{ "uniprot_canonical_ac": "P06748-1", "uniprot_ac": "P06748", "uniprot_id": "NPM_HUMAN", "mass": { "chemical_mass": 32575.0, "monoisotopic_mass": 32575.0 }, "refseq": { "ac": "NP_001032827", "name": "nucleophosmin isoform 3", "summary": "The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, "gene_names": [ { "name": "NPM1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06748", "id": "P06748" }, { "name": "B23; NPM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827", "id": "NP_001032827" }, { "name": "NPM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827", "id": "NP_001032827" }, { "name": "NPM", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06748", "id": "P06748" } ], "protein_names": [ { "name": "Nucleophosmin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06748" }, { "name": "NPM", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06748" }, { "name": "Nucleolar phosphoprotein B23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06748" }, { "name": "Nucleolar protein NO38", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06748" }, { "name": "Numatrin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06748" }, { "name": "nucleophosmin isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827", "id": "NP_001032827" }, { "name": "nucleophosmin/nucleoplasmin family, member 1; nucleolar protein NO38; testicular tissue protein Li 128; nucleophosmin (nucleolar phosphoprotein B23, numatrin)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827", "id": "NP_001032827" } ], "function": [ { "annotation": "DDX24 Mutation Alters NPM1 Phase Behavior and Disrupts Nucleolar Homeostasis in Vascular Malformations. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, { "database": "PubMed", "id": "37705750", "url": "https://glygen.org/publication/PubMed/37705750" } ] }, { "annotation": "Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. Antagonizes the inhibitory effect of ATF5 on cell proliferation and relieves ATF5-induced G2/M blockade (PubMed:22528486). In complex with MYC enhances the transcription of MYC target genes (PubMed:25956029). May act as chaperonin or cotransporter in the nucleolar localization of transcription termination factor TTF1 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748#function" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "UniProtKB", "id": "Q61937", "url": "https://www.uniprot.org/uniprot/Q61937#function" }, { "database": "PubMed", "id": "25956029", "url": "https://glygen.org/publication/PubMed/25956029" }, { "database": "PubMed", "id": "17015463", "url": "https://glygen.org/publication/PubMed/17015463" }, { "database": "PubMed", "id": "22002061", "url": "https://glygen.org/publication/PubMed/22002061" }, { "database": "PubMed", "id": "22528486", "url": "https://glygen.org/publication/PubMed/22528486" }, { "database": "PubMed", "id": "21084279", "url": "https://glygen.org/publication/PubMed/21084279" }, { "database": "PubMed", "id": "16107701", "url": "https://glygen.org/publication/PubMed/16107701" }, { "database": "PubMed", "id": "19188445", "url": "https://glygen.org/publication/PubMed/19188445" }, { "database": "PubMed", "id": "12882984", "url": "https://glygen.org/publication/PubMed/12882984" }, { "database": "PubMed", "id": "18809582", "url": "https://glygen.org/publication/PubMed/18809582" } ] }, { "annotation": "KLF2 transcription suppresses endometrial cancer cell proliferation, invasion, and migration through the inhibition of NPM1.", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, { "database": "PubMed", "id": "37610103", "url": "https://glygen.org/publication/PubMed/37610103" } ] }, { "annotation": "Pumilio1 regulates NPM3/NPM1 axis to promote PD-L1-mediated immune escape in gastric cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, { "database": "PubMed", "id": "38029539", "url": "https://glygen.org/publication/PubMed/38029539" } ] }, { "annotation": "The acetylation of STAT3 at K685 attenuates NPM-ALK-induced tumorigenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, { "database": "PubMed", "id": "38000524", "url": "https://glygen.org/publication/PubMed/38000524" } ] }, { "annotation": "The acidic stretch and the C-terminal nuclear export signal motif of NPM1 mutant: are they druggable in AML? Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" }, { "database": "PubMed", "id": "37740103", "url": "https://glygen.org/publication/PubMed/37740103" } ] }, { "annotation": "The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P06748", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06748" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 106, "end_pos": 106, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "171391764", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S106", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1467958614", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1467958614" }, { "id": "rs1467958614", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1467958614#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 112, "end_pos": 112, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "171391781", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761307473", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761307473" }, { "id": "rs761307473", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761307473" }, { "id": "rs761307473", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761307473" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 193, "end_pos": 193, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "5", "chr_pos": "171400207", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K193", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs944575847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs944575847" }, { "id": "rs944575847", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs944575847#frequency_tab" }, { "id": "rs944575847", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs944575847" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "5", "chr_pos": "171407735", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs944575847", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs944575847" }, { "id": "rs944575847", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs944575847#frequency_tab" }, { "id": "rs944575847", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs944575847" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "171407735", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1389753903", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1389753903" }, { "id": "rs1389753903", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1389753903" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 8, "end_pos": 8, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DMS->NMS).", "chr_id": "5", "chr_pos": "171387970", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D8", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 125, "end_pos": 125, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by PLK2.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "start_pos": 199, "end_pos": 199, "sequence_org": "T", "sequence_mut": "A", "comment": "Partial loss of phosphorylation. Does not affect phosphorylation by PLK2.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ] }, { "start_pos": 219, "end_pos": 219, "sequence_org": "T", "sequence_mut": "A", "comment": "Partial loss of phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ] }, { "start_pos": 234, "end_pos": 234, "sequence_org": "T", "sequence_mut": "A", "comment": "Partial loss of phosphorylation; when associated with A-237.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ] }, { "start_pos": 237, "end_pos": 237, "sequence_org": "T", "sequence_mut": "A", "comment": "Partial loss of phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ] }, { "start_pos": 248, "end_pos": 248, "sequence_org": "K", "sequence_mut": "A", "comment": "Partial destabilization of the structure.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 250, "end_pos": 250, "sequence_org": "K", "sequence_mut": "A", "comment": "Increase in the stabilization of the structure.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 263, "end_pos": 263, "sequence_org": "K", "sequence_mut": "A", "comment": "Increase in the stabilization of the structure and partial delocalization to the nucleoplasm. Complete delocalization to the nucleoplasm; when associated with A-267.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18259216", "url": "https://glygen.org/publication/PubMed/18259216" } ] }, { "start_pos": 263, "end_pos": 263, "sequence_org": "K", "sequence_mut": "R", "comment": "No change in the sumoylation level.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18259216", "url": "https://glygen.org/publication/PubMed/18259216" } ] }, { "start_pos": 267, "end_pos": 267, "sequence_org": "K", "sequence_mut": "A", "comment": "Increase in the stabilization of the structure and complete delocalization to the nucleoplasm. Complete delocalization to the nucleoplasm; when associated with A-263.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 268, "end_pos": 268, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete destabilization of the structure and loss of nucleolus localization; when associated with A-276.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 276, "end_pos": 276, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete destabilization of the structure and loss of nucleolus localization; when associated with A-268.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 288, "end_pos": 288, "sequence_org": "W", "sequence_mut": "A", "comment": "Complete destabilization of the structure; when associated with A-290.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 290, "end_pos": 290, "sequence_org": "W", "sequence_mut": "A", "comment": "Partial destabilization of the structure. Complete destabilization of the structure; when associated with A-288.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "start_pos": 4, "end_pos": 4, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation by PLK2 and impairs centriole duplication.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "start_pos": 4, "end_pos": 4, "sequence_org": "S", "sequence_mut": "D", "comment": "Mimicks phosphorylation state, inducing accumulation of centrioles.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "start_pos": 4, "end_pos": 4, "sequence_org": "S", "sequence_mut": "E", "comment": "Mimicks phosphorylation state, inducing accumulation of centrioles.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not affect phosphorylation by PLK2.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "95.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "91.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "85.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06748" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "common_name": "Human" } ], "gene": [ { "name": "NPM1", "url": "https://www.uniprot.org/uniprot/P06748", "locus": { "chromosome": "5", "start_pos": 28181, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_458", "url": "https://www.ensembl.org/id/LRG_458" } ] } } ], "crossref": [ { "id": "ENSG00000181163", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000181163", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P06748", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06748", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL5178", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5178", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NPM1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NPM1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4869", "url": "https://www.ncbi.nlm.nih.gov/gene/4869", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7910", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7910", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P06748", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06748*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004301", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004301", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032569", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032569", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036824", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036824", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4869", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4869", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "164040", "url": "http://www.omim.org/entry/164040", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06748", "url": "https://www.nextprot.org/entry/NX_P06748", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P06748", "url": "https://oglcnac.org/atlas/detail/P06748", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KNDEWIT", "url": "https://omabrowser.org/oma/group/KNDEWIT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5360624at2759", "url": "http://www.orthodb.org/?query=5360624at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22747", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22747", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22747:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22747:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2LLH", "url": "https://www.rcsb.org/structure/2LLH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2P1B", "url": "https://www.rcsb.org/structure/2P1B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VXD", "url": "https://www.rcsb.org/structure/2VXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EHD", "url": "https://www.rcsb.org/structure/5EHD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OBG", "url": "https://www.rcsb.org/structure/7OBG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OBH", "url": "https://www.rcsb.org/structure/7OBH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AH2", "url": "https://www.rcsb.org/structure/8AH2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AS5", "url": "https://www.rcsb.org/structure/8AS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03066", "url": "http://pfam.xfam.org/family/PF03066", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16276", "url": "http://pfam.xfam.org/family/PF16276", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06748", "url": "https://pharos.nih.gov/targets/P06748", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P06748", "url": "http://purl.obolibrary.org/obo/PR_P06748", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8869496", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8869496", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7I2V2X9", "url": "https://www.uniprot.org/uniprot/A0A7I2V2X9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2X9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2X9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3G5", "url": "https://www.uniprot.org/uniprot/A0A7I2V3G5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3G5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3G5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U2", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3U2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3U2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V433", "url": "https://www.uniprot.org/uniprot/A0A7I2V433", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V433-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V433-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4G8", "url": "https://www.uniprot.org/uniprot/A0A7I2V4G8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4G8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4G8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V579", "url": "https://www.uniprot.org/uniprot/A0A7I2V579", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V579-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V579-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5J8", "url": "https://www.uniprot.org/uniprot/A0A7I2V5J8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5J8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5J8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5S2", "url": "https://www.uniprot.org/uniprot/A0A7I2V5S2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5S2-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5S2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQC0", "url": "https://www.uniprot.org/uniprot/A0A7I2YQC0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQC0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQC0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGW4", "url": "https://www.uniprot.org/uniprot/E5RGW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGW4-1", "url": "https://www.uniprot.org/uniprot/E5RGW4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RI98", "url": "https://www.uniprot.org/uniprot/E5RI98", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RI98-1", "url": "https://www.uniprot.org/uniprot/E5RI98-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06748-1", "url": "https://www.uniprot.org/uniprot/P06748-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06748-2", "url": "https://www.uniprot.org/uniprot/P06748-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06748-3", "url": "https://www.uniprot.org/uniprot/P06748-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 294, "header": "sp|P06748-1|NPM_HUMAN Isoform 1 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 CANONICAL=P06748-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2X9-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEE", "length": 175, "header": "tr|A0A7I2V2X9-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171392979, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678774.1", "url": "https://www.ensembl.org/id/ENST00000678774.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503150.1", "url": "https://www.ensembl.org/id/ENSP00000503150.1" } ] } }, { "isoform_ac": "A0A7I2V3G5-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSWKPNSSIM", "length": 90, "header": "tr|A0A7I2V3G5-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171407742, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679190.1", "url": "https://www.ensembl.org/id/ENST00000679190.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503408.1", "url": "https://www.ensembl.org/id/ENSP00000503408.1" } ] } }, { "isoform_ac": "A0A7I2V3U2-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEEDKNPSRNRKKLLKHQKDLVL", "length": 195, "header": "tr|A0A7I2V3U2-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171405362, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679233.1", "url": "https://www.ensembl.org/id/ENST00000679233.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503717.1", "url": "https://www.ensembl.org/id/ENSP00000503717.1" } ] } }, { "isoform_ac": "A0A7I2V433-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQVEM", "length": 156, "header": "tr|A0A7I2V433-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171392825, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676613.1", "url": "https://www.ensembl.org/id/ENST00000676613.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503767.1", "url": "https://www.ensembl.org/id/ENSP00000503767.1" } ] } }, { "isoform_ac": "A0A7I2V4G8-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 123, "header": "tr|A0A7I2V4G8-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677297.1", "url": "https://www.ensembl.org/id/ENST00000677297.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504016.1", "url": "https://www.ensembl.org/id/ENSP00000504016.1" } ] } }, { "isoform_ac": "A0A7I2V579-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVRALTYFGCCVKV", "length": 99, "header": "tr|A0A7I2V579-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171391463, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678267.1", "url": "https://www.ensembl.org/id/ENST00000678267.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504107.1", "url": "https://www.ensembl.org/id/ENSP00000504107.1" } ] } }, { "isoform_ac": "A0A7I2V5J8-1", "url": "", "sequence": { "sequence": "MNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 201, "header": "tr|A0A7I2V5J8-1|A0A7I2V5J8_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171391359, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677907.1", "url": "https://www.ensembl.org/id/ENST00000677907.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504308.1", "url": "https://www.ensembl.org/id/ENSP00000504308.1" } ] } }, { "isoform_ac": "A0A7I2V5S2-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKFLACIHNLKEMGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 305, "header": "tr|A0A7I2V5S2-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677357.1", "url": "https://www.ensembl.org/id/ENST00000677357.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504740.1", "url": "https://www.ensembl.org/id/ENSP00000504740.1" } ] } }, { "isoform_ac": "A0A7I2YQC0-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKMCLASPLPSAMIVNFLWPPSHASYTAYSTGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 323, "header": "tr|A0A7I2YQC0-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676589.1", "url": "https://www.ensembl.org/id/ENST00000676589.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503283.1", "url": "https://www.ensembl.org/id/ENSP00000503283.1" } ] } }, { "isoform_ac": "E5RGW4-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNY", "length": 59, "header": "tr|E5RGW4-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=1 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171391367, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523622.1", "url": "https://www.ensembl.org/id/ENST00000523622.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428647.1", "url": "https://www.ensembl.org/id/ENSP00000428647.1" } ] } }, { "isoform_ac": "E5RI98-1", "url": "", "sequence": { "sequence": "MNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 230, "header": "tr|E5RI98-1|NPM_HUMAN Computationally mapped isoform of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171391359, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677325.1", "url": "https://www.ensembl.org/id/ENST00000677325.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503781.1", "url": "https://www.ensembl.org/id/ENSP00000503781.1" } ] } }, { "isoform_ac": "P06748-1", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 294, "header": "sp|P06748-1|NPM_HUMAN Isoform 1 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000517671.5", "url": "https://www.ensembl.org/id/ENST00000517671.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428755.1", "url": "https://www.ensembl.org/id/ENSP00000428755.1" } ] } }, { "isoform_ac": "P06748-2", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 265, "header": "sp|P06748-2|NPM_HUMAN Isoform 2 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171410562, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000351986.10", "url": "https://www.ensembl.org/id/ENST00000351986.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000341168.6", "url": "https://www.ensembl.org/id/ENSP00000341168.6" } ] } }, { "isoform_ac": "P06748-3", "url": "", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKAH", "length": 259, "header": "sp|P06748-3|NPM_HUMAN Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 CANONICAL=P06748-1" }, "locus": { "chromosome": "5", "start_pos": 171406402, "end_pos": 171387949, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393820.2", "url": "https://www.ensembl.org/id/ENST00000393820.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000377408.2", "url": "https://www.ensembl.org/id/ENSP00000377408.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 106, "start_aa": "Ser", "end_pos": 106, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser106", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 112, "start_aa": "Ser", "end_pos": 112, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser112", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 125, "start_aa": "Ser", "end_pos": 125, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser125", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 75, "start_aa": "Thr", "end_pos": 75, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr75", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 82, "start_aa": "Ser", "end_pos": 82, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser82", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 88, "start_aa": "Ser", "end_pos": 88, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser88", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "31637018", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31637018" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "34931806", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34931806" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 95, "start_aa": "Thr", "end_pos": 95, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr95", "evidence": [ { "id": "P06748", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P06748" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] } ], "phosphorylation": [ { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "PubMed", "id": "21472563", "url": "https://glygen.org/publication/PubMed/21472563" } ], "site_lbl": "Ser106" }, { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" } ], "site_lbl": "Ser10" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ], "site_lbl": "Ser112" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "O14965-1", "kinase_gene_name": "AURKA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "24857377", "url": "https://glygen.org/publication/PubMed/24857377" } ], "site_lbl": "Ser125" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "15082766", "url": "https://glygen.org/publication/PubMed/15082766" } ], "site_lbl": "Ser125" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK2", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "IntAct", "id": "P06748", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06748*" }, { "database": "PubMed", "id": "24857377", "url": "https://glygen.org/publication/PubMed/24857377" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "3944116", "url": "https://glygen.org/publication/PubMed/3944116" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" }, { "database": "PubMed", "id": "21472563", "url": "https://glygen.org/publication/PubMed/21472563" }, { "database": "PubMed", "id": "24867636", "url": "https://glygen.org/publication/PubMed/24867636" }, { "database": "PubMed", "id": "29806702", "url": "https://glygen.org/publication/PubMed/29806702" }, { "database": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" }, { "database": "PubMed", "id": "32606971", "url": "https://glygen.org/publication/PubMed/32606971" }, { "database": "PubMed", "id": "18318008", "url": "https://glygen.org/publication/PubMed/18318008" }, { "database": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser125" }, { "start_pos": 137, "end_pos": 137, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser137" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" } ], "site_lbl": "Ser139" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr17" }, { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser195" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" }, { "database": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" } ], "site_lbl": "Thr199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19933848", "url": "https://glygen.org/publication/PubMed/19933848" } ], "site_lbl": "Thr199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "11278991", "url": "https://glygen.org/publication/PubMed/11278991" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "Q00534-1", "kinase_gene_name": "CDK6", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18454140", "url": "https://glygen.org/publication/PubMed/18454140" }, { "database": "PubMed", "id": "20333249", "url": "https://glygen.org/publication/PubMed/20333249" } ], "site_lbl": "Thr199" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1, CDK2 and CDK6", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "11278991", "url": "https://glygen.org/publication/PubMed/11278991" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "16083285", "url": "https://glygen.org/publication/PubMed/16083285" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "7213797", "url": "https://glygen.org/publication/PubMed/7213797" }, { "database": "PubMed", "id": "16376875", "url": "https://glygen.org/publication/PubMed/16376875" }, { "database": "PubMed", "id": "16912078", "url": "https://glygen.org/publication/PubMed/16912078" }, { "database": "PubMed", "id": "17015463", "url": "https://glygen.org/publication/PubMed/17015463" }, { "database": "PubMed", "id": "17942908", "url": "https://glygen.org/publication/PubMed/17942908" }, { "database": "PubMed", "id": "18243139", "url": "https://glygen.org/publication/PubMed/18243139" }, { "database": "PubMed", "id": "20333249", "url": "https://glygen.org/publication/PubMed/20333249" }, { "database": "PubMed", "id": "20713529", "url": "https://glygen.org/publication/PubMed/20713529" }, { "database": "PubMed", "id": "20807181", "url": "https://glygen.org/publication/PubMed/20807181" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" }, { "database": "PubMed", "id": "21242972", "url": "https://glygen.org/publication/PubMed/21242972" }, { "database": "PubMed", "id": "24106084", "url": "https://glygen.org/publication/PubMed/24106084" }, { "database": "PubMed", "id": "24867636", "url": "https://glygen.org/publication/PubMed/24867636" }, { "database": "PubMed", "id": "25531824", "url": "https://glygen.org/publication/PubMed/25531824" }, { "database": "PubMed", "id": "25918010", "url": "https://glygen.org/publication/PubMed/25918010" }, { "database": "PubMed", "id": "26123729", "url": "https://glygen.org/publication/PubMed/26123729" }, { "database": "PubMed", "id": "26536659", "url": "https://glygen.org/publication/PubMed/26536659" }, { "database": "PubMed", "id": "26993766", "url": "https://glygen.org/publication/PubMed/26993766" }, { "database": "PubMed", "id": "27619510", "url": "https://glygen.org/publication/PubMed/27619510" }, { "database": "PubMed", "id": "28045037", "url": "https://glygen.org/publication/PubMed/28045037" }, { "database": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" }, { "database": "PubMed", "id": "31330844", "url": "https://glygen.org/publication/PubMed/31330844" }, { "database": "PubMed", "id": "33507833", "url": "https://glygen.org/publication/PubMed/33507833" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ], "site_lbl": "Thr199" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser217" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser218" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr219" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" }, { "database": "PubMed", "id": "24106084", "url": "https://glygen.org/publication/PubMed/24106084" } ], "site_lbl": "Thr219" }, { "start_pos": 222, "end_pos": 222, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser222" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "93076812", "url": "https://glygen.org/publication/PubMed/93076812" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "1446684", "url": "https://glygen.org/publication/PubMed/1446684" } ], "site_lbl": "Ser227" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "11278991", "url": "https://glygen.org/publication/PubMed/11278991" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "14670079", "url": "https://glygen.org/publication/PubMed/14670079" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ], "site_lbl": "Thr234" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ], "site_lbl": "Thr234" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "14670079", "url": "https://glygen.org/publication/PubMed/14670079" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" }, { "database": "PubMed", "id": "24106084", "url": "https://glygen.org/publication/PubMed/24106084" }, { "database": "PubMed", "id": "26536659", "url": "https://glygen.org/publication/PubMed/26536659" }, { "database": "PubMed", "id": "26993766", "url": "https://glygen.org/publication/PubMed/26993766" }, { "database": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Thr234" }, { "start_pos": 237, "end_pos": 237, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "11278991", "url": "https://glygen.org/publication/PubMed/11278991" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "14670079", "url": "https://glygen.org/publication/PubMed/14670079" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ], "site_lbl": "Thr237" }, { "start_pos": 237, "end_pos": 237, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "14670079", "url": "https://glygen.org/publication/PubMed/14670079" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" }, { "database": "PubMed", "id": "24106084", "url": "https://glygen.org/publication/PubMed/24106084" }, { "database": "PubMed", "id": "26536659", "url": "https://glygen.org/publication/PubMed/26536659" }, { "database": "PubMed", "id": "26993766", "url": "https://glygen.org/publication/PubMed/26993766" }, { "database": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ], "site_lbl": "Thr237" }, { "start_pos": 242, "end_pos": 242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "site_lbl": "Ser242" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" } ], "site_lbl": "Ser243" }, { "start_pos": 254, "end_pos": 254, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser254" }, { "start_pos": 260, "end_pos": 260, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser260" }, { "start_pos": 271, "end_pos": 271, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "33777934", "url": "https://glygen.org/publication/PubMed/33777934" } ], "site_lbl": "Tyr271" }, { "start_pos": 279, "end_pos": 279, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr279" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "33777934", "url": "https://glygen.org/publication/PubMed/33777934" } ], "site_lbl": "Tyr29" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser43" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr46" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "25071014", "url": "https://glygen.org/publication/PubMed/25071014" }, { "database": "PubMed", "id": "33073687", "url": "https://glygen.org/publication/PubMed/33073687" }, { "database": "PubMed", "id": "36041327", "url": "" } ], "site_lbl": "Ser48" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "P34947-1", "kinase_gene_name": "GRK5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "22467873", "url": "https://glygen.org/publication/PubMed/22467873" } ], "site_lbl": "Ser4" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" } ], "site_lbl": "Ser4" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "Q9NYY3-1", "kinase_gene_name": "PLK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" } ], "site_lbl": "Ser4" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PLK1 and PLK2", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PRO", "id": "P06748", "url": "http://purl.obolibrary.org/obo/P06748" }, { "database": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" }, { "database": "PubMed", "id": "27619510", "url": "https://glygen.org/publication/PubMed/27619510" }, { "database": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser4" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "33777934", "url": "https://glygen.org/publication/PubMed/33777934" } ], "site_lbl": "Tyr67" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19933706", "url": "https://glygen.org/publication/PubMed/19933706" } ], "site_lbl": "Ser70" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "19933706", "url": "https://glygen.org/publication/PubMed/19933706" } ], "site_lbl": "Ser70" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" } ], "site_lbl": "Ser70" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" } ], "site_lbl": "Thr75" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr78" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "33073687", "url": "https://glygen.org/publication/PubMed/33073687" } ], "site_lbl": "Ser88" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "phospho.ELM", "id": "P06748", "url": "http://phospho.elm.eu.org/byAccession/P06748.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "16041368", "url": "https://glygen.org/publication/PubMed/16041368" }, { "database": "PubMed", "id": "32686519", "url": "https://glygen.org/publication/PubMed/32686519" }, { "database": "PubMed", "id": "33073687", "url": "https://glygen.org/publication/PubMed/33073687" } ], "site_lbl": "Thr95" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Double-stranded-RNA-activated protein kinase PKR enhances transcriptional activation by tumor suppressor p53.", "journal": "Molecular and cellular biology", "date": "1999-04", "authors": "Cuddihy A R, Li S, Tam N W, Wong A H, Taya Y, Abraham N, Bell J C, Koromilas A E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10082513", "url": "https://glygen.org/publication/PubMed/10082513" } ] }, { "title": "A new fusion gene TPM3-ALK in anaplastic large cell lymphoma created by a (1;2)(q25;p23) translocation.", "journal": "Blood", "date": "1999", "authors": "Lamant L, Dastugue N, Pulford K, Delsol G, Mariame B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10216106", "url": "https://glygen.org/publication/PubMed/10216106" } ] }, { "title": "The double-stranded RNA activated protein kinase PKR physically associates with the tumor suppressor p53 protein and phosphorylates human p53 on serine 392 in vitro.", "journal": "Oncogene", "date": "1999", "authors": "Cuddihy AR, Wong AH, Tam NW, Li S, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10348343", "url": "https://glygen.org/publication/PubMed/10348343" } ] }, { "title": "DRBP76, a double-stranded RNA-binding nuclear protein, is phosphorylated by the interferon-induced protein kinase, PKR.", "journal": "The Journal of biological chemistry", "date": "1999-07-16", "authors": "Patel R C, Vestal D J, Xu Z, Bandyopadhyay S, Guo W, Erme S M, Williams B R, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10400669", "url": "https://glygen.org/publication/PubMed/10400669" } ] }, { "title": "TRK-fused gene (TFG) is a new partner of ALK in anaplastic large cell lymphoma producing two structurally different TFG-ALK translocations.", "journal": "Blood", "date": "1999", "authors": "Hernandez L, Pinyol M, Hernandez S, Bea S, Pulford K, Rosenwald A, Lamant L, Falini B, Ott G, Mason DY, Delsol G, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10556217", "url": "https://glygen.org/publication/PubMed/10556217" } ] }, { "title": "HIV-I TAT inhibits PKR activity by both RNA-dependent and RNA-independent mechanisms.", "journal": "Archives of biochemistry and biophysics", "date": "2000-01-15", "authors": "Cai R, Carpick B, Chun R F, Jeang K T, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10620360", "url": "https://glygen.org/publication/PubMed/10620360" } ] }, { "title": "JNK2 and IKKbeta are required for activating the innate response to viral infection.", "journal": "Immunity", "date": "1999-12", "authors": "Chu W M, Ostertag D, Li Z W, Chang L, Chen Y, Hu Y, Williams B, Perrault J, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10626894", "url": "https://glygen.org/publication/PubMed/10626894" } ] }, { "title": "NF-kappaB activation by double-stranded-RNA-activated protein kinase (PKR) is mediated through NF-kappaB-inducing kinase and IkappaB kinase.", "journal": "Molecular and cellular biology", "date": "2000-02", "authors": "Zamanian-Daryoush M, Mogensen T H, DiDonato J A, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10648614", "url": "https://glygen.org/publication/PubMed/10648614" } ] }, { "title": "ATIC-ALK: A novel variant ALK gene fusion in anaplastic large cell lymphoma resulting from the recurrent cryptic chromosomal inversion, inv(2)(p23q35).", "journal": "The American journal of pathology", "date": "2000", "authors": "Colleoni GW, Bridge JA, Garicochea B, Liu J, Filippa DA, Ladanyi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10702393", "url": "https://glygen.org/publication/PubMed/10702393" } ] }, { "title": "A new variant anaplastic lymphoma kinase (ALK)-fusion protein (ATIC-ALK) in a case of ALK-positive anaplastic large cell lymphoma.", "journal": "Cancer research", "date": "2000", "authors": "Trinei M, Lanfrancone L, Campo E, Pulford K, Mason DY, Pelicci PG, Falini B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10706082", "url": "https://glygen.org/publication/PubMed/10706082" } ] }, { "title": "Inv(2)(p23q35) in anaplastic large-cell lymphoma induces constitutive anaplastic lymphoma kinase (ALK) tyrosine kinase activation by fusion to ATIC, an enzyme involved in purine nucleotide biosynthesis.", "journal": "Blood", "date": "2000", "authors": "Ma Z, Cools J, Marynen P, Cui X, Siebert R, Gesk S, Schlegelberger B, Peeters B, De Wolf-Peeters C, Wlodarska I, Morris SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10706887", "url": "https://glygen.org/publication/PubMed/10706887" } ] }, { "title": "PKR stimulates NF-kappaB irrespective of its kinase function by interacting with the IkappaB kinase complex.", "journal": "Molecular and cellular biology", "date": "2000-07", "authors": "Bonnet M C, Weil R, Dam E, Hovanessian A G, Meurs E F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10848580", "url": "https://glygen.org/publication/PubMed/10848580" } ] }, { "title": "The B56alpha regulatory subunit of protein phosphatase 2A is a target for regulation by double-stranded RNA-dependent protein kinase PKR.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Xu Z, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "10866685", "url": "https://glygen.org/publication/PubMed/10866685" } ] }, { "title": "TPM3-ALK and TPM4-ALK oncogenes in inflammatory myofibroblastic tumors.", "journal": "The American journal of pathology", "date": "2000", "authors": "Lawrence B, Perez-Atayde A, Hibbard MK, Rubin BP, Dal Cin P, Pinkus JL, Pinkus GS, Xiao S, Yi ES, Fletcher CD, Fletcher JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "10934142", "url": "https://glygen.org/publication/PubMed/10934142" } ] }, { "title": "Nucleophosmin/B23 is a target of CDK2/cyclin E in centrosome duplication.", "journal": "Cell", "date": "2000", "authors": "Okuda M, Horn HF, Tarapore P, Tokuyama Y, Smulian AG, Chan PK, Knudsen ES, Hofmann IA, Snyder JD, Bove KE, Fukasawa K", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "11051553", "url": "https://glygen.org/publication/PubMed/11051553" } ] }, { "title": "A Role of RNA Helicase A in cis-Acting Transactivation Response Element-mediated Transcriptional Regulation of Human Immunodeficiency Virus Type 1.", "journal": "The Journal of biological chemistry", "date": "2001-02-23", "authors": "Fujii R, Okamoto M, Aratani S, Oishi T, Ohshima T, Taira K, Baba M, Fukamizu A, Nakajima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11096080", "url": "https://glygen.org/publication/PubMed/11096080" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase associated with anaplastic large-cell lymphoma activates the phosphatidylinositol 3-kinase/Akt antiapoptotic signaling pathway.", "journal": "Blood", "date": "2000", "authors": "Bai RY, Ouyang T, Miething C, Morris SW, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11110708", "url": "https://glygen.org/publication/PubMed/11110708" } ] }, { "title": "Functional characterization of and cooperation between the double-stranded RNA-binding motifs of the protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2001-03-30", "authors": "Tian B, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11134010", "url": "https://glygen.org/publication/PubMed/11134010" } ] }, { "title": "Hepatitis C virus envelope protein E2 does not inhibit PKR by simple competition with autophosphorylation sites in the RNA-binding domain.", "journal": "Journal of virology", "date": "2001", "authors": "Taylor DR, Tian B, Romano PR, Hinnebusch AG, Lai MM, Mathews MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11152499", "url": "https://glygen.org/publication/PubMed/11152499" } ] }, { "title": "Identification of the interferon-inducible double-stranded RNA-dependent protein kinase as a regulator of cellular response to bulky adducts.", "journal": "Cancer research", "date": "2000-12-15", "authors": "Bergeron J, Benlimame N, Zeng-Rong N, Xiao D, Scrivens P J, Koromilas A E, Alaoui-Jamali M A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11156368", "url": "https://glygen.org/publication/PubMed/11156368" } ] }, { "title": "Induction, binding specificity and function of human ICOS.", "journal": "European journal of immunology", "date": "2000", "authors": "Beier KC, Hutloff A, Dittrich AM, Heuck C, Rauch A, Buchner K, Ludewig B, Ochs HD, Mages HW, Kroczek RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "11169414", "url": "https://glygen.org/publication/PubMed/11169414" } ] }, { "title": "Role of double-stranded RNA-dependent protein kinase in mediating hypersensitivity of Fanconi anemia complementation group C cells to interferon gamma, tumor necrosis factor-alpha, and double-stranded RNA.", "journal": "Blood", "date": "2001-03-15", "authors": "Pang Q, Keeble W, Diaz J, Christianson T A, Fagerlie S, Rathbun K, Faulkner G R, O'Dwyer M, Bagby G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11238103", "url": "https://glygen.org/publication/PubMed/11238103" } ] }, { "title": "Modular structure of PACT: distinct domains for binding and activating PKR.", "journal": "Molecular and cellular biology", "date": "2001-03", "authors": "Peters G A, Hartmann R, Qin J, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11238927", "url": "https://glygen.org/publication/PubMed/11238927" } ] }, { "title": "Enhanced antiviral and antiproliferative properties of a STAT1 mutant unable to interact with the protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2001-04-27", "authors": "Wong A H, Durbin J E, Li S, Dever T E, Decker T, Koromilas A E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11278865", "url": "https://glygen.org/publication/PubMed/11278865" } ] }, { "title": "Specific phosphorylation of nucleophosmin on Thr(199) by cyclin-dependent kinase 2-cyclin E and its role in centrosome duplication.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tokuyama Y, Horn HF, Kawamura K, Tarapore P, Fukasawa K", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "11278991", "url": "https://glygen.org/publication/PubMed/11278991" } ] }, { "title": "Role of phosphatidylinositol 3-kinase-Akt pathway in nucleophosmin/anaplastic lymphoma kinase-mediated lymphomagenesis.", "journal": "Cancer research", "date": "2001", "authors": "Slupianek A, Nieborowska-Skorska M, Hoser G, Morrione A, Majewski M, Xue L, Morris SW, Wasik MA, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11280786", "url": "https://glygen.org/publication/PubMed/11280786" } ] }, { "title": "The nucleolar phosphoprotein B23 interacts with hepatitis delta antigens and modulates the hepatitis delta virus RNA replication.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Huang W H, Yung B Y, Syu W J, Lee Y H", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "11309377", "url": "https://glygen.org/publication/PubMed/11309377" } ] }, { "title": "Molecular characterization of a new ALK translocation involving moesin (MSN-ALK) in anaplastic large cell lymphoma.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2001", "authors": "Tort F, Pinyol M, Pulford K, Roncador G, Hernandez L, Nayach I, Kluin-Nelemans HC, Kluin P, Touriol C, Delsol G, Mason D, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11310834", "url": "https://glygen.org/publication/PubMed/11310834" } ] }, { "title": "The catalytic activity of dsRNA-dependent protein kinase, PKR, is required for NF-kappaB activation.", "journal": "Oncogene", "date": "2001-01-18", "authors": "Gil J, Rullas J, Garc\u00eda M A, Alcam\u00ed J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11313968", "url": "https://glygen.org/publication/PubMed/11313968" } ] }, { "title": "Binding of double-stranded RNA to protein kinase PKR is required for dimerization and promotes critical autophosphorylation events in the activation loop.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zhang F, Romano PR, Nagamura-Inoue T, Tian B, Dever TE, Mathews MB, Ozato K, Hinnebusch AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11337501", "url": "https://glygen.org/publication/PubMed/11337501" } ] }, { "title": "Protein kinase PKR is required for platelet-derived growth factor signaling of c-fos gene expression via Erks and Stat3.", "journal": "The EMBO journal", "date": "2001", "authors": "Deb A, Zamanian-Daryoush M, Xu Z, Kadereit S, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11350938", "url": "https://glygen.org/publication/PubMed/11350938" } ] }, { "title": "Nuclear factor 90 is a substrate and regulator of the eukaryotic initiation factor 2 kinase double-stranded RNA-activated protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001-08-31", "authors": "Parker L M, Fierro-Monti I, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11438540", "url": "https://glygen.org/publication/PubMed/11438540" } ] }, { "title": "DJ-1 positively regulates the androgen receptor by impairing the binding of PIASx alpha to the receptor.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Takahashi K, Taira T, Niki T, Seino C, Iguchi-Ariga SM, Ariga H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "11477070", "url": "https://glygen.org/publication/PubMed/11477070" } ] }, { "title": "FANCC interacts with Hsp70 to protect hematopoietic cells from IFN-gamma/TNF-alpha-mediated cytotoxicity.", "journal": "The EMBO journal", "date": "2001-08-15", "authors": "Pang Q, Keeble W, Christianson T A, Faulkner G R, Bagby G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11500375", "url": "https://glygen.org/publication/PubMed/11500375" } ] }, { "title": "A phosphatidylinositol 3-kinase/Akt pathway promotes translocation of Mdm2 from the cytoplasm to the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Mayo LD, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11504915", "url": "https://glygen.org/publication/PubMed/11504915" } ] }, { "title": "Multilevel dysregulation of STAT3 activation in anaplastic lymphoma kinase-positive T/null-cell lymphoma.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Zhang Q, Raghunath PN, Xue L, Majewski M, Carpentieri DF, Odum N, Morris S, Skorski T, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "11751994", "url": "https://glygen.org/publication/PubMed/11751994" } ] }, { "title": "Double-stranded RNA-dependent protein kinase, PKR, down-regulates CDC2/cyclin B1 and induces apoptosis in non-transformed but not in v-mos transformed cells.", "journal": "Oncogene", "date": "2001-12-06", "authors": "Dagon Y, Dovrat S, Vilchik S, Hacohen D, Shlomo G, Sredni B, Salzberg S, Nir U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11781817", "url": "https://glygen.org/publication/PubMed/11781817" } ] }, { "title": "The human BTG2/TIS21/PC3 gene: genomic structure, transcriptional regulation and evaluation as a candidate tumor suppressor gene.", "journal": "Gene", "date": "2002", "authors": "Duriez C, Falette N, Audoynaud C, Moyret-Lalle C, Bensaad K, Courtois S, Wang Q, Soussi T, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11814693", "url": "https://glygen.org/publication/PubMed/11814693" } ] }, { "title": "The insulin-sensitive glucose transporter, GLUT4, interacts physically with Daxx. Two proteins with capacity to bind Ubc9 and conjugated to SUMO1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lalioti VS, Vergarajauregui S, Pulido D, Sandoval IV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "11842083", "url": "https://glygen.org/publication/PubMed/11842083" } ] }, { "title": "Anaplastic lymphoma kinase (ALK) activates Stat3 and protects hematopoietic cells from cell death.", "journal": "Oncogene", "date": "2002", "authors": "Zamo A, Chiarle R, Piva R, Howes J, Fan Y, Chilosi M, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11850821", "url": "https://glygen.org/publication/PubMed/11850821" } ] }, { "title": "A positive feedback mechanism in the transcriptional activation of Apaf-1 by p53 and the coactivator Zac-1.", "journal": "Oncogene", "date": "2002", "authors": "Rozenfeld-Granot G, Krishnamurthy J, Kannan K, Toren A, Amariglio N, Givol D, Rechavi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11896574", "url": "https://glygen.org/publication/PubMed/11896574" } ] }, { "title": "Gene-specific regulation by general translation factors.", "journal": "Cell", "date": "2002-02-22", "authors": "Dever Thomas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11909525", "url": "https://glygen.org/publication/PubMed/11909525" } ] }, { "title": "Inactivation of the PKR protein kinase and stimulation of mRNA translation by the cellular co-chaperone P58(IPK) does not require J domain function.", "journal": "Biochemistry", "date": "2002-04-16", "authors": "Yan Wei, Gale Michael J, Tan Seng-Lai, Katze Michael G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11939789", "url": "https://glygen.org/publication/PubMed/11939789" } ] }, { "title": "Diversity of genomic breakpoints in TFG-ALK translocations in anaplastic large cell lymphomas: identification of a new TFG-ALK(XL) chimeric gene with transforming activity.", "journal": "The American journal of pathology", "date": "2002", "authors": "Hernandez L, Bea S, Bellosillo B, Pinyol M, Falini B, Carbone A, Ott G, Rosenwald A, Fernandez A, Pulford K, Mason D, Morris SW, Santos E, Campo E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11943732", "url": "https://glygen.org/publication/PubMed/11943732" } ] }, { "title": "The C-terminal, third conserved motif of the protein activator PACT plays an essential role in the activation of double-stranded-RNA-dependent protein kinase (PKR).", "journal": "The Biochemical journal", "date": "2002-08-15", "authors": "Huang Xu, Hutchins Brian, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "11985496", "url": "https://glygen.org/publication/PubMed/11985496" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "The RNA binding activity of a ribosome biogenesis factor, nucleophosmin/B23, is modulated by phosphorylation with a cell cycle-dependent kinase and by association with its subtype.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Okuwaki M, Tsujimoto M, Nagata K", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" } ] }, { "title": "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor.", "journal": "Genes, chromosomes & cancer", "date": "2002", "authors": "Cools J, Wlodarska I, Somers R, Mentens N, Pedeutour F, Maes B, De Wolf-Peeters C, Pauwels P, Hagemeijer A, Marynen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12112524", "url": "https://glygen.org/publication/PubMed/12112524" } ] }, { "title": "Modification of Daxx by small ubiquitin-related modifier-1.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Jang MS, Ryu SW, Kim E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "12150977", "url": "https://glygen.org/publication/PubMed/12150977" } ] }, { "title": "Activation of anaplastic lymphoma kinase is responsible for hyperphosphorylation of ShcC in neuroblastoma cell lines.", "journal": "Oncogene", "date": "2002", "authors": "Miyake I, Hakomori Y, Shinohara A, Gamou T, Saito M, Iwamatsu A, Sakai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12185581", "url": "https://glygen.org/publication/PubMed/12185581" } ] }, { "title": "The role of nucleophosmin in centrosome duplication.", "journal": "Oncogene", "date": "2002", "authors": "Okuda Masaru", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "12214246", "url": "https://glygen.org/publication/PubMed/12214246" } ] }, { "title": "Contribution of double-stranded RNA-activated protein kinase toward antiproliferative actions of heparin on vascular smooth muscle cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2002-09-01", "authors": "Patel Rekha C, Handy Indhira, Patel Chandrashekhar V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12231563", "url": "https://glygen.org/publication/PubMed/12231563" } ] }, { "title": "The anti-apoptotic function of Hsp70 in the interferon-inducible double-stranded RNA-dependent protein kinase-mediated death signaling pathway requires the Fanconi anemia protein, FANCC.", "journal": "The Journal of biological chemistry", "date": "2002-12-20", "authors": "Pang Qishen, Christianson Tracy A, Keeble Winifred, Koretsky Tara, Bagby Grover C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12397061", "url": "https://glygen.org/publication/PubMed/12397061" } ] }, { "title": "NPM-ALK transgenic mice spontaneously develop T-cell lymphomas and plasma cell tumors.", "journal": "Blood", "date": "2003", "authors": "Chiarle R, Gong JZ, Guasparri I, Pesci A, Cai J, Liu J, Simmons WJ, Dhall G, Howes J, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12424201", "url": "https://glygen.org/publication/PubMed/12424201" } ] }, { "title": "Functional proteomic analysis of human nucleolus.", "journal": "Mol. Biol. Cell", "date": "2002", "authors": "Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "12429849", "url": "https://glygen.org/publication/PubMed/12429849" } ] }, { "title": "Sumoylation of the progesterone receptor and of the steroid receptor coactivator SRC-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chauchereau A, Amazit L, Quesne M, Guiochon-Mantel A, Milgrom E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "12529333", "url": "https://glygen.org/publication/PubMed/12529333" } ] }, { "title": "The polycomb protein Pc2 is a SUMO E3.", "journal": "Cell", "date": "2003", "authors": "Kagey MH, Melhuish TA, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "12679040", "url": "https://glygen.org/publication/PubMed/12679040" } ] }, { "title": "P300 transcriptional repression is mediated by SUMO modification.", "journal": "Molecular cell", "date": "2003", "authors": "Girdwood D, Bumpass D, Vaughan OA, Thain A, Anderson LA, Snowden AW, Garcia-Wilson E, Perkins ND, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "12718889", "url": "https://glygen.org/publication/PubMed/12718889" } ] }, { "title": "Identification and characterization of a nuclear interacting partner of anaplastic lymphoma kinase (NIPA).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ouyang T, Bai RY, Bassermann F, von Klitzing C, Klumpen S, Miething C, Morris SW, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "12748172", "url": "https://glygen.org/publication/PubMed/12748172" } ] }, { "title": "ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma.", "journal": "Blood", "date": "2003", "authors": "De Paepe P, Baens M, van Krieken H, Verhasselt B, Stul M, Simons A, Poppe B, Laureys G, Brons P, Vandenberghe P, Speleman F, Praet M, De Wolf-Peeters C, Marynen P, Wlodarska I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12750159", "url": "https://glygen.org/publication/PubMed/12750159" } ] }, { "title": "Non-muscle myosin heavy chain (MYH9): a new partner fused to ALK in anaplastic large cell lymphoma.", "journal": "Genes, chromosomes & cancer", "date": "2003", "authors": "Lamant L, Gascoyne RD, Duplantier MM, Armstrong F, Raghab A, Chhanabhai M, Rajcan-Separovic E, Raghab J, Delsol G, Espinos E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12800156", "url": "https://glygen.org/publication/PubMed/12800156" } ] }, { "title": "Nucleophosmin interacts with and inhibits the catalytic function of eukaryotic initiation factor 2 kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Pang Q, Christianson TA, Koretsky T, Carlson H, David L, Keeble W, Faulkner GR, Speckhart A, Bagby GC", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "12882984", "url": "https://glygen.org/publication/PubMed/12882984" } ] }, { "title": "Silencing of the novel p53 target gene Snk/Plk2 leads to mitotic catastrophe in paclitaxel (taxol)-exposed cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Burns TF, Fei P, Scata KA, Dicker DT, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "12897130", "url": "https://glygen.org/publication/PubMed/12897130" } ] }, { "title": "ALK+, CD30-, CD20- large B-cell lymphoma containing anaplastic lymphoma kinase (ALK) fused to clathrin heavy chain gene (CLTC).", "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc", "date": "2003", "authors": "Chikatsu N, Kojima H, Suzukawa K, Shinagawa A, Nagasawa T, Ozawa H, Yamashita Y, Mori N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12920229", "url": "https://glygen.org/publication/PubMed/12920229" } ] }, { "title": "Inhibition of JAK3 induces apoptosis and decreases anaplastic lymphoma kinase activity in anaplastic large cell lymphoma.", "journal": "Oncogene", "date": "2003", "authors": "Amin HM, Medeiros LJ, Ma Y, Feretzaki M, Das P, Leventaki V, Rassidakis GZ, O'Connor SL, McDonnell TJ, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "12934099", "url": "https://glygen.org/publication/PubMed/12934099" } ] }, { "title": "Identification of the double-stranded RNA-binding domain of the human interferon-inducible protein kinase.", "journal": "The Journal of biological chemistry", "date": "1992-04-15", "authors": "Patel R C, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "1373135", "url": "https://glygen.org/publication/PubMed/1373135" } ] }, { "title": "Nuclear substrates of protein kinase C.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Beckmann R, Buchner K, Jungblut PR, Eckerskorn C, Weise C, Hilbert R, Hucho F", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "1446684", "url": "https://glygen.org/publication/PubMed/1446684" } ] }, { "title": "The carboxy-terminal, M3 motifs of PACT and TRBP have opposite effects on PKR activity.", "journal": "Virology", "date": "2003-10-25", "authors": "Gupta Vishal, Huang Xu, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "14585331", "url": "https://glygen.org/publication/PubMed/14585331" } ] }, { "title": "Proteomic characterization of the human centrosome by protein correlation profiling.", "journal": "Nature", "date": "2003", "authors": "Andersen Jens S, Wilkinson Christopher J, Mayor Thibault, Mortensen Peter, Nigg Erich A, Mann Matthias", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "14654843", "url": "https://glygen.org/publication/PubMed/14654843" } ] }, { "title": "Phosphorylation regulates nucleophosmin targeting to the centrosome during mitosis as detected by cross-reactive phosphorylation-specific MKK1/MKK2 antibodies.", "journal": "The Biochemical journal", "date": "2004", "authors": "Cha H, Hancock C, Dangi S, Maiguel D, Carrier F, Shapiro P", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "14670079", "url": "https://glygen.org/publication/PubMed/14670079" } ] }, { "title": "NPM-ALK fusion kinase of anaplastic large-cell lymphoma regulates survival and proliferative signaling through modulation of FOXO3a.", "journal": "Blood", "date": "2004", "authors": "Gu TL, Tothova Z, Scheijen B, Griffin JD, Gilliland DG, Sternberg DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "14962911", "url": "https://glygen.org/publication/PubMed/14962911" } ] }, { "title": "Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation.", "journal": "Oncogene", "date": "2004", "authors": "Bahassi el M, Hennigan RF, Myer DL, Stambrook PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "14968113", "url": "https://glygen.org/publication/PubMed/14968113" } ] }, { "title": "Nucleophosmin sets a threshold for p53 response to UV radiation.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Maiguel DA, Jones L, Chakravarty D, Yang C, Carrier F", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "15082766", "url": "https://glygen.org/publication/PubMed/15082766" } ] }, { "title": "Stabilization of Mdm2 via decreased ubiquitination is mediated by protein kinase B/Akt-dependent phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Feng J, Tamaskovic R, Yang Z, Brazil DP, Merlo A, Hess D, Hemmings BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15169778", "url": "https://glygen.org/publication/PubMed/15169778" } ] }, { "title": "B23/nucleophosmin serine 4 phosphorylation mediates mitotic functions of polo-like kinase 1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang H, Shi X, Paddon H, Hampong M, Dai W, Pelech S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" } ] }, { "title": "Differential effects of X-ALK fusion proteins on proliferation, transformation, and invasion properties of NIH3T3 cells.", "journal": "Oncogene", "date": "2004", "authors": "Armstrong F, Duplantier MM, Trempat P, Hieblot C, Lamant L, Espinos E, Racaud-Sultan C, Allouche M, Campo E, Delsol G, Touriol C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15208656", "url": "https://glygen.org/publication/PubMed/15208656" } ] }, { "title": "Protein kinase R (PKR) interacts with and activates mitogen-activated protein kinase kinase 6 (MKK6) in response to double-stranded RNA stimulation.", "journal": "The Journal of biological chemistry", "date": "2004-09-03", "authors": "Silva Arist\u00f3bolo M, Whitmore Mark, Xu Zan, Jiang Zhengfan, Li Xiaoxia, Williams Bryan R G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15229216", "url": "https://glygen.org/publication/PubMed/15229216" } ] }, { "title": "The Fanconi anemia proteins functionally interact with the protein kinase regulated by RNA (PKR).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang X, Li J, Sejas DP, Rathbun KR, Bagby GC, Pang Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15299030", "url": "https://glygen.org/publication/PubMed/15299030" } ] }, { "title": "Mis16 and Mis18 are required for CENP-A loading and histone deacetylation at centromeres.", "journal": "Cell", "date": "2004", "authors": "Hayashi T, Fujita Y, Iwasaki O, Adachi Y, Takahashi K, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "15369671", "url": "https://glygen.org/publication/PubMed/15369671" } ] }, { "title": "Inhibition of Akt increases p27Kip1 levels and induces cell cycle arrest in anaplastic large cell lymphoma.", "journal": "Blood", "date": "2005", "authors": "Rassidakis GZ, Feretzaki M, Atwell C, Grammatikakis I, Lin Q, Lai R, Claret FX, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15374880", "url": "https://glygen.org/publication/PubMed/15374880" } ] }, { "title": "Nek2A kinase regulates the localization of numatrin to centrosome in mitosis.", "journal": "FEBS letters", "date": "2004", "authors": "Yao J, Fu C, Ding X, Guo Z, Zenreski A, Chen Y, Ahmed K, Liao J, Dou Z, Yao X", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "15388344", "url": "https://glygen.org/publication/PubMed/15388344" } ] }, { "title": "NPM/ALK downregulates p27Kip1 in a PI-3K-dependent manner.", "journal": "Experimental hematology", "date": "2004", "authors": "Slupianek A, Skorski T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15588951", "url": "https://glygen.org/publication/PubMed/15588951" } ] }, { "title": "Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype.", "journal": "N. Engl. J. Med.", "date": "2005", "authors": "Falini Brunangelo, Mecucci Cristina, Tiacci Enrico, Alcalay Myriam, Rosati Roberto, Pasqualucci Laura, La Starza Roberta, Diverio Daniela, Colombo Emanuela, Santucci Antonella, Bigerna Barbara, Pacini Roberta, Pucciarini Alessandra, Liso Arcangelo, Vignetti Marco, Fazi Paola, Meani Natalia, Pettirossi Valentina, Saglio Giuseppe, Mandelli Franco, Lo-Coco Francesco, Pelicci Pier-Giuseppe, Martelli Massimo F,", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "15659725", "url": "https://glygen.org/publication/PubMed/15659725" } ] }, { "title": "Overexpression of RGC-32 in colon cancer and other tumors.", "journal": "Experimental and molecular pathology", "date": "2005", "authors": "Fosbrink M, Cudrici C, Niculescu F, Badea TC, David S, Shamsuddin A, Shin ML, Rus H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "15713436", "url": "https://glygen.org/publication/PubMed/15713436" } ] }, { "title": "Phosphorylation of HIV Tat by PKR increases interaction with TAR RNA and enhances transcription.", "journal": "Virology journal", "date": "2005-02-28", "authors": "Endo-Munoz Liliana, Warby Tammra, Harrich David, McMillan Nigel A J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15737233", "url": "https://glygen.org/publication/PubMed/15737233" } ] }, { "title": "Identification of the heparin-binding domains of the interferon-induced protein kinase, PKR.", "journal": "The FEBS journal", "date": "2005-03", "authors": "Fasciano Stephen, Hutchins Brian, Handy Indhira, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15752359", "url": "https://glygen.org/publication/PubMed/15752359" } ] }, { "title": "Covalent modification of human homeodomain interacting protein kinase 2 by SUMO-1 at lysine 25 affects its stability.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Gresko E, Moller A, Roscic A, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "15766567", "url": "https://glygen.org/publication/PubMed/15766567" } ] }, { "title": "RPGR ORF15 isoform co-localizes with RPGRIP1 at centrioles and basal bodies and interacts with nucleophosmin.", "journal": "Hum. Mol. Genet.", "date": "2005", "authors": "Shu X, Fry A M, Tulloch B, Manson F D C, Crabb J W, Khanna H, Faragher A J, Lennon A, He S, Trojan P, Giessl A, Wolfrum U, Vervoort R, Swaroop A, Wright A F", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "15772089", "url": "https://glygen.org/publication/PubMed/15772089" } ] }, { "title": "The nucleocapsid protein of SARS coronavirus has a high binding affinity to the human cellular heterogeneous nuclear ribonucleoprotein A1.", "journal": "FEBS letters", "date": "2005", "authors": "Luo H, Chen Q, Chen J, Chen K, Shen X, Jiang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914" } ], "reference": [ { "type": "PubMed", "id": "15862300", "url": "https://glygen.org/publication/PubMed/15862300" } ] }, { "title": "Stat3 is required for ALK-mediated lymphomagenesis and provides a possible therapeutic target.", "journal": "Nature medicine", "date": "2005", "authors": "Chiarle R, Simmons WJ, Cai H, Dhall G, Zamo A, Raz R, Karras JG, Levy DE, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "15895073", "url": "https://glygen.org/publication/PubMed/15895073" } ] }, { "title": "Sumoylation induced by the Arf tumor suppressor: a p53-independent function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Tago K, Chiocca S, Sherr CJ", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "15897463", "url": "https://glygen.org/publication/PubMed/15897463" } ] }, { "title": "Mechanisms for HIV Tat upregulation of IL-10 and other cytokine expression: kinase signaling and PKR-mediated immune response.", "journal": "FEBS letters", "date": "2005-06-06", "authors": "Li James C B, Lee Davy C W, Cheung Benny K W, Lau Allan S Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "15907845", "url": "https://glygen.org/publication/PubMed/15907845" } ] }, { "title": "Regulation of homeodomain-interacting protein kinase 2 (HIPK2) effector function through dynamic small ubiquitin-related modifier-1 (SUMO-1) modification.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hofmann TG, Jaffray E, Stollberg N, Hay RT, Will H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "15958389", "url": "https://glygen.org/publication/PubMed/15958389" } ] }, { "title": "Proper SUMO-1 conjugation is essential to DJ-1 to exert its full activities.", "journal": "Cell death and differentiation", "date": "2006", "authors": "Shinbo Y, Niki T, Taira T, Ooe H, Takahashi-Niki K, Maita C, Seino C, Iguchi-Ariga SM, Ariga H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "15976810", "url": "https://glygen.org/publication/PubMed/15976810" } ] }, { "title": "NIPA defines an SCF-type mammalian E3 ligase that regulates mitotic entry.", "journal": "Cell", "date": "2005", "authors": "Bassermann F, von Klitzing C, Munch S, Bai RY, Kawaguchi H, Morris SW, Peschel C, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "16009132", "url": "https://glygen.org/publication/PubMed/16009132" } ] }, { "title": "Temporal and spatial control of nucleophosmin by the Ran-Crm1 complex in centrosome duplication.", "journal": "Nature cell biology", "date": "2005", "authors": "Wang W, Budhu A, Forgues M, Wang XW", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "16041368", "url": "https://glygen.org/publication/PubMed/16041368" } ] }, { "title": "Global phosphoproteome of HT-29 human colon adenocarcinoma cells.", "journal": "Journal of proteome research", "date": "2005", "authors": "Kim JE, Tannenbaum SR, White FM", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "16083285", "url": "https://glygen.org/publication/PubMed/16083285" } ] }, { "title": "Transcriptional activity of megakaryoblastic leukemia 1 (MKL1) is repressed by SUMO modification.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Nakagawa K, Kuzumaki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "16098147", "url": "https://glygen.org/publication/PubMed/16098147" } ] }, { "title": "Human histone chaperone nucleophosmin enhances acetylation-dependent chromatin transcription.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Swaminathan V, Kishore AH, Febitha KK, Kundu TK", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "16107701", "url": "https://glygen.org/publication/PubMed/16107701" } ] }, { "title": "Identification of novel p53 target genes in ionizing radiation response.", "journal": "Cancer research", "date": "2005", "authors": "Jen KY, Cheung VG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16140933", "url": "https://glygen.org/publication/PubMed/16140933" } ] }, { "title": "Jak3 activation is significantly associated with ALK expression in anaplastic large cell lymphoma.", "journal": "Human pathology", "date": "2005", "authors": "Lai R, Rassidakis GZ, Lin Q, Atwell C, Medeiros LJ, Amin HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16153455", "url": "https://glygen.org/publication/PubMed/16153455" } ] }, { "title": "Transcriptional silencing of Polo-like kinase 2 (SNK/PLK2) is a frequent event in B-cell malignancies.", "journal": "Blood", "date": "2006", "authors": "Syed N, Smith P, Sullivan A, Spender LC, Dyer M, Karran L, O'Nions J, Allday M, Hoffmann I, Crawford D, Griffin B, Farrell PJ, Crook T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16160013", "url": "https://glygen.org/publication/PubMed/16160013" } ] }, { "title": "Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor.", "journal": "International journal of cancer", "date": "2006", "authors": "Panagopoulos I, Nilsson T, Domanski HA, Isaksson M, Lindblom P, Mertens F, Mandahl N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16161041", "url": "https://glygen.org/publication/PubMed/16161041" } ] }, { "title": "Inhibition of ALK enzymatic activity in T-cell lymphoma cells induces apoptosis and suppresses proliferation and STAT3 phosphorylation independently of Jak3.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2005", "authors": "Marzec M, Kasprzycka M, Ptasznik A, Wlodarski P, Zhang Q, Odum N, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16170336", "url": "https://glygen.org/publication/PubMed/16170336" } ] }, { "title": "Higher-order substrate recognition of eIF2alpha by the RNA-dependent protein kinase PKR.", "journal": "Cell", "date": "2005", "authors": "Dar AC, Dever TE, Sicheri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16179258", "url": "https://glygen.org/publication/PubMed/16179258" } ] }, { "title": "Mechanistic link between PKR dimerization, autophosphorylation, and eIF2alpha substrate recognition.", "journal": "Cell", "date": "2005", "authors": "Dey M, Cao C, Dar AC, Tamura T, Ozato K, Sicheri F, Dever TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16179259", "url": "https://glygen.org/publication/PubMed/16179259" } ] }, { "title": "Tyrosine phosphorylation acts as a molecular switch to full-scale activation of the eIF2alpha RNA-dependent protein kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Su Q, Wang S, Baltzis D, Qu LK, Wong AH, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16373505", "url": "https://glygen.org/publication/PubMed/16373505" } ] }, { "title": "Thr199 phosphorylation targets nucleophosmin to nuclear speckles and represses pre-mRNA processing.", "journal": "FEBS letters", "date": "2006", "authors": "Tarapore P, Shinmura K, Suzuki H, Tokuyama Y, Kim SH, Mayeda A, Fukasawa K", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "16376875", "url": "https://glygen.org/publication/PubMed/16376875" } ] }, { "title": "Global identification of O-GlcNAc-modified proteins.", "journal": "Analytical chemistry", "date": "2006", "authors": "Nandi A, Sprung R, Barma DK, Zhao Y, Kim SC, Falck JR, Zhao Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "16408927", "url": "https://glygen.org/publication/PubMed/16408927" } ] }, { "title": "The catalytic activity of the eukaryotic initiation factor-2alpha kinase PKR is required to negatively regulate Stat1 and Stat3 via activation of the T-cell protein-tyrosine phosphatase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wang S, Raven JF, Baltzis D, Kazemi S, Brunet DV, Hatzoglou M, Tremblay ML, Koromilas AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16431927", "url": "https://glygen.org/publication/PubMed/16431927" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Cytoplasmic nucleophosmin in myeloid sarcoma occurring 20 years after diagnosis of acute myeloid leukaemia.", "journal": "Lancet Oncol.", "date": "2006", "authors": "Bolli Niccol\u00f2, Galimberti Sara, Martelli Maria P, Tabarrini Alessia, Roti Giovanni, Mecucci Cristina, Martelli Massimo F, Petrini Mario, Falini Brunangelo", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "16574551", "url": "https://glygen.org/publication/PubMed/16574551" } ] }, { "title": "The N-terminus of PKR is responsible for the activation of the NF-kappaB signaling pathway by interacting with the IKK complex.", "journal": "Cellular signalling", "date": "2006-11", "authors": "Bonnet Marion C, Daurat Caroline, Ottone Catherine, Meurs Eliane F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16600570", "url": "https://glygen.org/publication/PubMed/16600570" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Double-stranded RNA-dependent protein kinase phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 mediates apoptosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Scheuner D, Patel R, Wang F, Lee K, Kumar K, Wu J, Nilsson A, Karin M, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16717090", "url": "https://glygen.org/publication/PubMed/16717090" } ] }, { "title": "Involvement of SUMO modification in MBD1- and MCAF1-mediated heterochromatin formation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Uchimura Y, Ichimura T, Uwada J, Tachibana T, Sugahara S, Nakao M, Saitoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "16757475", "url": "https://glygen.org/publication/PubMed/16757475" } ] }, { "title": "Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.", "journal": "Blood", "date": "2006", "authors": "Han Y, Amin HM, Franko B, Frantz C, Shi X, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16825495", "url": "https://glygen.org/publication/PubMed/16825495" } ] }, { "title": "Restoration of shp1 expression by 5-AZA-2'-deoxycytidine is associated with downregulation of JAK3/STAT3 signaling in ALK-positive anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2006", "authors": "Han Y, Amin HM, Frantz C, Franko B, Lee J, Lin Q, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16871283", "url": "https://glygen.org/publication/PubMed/16871283" } ] }, { "title": "Effects of interphase and mitotic phosphorylation on the mobility and location of nucleolar protein B23.", "journal": "Journal of cell science", "date": "2006", "authors": "Negi SS, Olson MO", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "16912078", "url": "https://glygen.org/publication/PubMed/16912078" } ] }, { "title": "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.", "journal": "Molecular cell", "date": "2006", "authors": "Kim SC, Sprung R, Chen Y, Xu Y, Ball H, Pei J, Cheng T, Kho Y, Xiao H, Xiao L, Grishin NV, White M, Yang XJ, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "16916647", "url": "https://glygen.org/publication/PubMed/16916647" } ] }, { "title": "JSI-124 (cucurbitacin I) inhibits Janus kinase-3/signal transducer and activator of transcription-3 signalling, downregulates nucleophosmin-anaplastic lymphoma kinase (ALK), and induces apoptosis in ALK-positive anaplastic large cell lymphoma cells.", "journal": "British journal of haematology", "date": "2006", "authors": "Shi X, Franko B, Frantz C, Amin HM, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "16939498", "url": "https://glygen.org/publication/PubMed/16939498" } ] }, { "title": "Molecular cloning and characterization of the human double-stranded RNA-activated protein kinase induced by interferon.", "journal": "Cell", "date": "1990-07-27", "authors": "Meurs E, Chong K, Galabru J, Thomas N S, Kerr I M, Williams B R, Hovanessian A G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "1695551", "url": "https://glygen.org/publication/PubMed/1695551" } ] }, { "title": "Phosphorylation of specific serine residues in the PKR activation domain of PACT is essential for its ability to mediate apoptosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Peters GA, Li S, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "16982605", "url": "https://glygen.org/publication/PubMed/16982605" } ] }, { "title": "Interaction between ROCK II and nucleophosmin/B23 in the regulation of centrosome duplication.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ma Z, Kanai M, Kawamura K, Kaibuchi K, Ye K, Fukasawa K", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "17015463", "url": "https://glygen.org/publication/PubMed/17015463" } ] }, { "title": "Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.", "journal": "The EMBO journal", "date": "2006", "authors": "Lyst MJ, Nan X, Stancheva I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17066076", "url": "https://glygen.org/publication/PubMed/17066076" } ] }, { "title": "Doxorubicin down-regulates Kruppel-associated box domain-associated protein 1 sumoylation that relieves its transcription repression on p21WAF1/CIP1 in breast cancer MCF-7 cells.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee YK, Thomas SN, Yang AJ, Ann DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17079232", "url": "https://glygen.org/publication/PubMed/17079232" } ] }, { "title": "Double-stranded RNA deaminase ADAR1 increases host susceptibility to virus infection.", "journal": "Journal of virology", "date": "2007-01", "authors": "Nie Yongzhan, Hammond Graeme L, Yang Jing-Hua", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "17079286", "url": "https://glygen.org/publication/PubMed/17079286" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Role of SUMO-interacting motif in Daxx SUMO modification, subnuclear localization, and repression of sumoylated transcription factors.", "journal": "Molecular cell", "date": "2006", "authors": "Lin DY, Huang YS, Jeng JC, Kuo HY, Chang CC, Chao TT, Ho CC, Chen YC, Lin TP, Fang HI, Hung CC, Suen CS, Hwang MJ, Chang KS, Maul GG, Shih HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17081986", "url": "https://glygen.org/publication/PubMed/17081986" } ] }, { "title": "Identification of multiple SNT-binding sites on NPM-ALK oncoprotein and their involvement in cell transformation.", "journal": "Oncogene", "date": "2007", "authors": "Chikamori M, Fujimoto J, Tokai-Nishizumi N, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17086210", "url": "https://glygen.org/publication/PubMed/17086210" } ] }, { "title": "The NPM-ALK tyrosine kinase mimics TCR signalling pathways, inducing NFAT and AP-1 by RAS-dependent mechanisms.", "journal": "Cellular signalling", "date": "2007", "authors": "Turner SD, Yeung D, Hadfield K, Cook SJ, Alexander DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "17110082", "url": "https://glygen.org/publication/PubMed/17110082" } ] }, { "title": "Functional validation of the anaplastic lymphoma kinase signature identifies CEBPB and BCL2A1 as critical target genes.", "journal": "The Journal of clinical investigation", "date": "2006", "authors": "Piva R, Pellegrino E, Mattioli M, Agnelli L, Lombardi L, Boccalatte F, Costa G, Ruggeri BA, Cheng M, Chiarle R, Palestro G, Neri A, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "17111047", "url": "https://glygen.org/publication/PubMed/17111047" } ] }, { "title": "RGC32, a novel p53-inducible gene, is located on centrosomes during mitosis and results in G2/M arrest.", "journal": "Oncogene", "date": "2007", "authors": "Saigusa K, Imoto I, Tanikawa C, Aoyagi M, Ohno K, Nakamura Y, Inazawa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "17146433", "url": "https://glygen.org/publication/PubMed/17146433" } ] }, { "title": "Identification of NVP-TAE684, a potent, selective, and efficacious inhibitor of NPM-ALK.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Galkin AV, Melnick JS, Kim S, Hood TL, Li N, Li L, Xia G, Steensma R, Chopiuk G, Jiang J, Wan Y, Ding P, Liu Y, Sun F, Schultz PG, Gray NS, Warmuth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "17185414", "url": "https://glygen.org/publication/PubMed/17185414" } ] }, { "title": "Activation of PKR: an open and shut case?", "journal": "Trends in biochemical sciences", "date": "2007-02", "authors": "Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "17196820", "url": "https://glygen.org/publication/PubMed/17196820" } ] }, { "title": "Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.", "journal": "Developmental cell", "date": "2007", "authors": "Fujita Y, Hayashi T, Kiyomitsu T, Toyoda Y, Kokubu A, Obuse C, Yanagida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17199038", "url": "https://glygen.org/publication/PubMed/17199038" } ] }, { "title": "Aurora-B regulates RNA methyltransferase NSUN2.", "journal": "Mol. Biol. Cell", "date": "2007", "authors": "Sakita-Suto S, Kanda A, Suzuki F, Sato S, Takata T, Tatsuka M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "17215513", "url": "https://glygen.org/publication/PubMed/17215513" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Sumoylation of the transcriptional intermediary factor 1beta (TIF1beta), the Co-repressor of the KRAB Multifinger proteins, is required for its transcriptional activity and is modulated by the KRAB domain.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mascle XH, Germain-Desprez D, Huynh P, Estephan P, Aubry M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17298944", "url": "https://glygen.org/publication/PubMed/17298944" } ] }, { "title": "Nucleophosmin acts as a novel AP2alpha-binding transcriptional corepressor during cell differentiation.", "journal": "EMBO reports", "date": "2007", "authors": "Liu H, Tan BC, Tseng KH, Chuang CP, Yeh CW, Chen KD, Lee SC, Yung BY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8869496", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8869496" } ], "reference": [ { "type": "PubMed", "id": "17318229", "url": "https://glygen.org/publication/PubMed/17318229" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Functional genomics identifies a Myb domain-containing protein family required for assembly of CENP-A chromatin.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Maddox PS, Hyndman F, Monen J, Oegema K, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "17339379", "url": "https://glygen.org/publication/PubMed/17339379" } ] }, { "title": "Oncogenic tyrosine kinase NPM/ALK induces activation of the rapamycin-sensitive mTOR signaling pathway.", "journal": "Oncogene", "date": "2007", "authors": "Marzec M, Kasprzycka M, Liu X, El-Salem M, Halasa K, Raghunath PN, Bucki R, Wlodarski P, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17353907", "url": "https://glygen.org/publication/PubMed/17353907" } ] }, { "title": "SUMO modification of the DEAD box protein p68 modulates its transcriptional activity and promotes its interaction with HDAC1.", "journal": "Oncogene", "date": "2007", "authors": "Jacobs AM, Nicol SM, Hislop RG, Jaffray EG, Hay RT, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17369852", "url": "https://glygen.org/publication/PubMed/17369852" } ] }, { "title": "NPM-ALK oncogenic kinase promotes cell-cycle progression through activation of JNK/cJun signaling in anaplastic large-cell lymphoma.", "journal": "Blood", "date": "2007", "authors": "Leventaki V, Drakos E, Medeiros LJ, Lim MS, Elenitoba-Johnson KS, Claret FX, Rassidakis GZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "17416736", "url": "https://glygen.org/publication/PubMed/17416736" } ] }, { "title": "The tyrosine phosphatase Shp2 interacts with NPM-ALK and regulates anaplastic lymphoma cell growth and migration.", "journal": "Cancer research", "date": "2007", "authors": "Voena C, Conte C, Ambrogio C, Boeri Erba E, Boccalatte F, Mohammed S, Jensen ON, Palestro G, Inghirami G, Chiarle R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17483340", "url": "https://glygen.org/publication/PubMed/17483340" } ] }, { "title": "Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Liu X, Liu Z, Jang SW, Ma Z, Shinmura K, Kang S, Dong S, Chen J, Fukasawa K, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17535915", "url": "https://glygen.org/publication/PubMed/17535915" } ] }, { "title": "Identification of the transforming EML4-ALK fusion gene in non-small-cell lung cancer.", "journal": "Nature", "date": "2007", "authors": "Soda M, Choi YL, Enomoto M, Takada S, Yamashita Y, Ishikawa S, Fujiwara S, Watanabe H, Kurashina K, Hatanaka H, Bando M, Ohno S, Ishikawa Y, Aburatani H, Niki T, Sohara Y, Sugiyama Y, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "17625570", "url": "https://glygen.org/publication/PubMed/17625570" } ] }, { "title": "The oncoprotein NPM-ALK of anaplastic large-cell lymphoma induces JUNB transcription via ERK1/2 and JunB translation via mTOR signaling.", "journal": "Blood", "date": "2007", "authors": "Staber PB, Vesely P, Haq N, Ott RG, Funato K, Bambach I, Fuchs C, Schauer S, Linkesch W, Hrzenjak A, Dirks WG, Sexl V, Bergler H, Kadin ME, Sternberg DW, Kenner L, Hoefler G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "17690253", "url": "https://glygen.org/publication/PubMed/17690253" } ] }, { "title": "TOPORS functions as a SUMO-1 E3 ligase for chromatin-modifying proteins.", "journal": "Journal of proteome research", "date": "2007", "authors": "Pungaliya P, Kulkarni D, Park HJ, Marshall H, Zheng H, Lackland H, Saleem A, Rubin EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17803295", "url": "https://glygen.org/publication/PubMed/17803295" } ] }, { "title": "Crystal structure of human nucleophosmin-core reveals plasticity of the pentamer-pentamer interface.", "journal": "Proteins", "date": "2007", "authors": "Lee Hyung Ho, Kim Hyoun Sook, Kang Ji Yong, Lee Byung Il, Ha Jun Yong, Yoon Hye Jin, Lim Seung Oe, Jung Guhung, Suh Se Won", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "17879352", "url": "https://glygen.org/publication/PubMed/17879352" } ] }, { "title": "STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression.", "journal": "Nature medicine", "date": "2007", "authors": "Zhang Q, Wang HY, Liu X, Wasik MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "17922009", "url": "https://glygen.org/publication/PubMed/17922009" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Role for KAP1 serine 824 phosphorylation and sumoylation/desumoylation switch in regulating KAP1-mediated transcriptional repression.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Li X, Lee YK, Jeng JC, Yen Y, Schultz DC, Shih HM, Ann DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "17942393", "url": "https://glygen.org/publication/PubMed/17942393" } ] }, { "title": "Cyclin-dependent kinase 2/cyclin E complex is involved in p120 catenin (p120ctn)-dependent cell growth control: a new role for p120ctn in cancer.", "journal": "Cancer research", "date": "2007-10-15", "authors": "Chartier Nicolas T, Oddou Christiane I, Lain\u00e9 Mich\u00e8le G, Ducarouge Benjamin, Marie Christiane A, Block Marc R, Jacquier-Sarlin Muriel R", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "17942908", "url": "https://glygen.org/publication/PubMed/17942908" } ] }, { "title": "The structure and functions of NPM1/Nucleophosmin/B23, a multifunctional nucleolar acidic protein.", "journal": "J. Biochem.", "date": "2008", "authors": "Okuwaki M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "18024471", "url": "https://glygen.org/publication/PubMed/18024471" } ] }, { "title": "PHD domain-mediated E3 ligase activity directs intramolecular sumoylation of an adjacent bromodomain required for gene silencing.", "journal": "Molecular cell", "date": "2007", "authors": "Ivanov AV, Peng H, Yurchenko V, Yap KL, Negorev DG, Schultz DC, Psulkowski E, Fredericks WJ, White DE, Maul GG, Sadofsky MJ, Zhou MM, Rauscher FJ 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "18082607", "url": "https://glygen.org/publication/PubMed/18082607" } ] }, { "title": "Interaction of human tRNA-dihydrouridine synthase-2 with interferon-induced protein kinase PKR.", "journal": "Nucleic acids research", "date": "2008", "authors": "Mittelstadt M, Frump A, Khuu T, Fowlkes V, Handy I, Patel CV, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18096616", "url": "https://glygen.org/publication/PubMed/18096616" } ] }, { "title": "The anaplastic lymphoma kinase in the pathogenesis of cancer.", "journal": "Nature reviews. Cancer", "date": "2008", "authors": "Chiarle R, Voena C, Ambrogio C, Piva R, Inghirami G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18097461", "url": "https://glygen.org/publication/PubMed/18097461" } ] }, { "title": "SUMOylation modulates the transcription repressor function of RIP140.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rytinki MM, Palvimo JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "18211901", "url": "https://glygen.org/publication/PubMed/18211901" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "The nucleocapsid protein of SARS-associated coronavirus inhibits B23 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zeng Y, Ye L, Zhu S, Zheng H, Zhao P, Cai W, Su L, She Y, Wu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9692914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "18243139", "url": "https://glygen.org/publication/PubMed/18243139" } ] }, { "title": "The nucleolar SUMO-specific protease SENP3 reverses SUMO modification of nucleophosmin and is required for rRNA processing.", "journal": "EMBO reports", "date": "2008", "authors": "Haindl M, Harasim T, Eick D, Muller S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "18259216", "url": "https://glygen.org/publication/PubMed/18259216" } ] }, { "title": "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.", "journal": "Proteomics", "date": "2008", "authors": "Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "18318008", "url": "https://glygen.org/publication/PubMed/18318008" } ] }, { "title": "The BTG2 protein is a general activator of mRNA deadenylation.", "journal": "The EMBO journal", "date": "2008", "authors": "Mauxion F, Faux C, Seraphin B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "18337750", "url": "https://glygen.org/publication/PubMed/18337750" } ] }, { "title": "Sumoylation is critical for DJ-1 to repress p53 transcriptional activity.", "journal": "FEBS letters", "date": "2008", "authors": "Fan J, Ren H, Fei E, Jia N, Ying Z, Jiang P, Wu M, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "18339323", "url": "https://glygen.org/publication/PubMed/18339323" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Regulation of growth factor signaling by FRS2 family docking/scaffold adaptor proteins.", "journal": "Cancer science", "date": "2008", "authors": "Gotoh N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18452557", "url": "https://glygen.org/publication/PubMed/18452557" } ] }, { "title": "p53-Driven apoptosis limits centrosome amplification and genomic instability downstream of NPM1 phosphorylation.", "journal": "Nature cell biology", "date": "2008", "authors": "Cuomo ME, Knebel A, Morrice N, Paterson H, Cohen P, Mittnacht S", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "18454140", "url": "https://glygen.org/publication/PubMed/18454140" } ] }, { "title": "Structural insights into human KAP1 PHD finger-bromodomain and its role in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Zeng L, Yap KL, Ivanov AV, Wang X, Mujtaba S, Plotnikova O, Rauscher FJ 3rd, Zhou MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "18488044", "url": "https://glygen.org/publication/PubMed/18488044" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "Structural consequences of nucleophosmin mutations in acute myeloid leukemia.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Grummitt CG, Townsley FM, Johnson CM, Warren AJ, Bycroft M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "18511415", "url": "https://glygen.org/publication/PubMed/18511415" } ] }, { "title": "Identification of novel isoforms of the EML4-ALK transforming gene in non-small cell lung cancer.", "journal": "Cancer research", "date": "2008", "authors": "Choi YL, Takeuchi K, Soda M, Inamura K, Togashi Y, Hatano S, Enomoto M, Hamada T, Haruta H, Watanabe H, Kurashina K, Hatanaka H, Ueno T, Takada S, Yamashita Y, Sugiyama Y, Ishikawa Y, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18593892", "url": "https://glygen.org/publication/PubMed/18593892" } ] }, { "title": "EML4-ALK fusion gene and efficacy of an ALK kinase inhibitor in lung cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2008", "authors": "Koivunen JP, Mermel C, Zejnullahu K, Murphy C, Lifshits E, Holmes AJ, Choi HG, Kim J, Chiang D, Thomas R, Lee J, Richards WG, Sugarbaker DJ, Ducko C, Lindeman N, Marcoux JP, Engelman JA, Gray NS, Lee C, Meyerson M, Janne PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18594010", "url": "https://glygen.org/publication/PubMed/18594010" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "An inflammatory myofibroblastic tumor in liver with ALK and RANBP2 gene rearrangement: combination of distinct morphologic, immunohistochemical, and genetic features.", "journal": "Human pathology", "date": "2008", "authors": "Chen ST, Lee JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18701132", "url": "https://glygen.org/publication/PubMed/18701132" } ] }, { "title": "Identification of ALK as a major familial neuroblastoma predisposition gene.", "journal": "Nature", "date": "2008", "authors": "Mosse YP, Laudenslager M, Longo L, Cole KA, Wood A, Attiyeh EF, Laquaglia MJ, Sennett R, Lynch JE, Perri P, Laureys G, Speleman F, Kim C, Hou C, Hakonarson H, Torkamani A, Schork NJ, Brodeur GM, Tonini GP, Rappaport E, Devoto M, Maris JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18724359", "url": "https://glygen.org/publication/PubMed/18724359" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Maggi LB Jr, Kuchenruether M, Dadey DY, Schwope RM, Grisendi S, Townsend RR, Pandolfi PP, Weber JD", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "18809582", "url": "https://glygen.org/publication/PubMed/18809582" } ] }, { "title": "Nck-1 interacts with PKR and modulates its activation by dsRNA.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Cardin E, Larose L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18835251", "url": "https://glygen.org/publication/PubMed/18835251" } ] }, { "title": "Somatic and germline activating mutations of the ALK kinase receptor in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "Janoueix-Lerosey I, Lequin D, Brugieres L, Ribeiro A, de Pontual L, Combaret V, Raynal V, Puisieux A, Schleiermacher G, Pierron G, Valteau-Couanet D, Frebourg T, Michon J, Lyonnet S, Amiel J, Delattre O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18923523", "url": "https://glygen.org/publication/PubMed/18923523" } ] }, { "title": "Oncogenic mutations of ALK kinase in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "Chen Y, Takita J, Choi YL, Kato M, Ohira M, Sanada M, Wang L, Soda M, Kikuchi A, Igarashi T, Nakagawara A, Hayashi Y, Mano H, Ogawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "18923524", "url": "https://glygen.org/publication/PubMed/18923524" } ] }, { "title": "Activating mutations in ALK provide a therapeutic target in neuroblastoma.", "journal": "Nature", "date": "2008", "authors": "George RE, Sanda T, Hanna M, Frohling S, Luther W 2nd, Zhang J, Ahn Y, Zhou W, London WB, McGrady P, Xue L, Zozulya S, Gregor VE, Webb TR, Gray NS, Gilliland DG, Diller L, Greulich H, Morris SW, Meyerson M, Look AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "18923525", "url": "https://glygen.org/publication/PubMed/18923525" } ] }, { "title": "PKR regulates B56(alpha)-mediated BCL2 phosphatase activity in acute lymphoblastic leukemia-derived REH cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ruvolo VR, Kurinna SM, Karanjeet KB, Schuster TF, Martelli AM, McCubrey JA, Ruvolo PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "18957415", "url": "https://glygen.org/publication/PubMed/18957415" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases.", "journal": "J. Cell Biol.", "date": "2008", "authors": "Yun C, Wang Y, Mukhopadhyay D, Backlund P, Kolli N, Yergey A, Wilkinson KD, Dasso M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19015314", "url": "https://glygen.org/publication/PubMed/19015314" } ] }, { "title": "Human protein factory for converting the transcriptome into an in vitro-expressed proteome.", "journal": "Nat. Methods", "date": "2008", "authors": "Goshima Naoki, Kawamura Yoshifumi, Fukumoto Akiko, Miura Aya, Honma Reiko, Satoh Ryohei, Wakamatsu Ai, Yamamoto Jun-ichi, Kimura Kouichi, Nishikawa Tetsuo, Andoh Taichi, Iida Yuki, Ishikawa Kumiko, Ito Emi, Kagawa Naoko, Kaminaga Chie, Kanehori Kei-ichi, Kawakami Bunsei, Kenmochi Kiyokazu, Kimura Rie, Kobayashi Miki, Kuroita Toshihiro, Kuwayama Hisashi, Maruyama Yukio, Matsuo Kiyoshi, Minami Kazuyoshi, Mitsubori Mariko, Mori Masatoshi, Morishita Riyo, Murase Atsushi, Nishikawa Akira, Nishikawa Shigemichi, Okamoto Toshihiko, Sakagami Noriko, Sakamoto Yutaka, Sasaki Yukari, Seki Tomoe, Sono Saki, Sugiyama Akio, Sumiya Tsuyoshi, Takayama Tomoko, Takayama Yukiko, Takeda Hiroyuki, Togashi Takushi, Yahata Kazuhide, Yamada Hiroko, Yanagisawa Yuka, Endo Yaeta, Imamoto Fumio, Kisu Yasutomo, Tanaka Shigeo, Isogai Takao, Imai Jun-ichi, Watanabe Shinya, Nomura Nobuo", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19054851", "url": "https://glygen.org/publication/PubMed/19054851" } ] }, { "title": "APE1/Ref-1 interacts with NPM1 within nucleoli and plays a role in the rRNA quality control process.", "journal": "Molecular and cellular biology", "date": "2009-04", "authors": "Vascotto Carlo, Fantini Damiano, Romanello Milena, Cesaratto Laura, Deganuto Marta, Leonardi Antonio, Radicella J Pablo, Kelley Mark R, D'Ambrosio Chiara, Scaloni Andrea, Quadrifoglio Franco, Tell Gianluca", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19188445", "url": "https://glygen.org/publication/PubMed/19188445" } ] }, { "title": "Nucleolar structure and function are regulated by the deubiquitylating enzyme USP36.", "journal": "Journal of cell science", "date": "2009", "authors": "Endo A, Matsumoto M, Inada T, Yamamoto A, Nakayama KI, Kitamura N, Komada M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19208757", "url": "https://glygen.org/publication/PubMed/19208757" } ] }, { "title": "An antiviral response directed by PKR phosphorylation of the RNA helicase A.", "journal": "PLoS pathogens", "date": "2009", "authors": "Sadler AJ, Latchoumanin O, Hawkes D, Mak J, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19229320", "url": "https://glygen.org/publication/PubMed/19229320" } ] }, { "title": "Novel proteomics strategy brings insight into the prevalence of SUMO-2 target sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Blomster HA, Hietakangas V, Wu J, Kouvonen P, Hautaniemi S, Sistonen L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "19240082", "url": "https://glygen.org/publication/PubMed/19240082" } ] }, { "title": "Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Horiuchi M, Takeuchi K, Noda N, Muroya N, Suzuki T, Nakamura T, Kawamura-Tsuzuku J, Takahasi K, Yamamoto T, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "19276069", "url": "https://glygen.org/publication/PubMed/19276069" } ] }, { "title": "Large-scale proteomics analysis of the human kinome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "19369195", "url": "https://glygen.org/publication/PubMed/19369195" } ] }, { "title": "Active establishment of centromeric CENP-A chromatin by RSF complex.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Perpelescu M, Nozaki N, Obuse C, Yang H, Yoda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19398759", "url": "https://glygen.org/publication/PubMed/19398759" } ] }, { "title": "Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.", "journal": "Cell", "date": "2009", "authors": "Foltz DR, Jansen LE, Bailey AO, Yates JR 3rd, Bassett EA, Wood S, Black BE, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410544", "url": "https://glygen.org/publication/PubMed/19410544" } ] }, { "title": "HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.", "journal": "Cell", "date": "2009", "authors": "Dunleavy EM, Roche D, Tagami H, Lacoste N, Ray-Gallet D, Nakamura Y, Daigo Y, Nakatani Y, Almouzni-Pettinotti G", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "19410545", "url": "https://glygen.org/publication/PubMed/19410545" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "PKR, a p53 target gene, plays a crucial role in the tumor-suppressor function of p53.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009-05-12", "authors": "Yoon Cheol-Hee, Lee Eun-Soo, Lim Dae-Seog, Bae Yong-Soo", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19416861", "url": "https://glygen.org/publication/PubMed/19416861" } ] }, { "title": "The FRS2 family of docking/scaffolding adaptor proteins as therapeutic targets of cancer treatment.", "journal": "Expert opinion on therapeutic targets", "date": "2009", "authors": "Sato T, Gotoh N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "19456272", "url": "https://glygen.org/publication/PubMed/19456272" } ] }, { "title": "Anaplastic lymphoma kinase: signalling in development and disease.", "journal": "The Biochemical journal", "date": "2009", "authors": "Palmer RH, Vernersson E, Grabbe C, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "19459784", "url": "https://glygen.org/publication/PubMed/19459784" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Matafora V, D'Amato A, Mori S, Blasi F, Bachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "19596686", "url": "https://glygen.org/publication/PubMed/19596686" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "SUMO modification regulates the transcriptional activity of FLASH.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Alm-Kristiansen AH, Norman IL, Matre V, Gabrielsen OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "19615980", "url": "https://glygen.org/publication/PubMed/19615980" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "The metastasis efficiency modifier ribosomal RNA processing 1 homolog B (RRP1B) is a chromatin-associated factor.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Crawford NP, Yang H, Mattaini KR, Hunter KW", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "19710015", "url": "https://glygen.org/publication/PubMed/19710015" } ] }, { "title": "RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR.", "journal": "The Journal of biological chemistry", "date": "2009-10-23", "authors": "Toth Ann M, Li Zhiqun, Cattaneo Roberto, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19710021", "url": "https://glygen.org/publication/PubMed/19710021" } ] }, { "title": "Adenosine deaminase ADAR1 increases gene expression at the translational level by decreasing protein kinase PKR-dependent eIF-2alpha phosphorylation.", "journal": "Journal of molecular biology", "date": "2009-11-06", "authors": "Wang Ying, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19733181", "url": "https://glygen.org/publication/PubMed/19733181" } ] }, { "title": "Phosphorylation of the human microRNA-generating complex mediates MAPK/Erk signaling.", "journal": "Cell", "date": "2009-10-02", "authors": "Paroo Zain, Ye Xuecheng, Chen She, Liu Qinghua", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19804757", "url": "https://glygen.org/publication/PubMed/19804757" } ] }, { "title": "PKR is not a universal target of tumor suppressor p53 in response to genotoxic stress.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009-11-01", "authors": "Rahman Mashrur, Lem Christopher, Muaddi Hala, Koromilas Antonis E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "19838063", "url": "https://glygen.org/publication/PubMed/19838063" } ] }, { "title": "NPM phosphorylation stimulates Cdk1, overrides G2/M checkpoint and increases leukemic blasts in mice.", "journal": "Carcinogenesis", "date": "2010", "authors": "Du W, Zhou Y, Pike S, Pang Q", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "19933706", "url": "https://glygen.org/publication/PubMed/19933706" } ] }, { "title": "Cdk2 and Cdk4 regulate the centrosome cycle and are critical mediators of centrosome amplification in p53-null cells.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Adon AM, Zeng X, Harrison MK, Sannem S, Kiyokawa H, Kaldis P, Saavedra HI", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "19933848", "url": "https://glygen.org/publication/PubMed/19933848" } ] }, { "title": "Sumoylation of p68 and p72 RNA helicases affects protein stability and transactivation potential.", "journal": "Biochemistry", "date": "2010", "authors": "Mooney SM, Grande JP, Salisbury JL, Janknecht R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "19995069", "url": "https://glygen.org/publication/PubMed/19995069" } ] }, { "title": "C/EBPbeta expression in ALK-positive anaplastic large cell lymphomas is required for cell proliferation and is induced by the STAT3 signaling pathway.", "journal": "Haematologica", "date": "2010", "authors": "Anastasov N, Bonzheim I, Rudelius M, Klier M, Dau T, Angermeier D, Duyster J, Pittaluga S, Fend F, Raffeld M, Quintanilla-Martinez L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "20015877", "url": "https://glygen.org/publication/PubMed/20015877" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.", "journal": "EMBO J.", "date": "2010", "authors": "Muller C, Bremer A, Schreiber S, Eichwald S, Calkhoven CF", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "20075868", "url": "https://glygen.org/publication/PubMed/20075868" } ] }, { "title": "HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shuaib M, Ouararhni K, Dimitrov S, Hamiche A", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20080577", "url": "https://glygen.org/publication/PubMed/20080577" } ] }, { "title": "A role for non-covalent SUMO interaction motifs in Pc2/CBX4 E3 activity.", "journal": "PloS one", "date": "2010", "authors": "Merrill JC, Melhuish TA, Kagey MH, Yang SH, Sharrocks AD, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "20098713", "url": "https://glygen.org/publication/PubMed/20098713" } ] }, { "title": "Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Ren J, Wang Y, Liang Y, Zhang Y, Bao S, Xu Z", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "20159986", "url": "https://glygen.org/publication/PubMed/20159986" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Specific complex of human immunodeficiency virus type 1 rev and nucleolar B23 proteins: dissociation by the Rev response element.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Fankhauser C, Izaurralde E, Adachi Y, Wingfield P, Laemmli UK", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "2017166", "url": "https://glygen.org/publication/PubMed/2017166" } ] }, { "title": "The SUMO E3 ligase activity of Pc2 is coordinated through a SUMO interaction motif.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Yang SH, Sharrocks AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "20176810", "url": "https://glygen.org/publication/PubMed/20176810" } ] }, { "title": "Phosphoproteomic analysis of primary human multiple myeloma cells.", "journal": "Journal of proteomics", "date": "2010", "authors": "Ge F, Xiao CL, Yin XF, Lu CH, Zeng HL, He QY", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Nucleophosmin phosphorylation by v-cyclin-CDK6 controls KSHV latency.", "journal": "PLoS pathogens", "date": "2010", "authors": "Sarek G, Jarviluoma A, Moore HM, Tojkander S, Vartia S, Biberfeld P, Laiho M, Ojala PM", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "20333249", "url": "https://glygen.org/publication/PubMed/20333249" } ] }, { "title": "Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication.", "journal": "PloS one", "date": "2010", "authors": "Krause A, Hoffmann I", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "title": "New Cdc2 Tyr 4 phosphorylation by dsRNA-activated protein kinase triggers Cdc2 polyubiquitination and G2 arrest under genotoxic stresses.", "journal": "EMBO reports", "date": "2010", "authors": "Yoon CH, Miah MA, Kim KP, Bae YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20395957", "url": "https://glygen.org/publication/PubMed/20395957" } ] }, { "title": "Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2.", "journal": "Journal of structural and functional genomics", "date": "2010", "authors": "Koshiba S, Li H, Motoda Y, Tomizawa T, Kasai T, Tochio N, Yabuki T, Harada T, Watanabe S, Tanaka A, Shirouzu M, Kigawa T, Yamamoto T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "20454865", "url": "https://glygen.org/publication/PubMed/20454865" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Nucleophosmin is overexpressed in thyroid tumors.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Pianta A, Puppin C, Franzoni A, Fabbro D, Di Loreto C, Bulotta S, Deganuto M, Paron I, Tell G, Puxeddu E, Filetti S, Russo D, Damante G", "evidence": [ { "database": "GlyGen", "id": "A0332", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "20515654", "url": "https://glygen.org/publication/PubMed/20515654" } ] }, { "title": "Respiratory syncytial virus limits alpha subunit of eukaryotic translation initiation factor 2 (eIF2alpha) phosphorylation to maintain translation and viral replication.", "journal": "The Journal of biological chemistry", "date": "2010-07-30", "authors": "Groskreutz Dayna J, Babor Ellen C, Monick Martha M, Varga Steven M, Hunninghake Gary W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20519500", "url": "https://glygen.org/publication/PubMed/20519500" } ] }, { "title": "PLK2 phosphorylation is critical for CPAP function in procentriole formation during the centrosome cycle.", "journal": "The EMBO journal", "date": "2010", "authors": "Chang J, Cizmecioglu O, Hoffmann I, Rhee K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "20531387", "url": "https://glygen.org/publication/PubMed/20531387" } ] }, { "title": "Dual recognition of CENP-A nucleosomes is required for centromere assembly.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Carroll CW, Milks KJ, Straight AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "20566683", "url": "https://glygen.org/publication/PubMed/20566683" } ] }, { "title": "Sumoylation of ING2 regulates the transcription mediated by Sin3A.", "journal": "Oncogene", "date": "2010", "authors": "Ythier D, Larrieu D, Binet R, Binda O, Brambilla C, Gazzeri S, Pedeux R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "20676127", "url": "https://glygen.org/publication/PubMed/20676127" } ] }, { "title": "The double-stranded RNA-dependent protein kinase differentially regulates insulin receptor substrates 1 and 2 in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Yang X, Nath A, Opperman MJ, Chan C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "20685959", "url": "https://glygen.org/publication/PubMed/20685959" } ] }, { "title": "Recruitment of phosphorylated NPM1 to sites of DNA damage through RNF8-dependent ubiquitin conjugates.", "journal": "Cancer research", "date": "2010", "authors": "Koike A, Nishikawa H, Wu W, Okada Y, Venkitaraman AR, Ohta T", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "20713529", "url": "https://glygen.org/publication/PubMed/20713529" } ] }, { "title": "The role of nucleophosmin/B23 in radiation-induced chromosomal instability in human lymphoblastoid cells of different p53 genotypes.", "journal": "International journal of radiation biology", "date": "2010-12", "authors": "Chen Honghong, Jia Rongfei, Zhou Meijun, Xu Aihong, Hu Yuxing, Cheng Wenying, Shao Chunlin", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "20807181", "url": "https://glygen.org/publication/PubMed/20807181" } ] }, { "title": "RRP1B targets PP1 to mammalian cell nucleoli and is associated with pre-60S ribosomal subunits.", "journal": "Mol. Biol. Cell", "date": "2010", "authors": "Chamousset D, De Wever V, Moorhead GB, Chen Y, Boisvert FM, Lamond AI, Trinkle-Mulcahy L", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "20926688", "url": "https://glygen.org/publication/PubMed/20926688" } ] }, { "title": "Dephosphorylation of nucleophosmin by PP1beta facilitates pRB binding and consequent E2F1-dependent DNA repair.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Lin CY, Tan BC, Liu H, Shih CJ, Chien KY, Lin CL, Yung BY", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "20962268", "url": "https://glygen.org/publication/PubMed/20962268" } ] }, { "title": "Multiple forms of PKR present in the nuclei of acute leukemia cells represent an active kinase that is responsive to stress.", "journal": "Leukemia", "date": "2011", "authors": "Blalock WL, Bavelloni A, Piazzi M, Tagliavini F, Faenza I, Martelli AM, Follo MY, Cocco L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21072047", "url": "https://glygen.org/publication/PubMed/21072047" } ] }, { "title": "BRCA2 and nucleophosmin coregulate centrosome amplification and form a complex with the Rho effector kinase ROCK2.", "journal": "Cancer research", "date": "2011-01-01", "authors": "Wang Hui-Feng, Takenaka Katsuya, Nakanishi Akira, Miki Yoshio", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "21084279", "url": "https://glygen.org/publication/PubMed/21084279" } ] }, { "title": "Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.", "journal": "Genes & development", "date": "2010", "authors": "Harashima A, Guettouche T, Barber GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21123651", "url": "https://glygen.org/publication/PubMed/21123651" } ] }, { "title": "Identification of a novel fusion, SQSTM1-ALK, in ALK-positive large B-cell lymphoma.", "journal": "Haematologica", "date": "2011", "authors": "Takeuchi K, Soda M, Togashi Y, Ota Y, Sekiguchi Y, Hatano S, Asaka R, Noguchi M, Mano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21134980", "url": "https://glygen.org/publication/PubMed/21134980" } ] }, { "title": "Epithelioid inflammatory myofibroblastic sarcoma: An aggressive intra-abdominal variant of inflammatory myofibroblastic tumor with nuclear membrane or perinuclear ALK.", "journal": "The American journal of surgical pathology", "date": "2011", "authors": "Marino-Enriquez A, Wang WL, Roy A, Lopez-Terrada D, Lazar AJ, Fletcher CD, Coffin CM, Hornick JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21164297", "url": "https://glygen.org/publication/PubMed/21164297" } ] }, { "title": "ALK rearrangement in sickle cell trait-associated renal medullary carcinoma.", "journal": "Genes, chromosomes & cancer", "date": "2011", "authors": "Marino-Enriquez A, Ou WB, Weldon CB, Fletcher JA, Perez-Atayde AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21213368", "url": "https://glygen.org/publication/PubMed/21213368" } ] }, { "title": "Activated ROCK II by-passes the requirement of the CDK2 activity for centrosome duplication and amplification.", "journal": "Oncogene", "date": "2011", "authors": "Hanashiro K, Brancaccio M, Fukasawa K", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "21242972", "url": "https://glygen.org/publication/PubMed/21242972" } ] }, { "title": "Multiple levels of PKR inhibition during HIV-1 replication.", "journal": "Reviews in medical virology", "date": "2011-01", "authors": "Clerzius Guerline, G\u00e9linas Jean-Fran\u00e7ois, Gatignol Anne", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21294215", "url": "https://glygen.org/publication/PubMed/21294215" } ] }, { "title": "PIAS1 interacts with FLASH and enhances its co-activation of c-Myb.", "journal": "Molecular cancer", "date": "2011", "authors": "Alm-Kristiansen AH, Lorenzo PI, Molvaersmyr AK, Matre V, Ledsaak M, Saether T, Gabrielsen OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "21338522", "url": "https://glygen.org/publication/PubMed/21338522" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Role of ERK-BIM and STAT3-survivin signaling pathways in ALK inhibitor-induced apoptosis in EML4-ALK-positive lung cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Takezawa K, Okamoto I, Nishio K, Janne PA, Nakagawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21415216", "url": "https://glygen.org/publication/PubMed/21415216" } ] }, { "title": "Mass spectrometric characterization of protein structure details refines the proteome signature for invasive ductal breast carcinoma.", "journal": "Journal of the American Society for Mass Spectrometry", "date": "2011-03", "authors": "R\u00f6wer Claudia, Koy Cornelia, Hecker Michael, Reimer Toralf, Gerber Bernd, Thiesen Hans-J\u00fcrgen, Glocker Michael O", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "21472563", "url": "https://glygen.org/publication/PubMed/21472563" } ] }, { "title": "Inhibition of anaplastic lymphoma kinase (ALK) activity provides a therapeutic approach for CLTC-ALK-positive human diffuse large B cell lymphomas.", "journal": "PloS one", "date": "2011", "authors": "Cerchietti L, Damm-Welk C, Vater I, Klapper W, Harder L, Pott C, Yang SN, Reiter A, Siebert R, Melnick A, Woessmann W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "21494621", "url": "https://glygen.org/publication/PubMed/21494621" } ] }, { "title": "Therapeutic strategies to overcome crizotinib resistance in non-small cell lung cancers harboring the fusion oncogene EML4-ALK.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Katayama R, Khan TM, Benes C, Lifshits E, Ebi H, Rivera VM, Shakespeare WC, Iafrate AJ, Engelman JA, Shaw AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "21502504", "url": "https://glygen.org/publication/PubMed/21502504" } ] }, { "title": "Precursor miR-886, a novel noncoding RNA repressed in cancer, associates with PKR and modulates its activity.", "journal": "RNA (New York, N.Y.)", "date": "2011-06", "authors": "Lee Kwanbok, Kunkeaw Nawapol, Jeon Sung Ho, Lee Inhan, Johnson Betty H, Kang Gum-Yong, Bang Joo Young, Park Hyung Soon, Leelayuwat Chanvit, Lee Yong Sun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21518807", "url": "https://glygen.org/publication/PubMed/21518807" } ] }, { "title": "Co-repressor activity of scaffold attachment factor B1 requires sumoylation.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Garee JP, Meyer R, Oesterreich S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "21527249", "url": "https://glygen.org/publication/PubMed/21527249" } ] }, { "title": "Anaplastic thyroid cancers harbor novel oncogenic mutations of the ALK gene.", "journal": "Cancer research", "date": "2011", "authors": "Murugan AK, Xing M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21596819", "url": "https://glygen.org/publication/PubMed/21596819" } ] }, { "title": "Inhibition of RNase L and RNA-dependent protein kinase (PKR) by sunitinib impairs antiviral innate immunity.", "journal": "The Journal of biological chemistry", "date": "2011-07-29", "authors": "Jha Babal Kant, Polyakova Irina, Kessler Patricia, Dong Beihua, Dickerman Benjamin, Sen Ganes C, Silverman Robert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21636578", "url": "https://glygen.org/publication/PubMed/21636578" } ] }, { "title": "A novel KIF5B-ALK variant in nonsmall cell lung cancer.", "journal": "Cancer", "date": "2011", "authors": "Wong DW, Leung EL, Wong SK, Tin VP, Sihoe AD, Cheng LC, Au JS, Chung LP, Wong MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21656749", "url": "https://glygen.org/publication/PubMed/21656749" } ] }, { "title": "IL-2R common gamma-chain is epigenetically silenced by nucleophosphin-anaplastic lymphoma kinase (NPM-ALK) and acts as a tumor suppressor by targeting NPM-ALK.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Zhang Q, Wang HY, Liu X, Bhutani G, Kantekure K, Wasik M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "21715655", "url": "https://glygen.org/publication/PubMed/21715655" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Barnhart MC, Kuich PH, Stellfox ME, Ward JA, Bassett EA, Black BE, Foltz DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279" } ], "reference": [ { "type": "PubMed", "id": "21768289", "url": "https://glygen.org/publication/PubMed/21768289" } ] }, { "title": "Activating ALK mutations found in neuroblastoma are inhibited by Crizotinib and NVP-TAE684.", "journal": "The Biochemical journal", "date": "2011", "authors": "Schonherr C, Ruuth K, Yamazaki Y, Eriksson T, Christensen J, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21838707", "url": "https://glygen.org/publication/PubMed/21838707" } ] }, { "title": "Identification of oncogenic point mutations and hyperphosphorylation of anaplastic lymphoma kinase in lung cancer.", "journal": "Neoplasia (New York, N.Y.)", "date": "2011", "authors": "Wang YW, Tu PH, Lin KT, Lin SC, Ko JY, Jou YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "21847362", "url": "https://glygen.org/publication/PubMed/21847362" } ] }, { "title": "The cellular TAR RNA binding protein, TRBP, promotes HIV-1 replication primarily by inhibiting the activation of double-stranded RNA-dependent kinase PKR.", "journal": "Journal of virology", "date": "2011-12", "authors": "Sanghvi Viraj R, Steel Laura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21937648", "url": "https://glygen.org/publication/PubMed/21937648" } ] }, { "title": "ALK mutations conferring differential resistance to structurally diverse ALK inhibitors.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Heuckmann JM, Holzel M, Sos ML, Heynck S, Balke-Want H, Koker M, Peifer M, Weiss J, Lovly CM, Grutter C, Rauh D, Pao W, Thomas RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "21948233", "url": "https://glygen.org/publication/PubMed/21948233" } ] }, { "title": "Heparin activates PKR by inducing dimerization.", "journal": "Journal of molecular biology", "date": "2011-11-11", "authors": "Anderson Eric, Pierre-Louis Willythssa S, Wong C Jason, Lary Jeffrey W, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21978664", "url": "https://glygen.org/publication/PubMed/21978664" } ] }, { "title": "Activation of the Antiviral Kinase PKR and Viral Countermeasures.", "journal": "Viruses", "date": "2009-12", "authors": "Dauber Bianca, Wolff Thorsten", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "21994559", "url": "https://glygen.org/publication/PubMed/21994559" } ] }, { "title": "New centromeric component CENP-W is an RNA-associated nuclear matrix protein that interacts with nucleophosmin/B23 protein.", "journal": "The Journal of biological chemistry", "date": "2011-12-09", "authors": "Chun Younghwa, Park Byoungwoo, Koh Wansoo, Lee Sunhee, Cheon Yeongmi, Kim Raehyung, Che Lihua, Lee Soojin", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "22002061", "url": "https://glygen.org/publication/PubMed/22002061" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "The RAX/PACT-PKR stress response pathway promotes p53 sumoylation and activation, leading to G(1) arrest.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2012", "authors": "Bennett RL, Pan Y, Christian J, Hui T, May WS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "22214662", "url": "https://glygen.org/publication/PubMed/22214662" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Aberrant activation of ALK kinase by a novel truncated form ALK protein in neuroblastoma.", "journal": "Oncogene", "date": "2012", "authors": "Okubo J, Takita J, Chen Y, Oki K, Nishimura R, Kato M, Sanada M, Hiwatari M, Hayashi Y, Igarashi T, Ogawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22249260", "url": "https://glygen.org/publication/PubMed/22249260" } ] }, { "title": "Evidence providing new insights into TOB-promoted deadenylation and supporting a link between TOB's deadenylation-enhancing and antiproliferative activities.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Ezzeddine N, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "22252318", "url": "https://glygen.org/publication/PubMed/22252318" } ] }, { "title": "Identification of new ALK and RET gene fusions from colorectal and lung cancer biopsies.", "journal": "Nature medicine", "date": "2012", "authors": "Lipson D, Capelletti M, Yelensky R, Otto G, Parker A, Jarosz M, Curran JA, Balasubramanian S, Bloom T, Brennan KW, Donahue A, Downing SR, Frampton GM, Garcia L, Juhn F, Mitchell KC, White E, White J, Zwirko Z, Peretz T, Nechushtan H, Soussan-Gutman L, Kim J, Sasaki H, Kim HR, Park SI, Ercan D, Sheehan CE, Ross JS, Cronin MT, Janne PA, Stephens PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22327622", "url": "https://glygen.org/publication/PubMed/22327622" } ] }, { "title": "KLC1-ALK: a novel fusion in lung cancer identified using a formalin-fixed paraffin-embedded tissue only.", "journal": "PloS one", "date": "2012", "authors": "Togashi Y, Soda M, Sakata S, Sugawara E, Hatano S, Asaka R, Nakajima T, Mano H, Takeuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22347464", "url": "https://glygen.org/publication/PubMed/22347464" } ] }, { "title": "Function of homo- and hetero-oligomers of human nucleoplasmin/nucleophosmin family proteins NPM1, NPM2 and NPM3 during sperm chromatin remodeling.", "journal": "Nucleic Acids Res.", "date": "2012", "authors": "Okuwaki M, Sumi A, Hisaoka M, Saotome-Nakamura A, Akashi S, Nishimura Y, Nagata K", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "22362753", "url": "https://glygen.org/publication/PubMed/22362753" } ] }, { "title": "G protein-coupled receptor kinase 5 phosphorylates nucleophosmin and regulates cell sensitivity to polo-like kinase 1 inhibition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "So CH, Michal AM, Mashayekhi R, Benovic JL", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "22467873", "url": "https://glygen.org/publication/PubMed/22467873" } ] }, { "title": "Small ubiquitin-like modifier (SUMO) modification of zinc finger protein 131 potentiates its negative effect on estrogen signaling.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Oh Y, Chung KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "22467880", "url": "https://glygen.org/publication/PubMed/22467880" } ] }, { "title": "Tat-responsive region RNA of human immunodeficiency virus 1 can prevent activation of the double-stranded-RNA-activated protein kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990-11", "authors": "Gunnery S, Rice A P, Robertson H D, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "2247437", "url": "https://glygen.org/publication/PubMed/2247437" } ] }, { "title": "Nucleophosmin (NPM1/B23) interacts with activating transcription factor 5 (ATF5) protein and promotes proteasome- and caspase-dependent ATF5 degradation in hepatocellular carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Liu X, Liu D, Qian D, Dai J, An Y, Jiang S, Stanley B, Yang J, Wang B, Liu X, Liu DX", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "22528486", "url": "https://glygen.org/publication/PubMed/22528486" } ] }, { "title": "Identification of anaplastic lymphoma kinase as a potential therapeutic target in ovarian cancer.", "journal": "Cancer research", "date": "2012", "authors": "Ren H, Tan ZP, Zhu X, Crosby K, Haack H, Ren JM, Beausoleil S, Moritz A, Innocenti G, Rush J, Zhang Y, Zhou XM, Gu TL, Yang YF, Comb MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "22570254", "url": "https://glygen.org/publication/PubMed/22570254" } ] }, { "title": "Fusion of dynactin 1 to anaplastic lymphoma kinase in inflammatory myofibroblastic tumor.", "journal": "Human pathology", "date": "2012", "authors": "Wang X, Krishnan C, Nguyen EP, Meyer KJ, Oliveira JL, Yang P, Yi ES, Erickson-Johnson MR, Yaszemski MJ, Maran A, Oliveira AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "22658521", "url": "https://glygen.org/publication/PubMed/22658521" } ] }, { "title": "DEAD-box RNA helicases as transcription cofactors.", "journal": "Methods in enzymology", "date": "2012", "authors": "Fuller-Pace FV, Nicol SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "22713328", "url": "https://glygen.org/publication/PubMed/22713328" } ] }, { "title": "Extracellular signal-regulated kinase 2 (ERK2) mediates phosphorylation and inactivation of nuclear interaction partner of anaplastic lymphoma kinase (NIPA) at G2/M.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Illert AL, Zech M, Moll C, Albers C, Kreutmair S, Peschel C, Bassermann F, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "22955283", "url": "https://glygen.org/publication/PubMed/22955283" } ] }, { "title": "Characterization of the direct physical interaction of nc886, a cellular non-coding RNA, and PKR.", "journal": "FEBS letters", "date": "2012-09-21", "authors": "Jeon Sung Ho, Lee Kwanbok, Lee Kwang Soo, Kunkeaw Nawapol, Johnson Betty H, Holthauzen Luis Marcelo F, Gong Bin, Leelayuwat Chanvit, Lee Yong Sun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "22986343", "url": "https://glygen.org/publication/PubMed/22986343" } ] }, { "title": "DDX31 regulates the p53-HDM2 pathway and rRNA gene transcription through its interaction with NPM1 in renal cell carcinomas.", "journal": "Cancer Res.", "date": "2012", "authors": "Fukawa T, Ono M, Matsuo T, Uehara H, Miki T, Nakamura Y, Kanayama HO, Katagiri T", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "23019224", "url": "https://glygen.org/publication/PubMed/23019224" } ] }, { "title": "Cytoplasmic STAT3 represses autophagy by inhibiting PKR activity.", "journal": "Molecular cell", "date": "2012-12-14", "authors": "Shen Shensi, Niso-Santano Mireia, Adjemian Sandy, Takehara Tetsuo, Malik Shoaib Ahmad, Minoux Herv\u00e9, Souquere Sylvie, Mari\u00f1o Guillermo, Lachkar Sylvie, Senovilla Laura, Galluzzi Lorenzo, Kepp Oliver, Pierron G\u00e9rard, Maiuri Maria Chiara, Hikita Hayato, Kroemer Romano, Kroemer Guido", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23084476", "url": "https://glygen.org/publication/PubMed/23084476" } ] }, { "title": "Cell culture and Drosophila model systems define three classes of anaplastic lymphoma kinase mutations in neuroblastoma.", "journal": "Disease models & mechanisms", "date": "2013", "authors": "Chand D, Yamazaki Y, Ruuth K, Schonherr C, Martinsson T, Kogner P, Attiyeh EF, Maris J, Morozova O, Marra MA, Ohira M, Nakagawara A, Sandstrom PE, Palmer RH, Hallberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23104988", "url": "https://glygen.org/publication/PubMed/23104988" } ] }, { "title": "Characterization of rearrangements involving the ALK gene reveals a novel truncated form associated with tumor aggressiveness in neuroblastoma.", "journal": "Cancer research", "date": "2013", "authors": "Cazes A, Louis-Brennetot C, Mazot P, Dingli F, Lombard B, Boeva V, Daveau R, Cappo J, Combaret V, Schleiermacher G, Jouannet S, Ferrand S, Pierron G, Barillot E, Loew D, Vigny M, Delattre O, Janoueix-Lerosey I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23139213", "url": "https://glygen.org/publication/PubMed/23139213" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Anaplastic lymphoma kinase (ALK): structure, oncogenic activation, and pharmacological inhibition.", "journal": "Pharmacological research", "date": "2013", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23201355", "url": "https://glygen.org/publication/PubMed/23201355" } ] }, { "title": "Activation of double-stranded RNA-activated protein kinase (PKR) by interferon-stimulated gene 15 (ISG15) modification down-regulates protein translation.", "journal": "The Journal of biological chemistry", "date": "2013-01-25", "authors": "Okumura Fumihiko, Okumura Akiko J, Uematsu Keiji, Hatakeyama Shigetsugu, Zhang Dong-Er, Kamura Takumi", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23229543", "url": "https://glygen.org/publication/PubMed/23229543" } ] }, { "title": "The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.", "journal": "PloS one", "date": "2012", "authors": "Doidge R, Mittal S, Aslam A, Winkler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "23236473", "url": "https://glygen.org/publication/PubMed/23236473" } ] }, { "title": "Crizotinib-resistant NPM-ALK mutants confer differential sensitivity to unrelated Alk inhibitors.", "journal": "Molecular cancer research : MCR", "date": "2013", "authors": "Ceccon M, Mologni L, Bisson W, Scapozza L, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "23239810", "url": "https://glygen.org/publication/PubMed/23239810" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Oh Y, Chung KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "23404503", "url": "https://glygen.org/publication/PubMed/23404503" } ] }, { "title": "Identification of recurrent FGFR3 fusion genes in lung cancer through kinome-centred RNA sequencing.", "journal": "The Journal of pathology", "date": "2013", "authors": "Majewski IJ, Mittempergher L, Davidson NM, Bosma A, Willems SM, Horlings HM, de Rink I, Greger L, Hooijer GK, Peters D, Nederlof PM, Hofland I, de Jong J, Wesseling J, Kluin RJ, Brugman W, Kerkhoven R, Nieboer F, Roepman P, Broeks A, Muley TR, Jassem J, Niklinski J, van Zandwijk N, Brazma A, Oshlack A, van den Heuvel M, Bernards R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23661334", "url": "https://glygen.org/publication/PubMed/23661334" } ] }, { "title": "SUMO regulates proteasome-dependent degradation of FLASH/Casp8AP2.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2013", "authors": "Vennemann A, Hofmann TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "23673342", "url": "https://glygen.org/publication/PubMed/23673342" } ] }, { "title": "Suppression of antiviral innate immunity by sunitinib enhances oncolytic virotherapy.", "journal": "Molecular therapy : the journal of the American Society of Gene Therapy", "date": "2013-09", "authors": "Jha Babal K, Dong Beihua, Nguyen Carvell T, Polyakova Irina, Silverman Robert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "23732991", "url": "https://glygen.org/publication/PubMed/23732991" } ] }, { "title": "Inflammatory myofibroblastic tumour of the lung with a novel PPFIBP1-ALK fusion variant.", "journal": "Histopathology", "date": "2013", "authors": "Yoshida A, Shibata T, Tsuta K, Watanabe S, Tsuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "23957430", "url": "https://glygen.org/publication/PubMed/23957430" } ] }, { "title": "ABH2 couples regulation of ribosomal DNA transcription with DNA alkylation repair.", "journal": "Cell Rep.", "date": "2013", "authors": "Li P, Gao S, Wang L, Yu F, Li J, Wang C, Li J, Wong J", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "23972994", "url": "https://glygen.org/publication/PubMed/23972994" } ] }, { "title": "Mechanistic insight into ALK receptor tyrosine kinase in human cancer biology.", "journal": "Nature reviews. Cancer", "date": "2013", "authors": "Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24060861", "url": "https://glygen.org/publication/PubMed/24060861" } ] }, { "title": "Intrinsically disordered regions of nucleophosmin/B23 regulate its RNA binding activity through their inter- and intra-molecular association.", "journal": "Nucleic acids research", "date": "2014", "authors": "Hisaoka M, Nagata K, Okuwaki M", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "24106084", "url": "https://glygen.org/publication/PubMed/24106084" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Amino acid sequence of a specific antigenic peptide of protein B23.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Chan PK, Chan WY, Yung BY, Cook RG, Aldrich MB, Ku D, Goldknopf IL, Busch H", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "2429957", "url": "https://glygen.org/publication/PubMed/2429957" } ] }, { "title": "Identification of the PKR nuclear interactome reveals roles in ribosome biogenesis, mRNA processing and cell division.", "journal": "Journal of cellular physiology", "date": "2014-08", "authors": "Blalock William L, Piazzi Manuela, Bavelloni Alberto, Raffini Mirco, Faenza Irene, D'Angelo Antonietta, Cocco Lucio", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24347309", "url": "https://glygen.org/publication/PubMed/24347309" } ] }, { "title": "Kinase fusions are frequent in Spitz tumours and spitzoid melanomas.", "journal": "Nature communications", "date": "2014", "authors": "Wiesner T, He J, Yelensky R, Esteve-Puig R, Botton T, Yeh I, Lipson D, Otto G, Brennan K, Murali R, Garrido M, Miller VA, Ross JS, Berger MF, Sparatta A, Palmedo G, Cerroni L, Busam KJ, Kutzner H, Cronin MT, Stephens PJ, Bastian BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24445538", "url": "https://glygen.org/publication/PubMed/24445538" } ] }, { "title": "Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.", "journal": "PloS one", "date": "2014", "authors": "Perot G, Soubeyran I, Ribeiro A, Bonhomme B, Savagner F, Boutet-Bouzamondo N, Hostein I, Bonichon F, Godbert Y, Chibon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24475247", "url": "https://glygen.org/publication/PubMed/24475247" } ] }, { "title": "HIP1-ALK, a novel ALK fusion variant that responds to crizotinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Fang DD, Zhang B, Gu Q, Lira M, Xu Q, Sun H, Qian M, Sheng W, Ozeck M, Wang Z, Zhang C, Chen X, Chen KX, Li J, Chen SH, Christensen J, Mao M, Chan CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "24496003", "url": "https://glygen.org/publication/PubMed/24496003" } ] }, { "title": "HIP1-ALK, a novel fusion protein identified in lung adenocarcinoma.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Hong M, Kim RN, Song JY, Choi SJ, Oh E, Lira ME, Mao M, Takeuchi K, Han J, Kim J, Choi YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "24518094", "url": "https://glygen.org/publication/PubMed/24518094" } ] }, { "title": "Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Kelly LM, Barila G, Liu P, Evdokimova VN, Trivedi S, Panebianco F, Gandhi M, Carty SE, Hodak SP, Luo J, Dacic S, Yu YP, Nikiforova MN, Ferris RL, Altschuler DL, Nikiforov YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "24613930", "url": "https://glygen.org/publication/PubMed/24613930" } ] }, { "title": "NF90 exerts antiviral activity through regulation of PKR phosphorylation and stress granules in infected cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014-04-15", "authors": "Wen Xi, Huang Xiaofeng, Mok Bobo Wing-Yee, Chen Yixin, Zheng Min, Lau Siu-Ying, Wang Pui, Song Wenjun, Jin Dong-Yan, Yuen Kwok-Yung, Chen Honglin", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24623135", "url": "https://glygen.org/publication/PubMed/24623135" } ] }, { "title": "IPS-1 plays an essential role in dsRNA-induced stress granule formation by interacting with PKR and promoting its activation.", "journal": "Journal of cell science", "date": "2014-06-01", "authors": "Zhang Peifen, Li Yuye, Xia Jun, He Junfang, Pu Jieying, Xie Jiong, Wu Siyu, Feng Lianqiang, Huang Xi, Zhang Ping", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24659800", "url": "https://glygen.org/publication/PubMed/24659800" } ] }, { "title": "The ALK inhibitor ceritinib overcomes crizotinib resistance in non-small cell lung cancer.", "journal": "Cancer discovery", "date": "2014", "authors": "Friboulet L, Li N, Katayama R, Lee CC, Gainor JF, Crystal AS, Michellys PY, Awad MM, Yanagitani N, Kim S, Pferdekamper AC, Li J, Kasibhatla S, Sun F, Sun X, Hua S, McNamara P, Mahmood S, Lockerman EL, Fujita N, Nishio M, Harris JL, Shaw AT, Engelman JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "24675041", "url": "https://glygen.org/publication/PubMed/24675041" } ] }, { "title": "A novel fusion of TPR and ALK in lung adenocarcinoma.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Choi YL, Lira ME, Hong M, Kim RN, Choi SJ, Song JY, Pandy K, Mann DL, Stahl JA, Peckham HE, Zheng Z, Han J, Mao M, Kim J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "24736082", "url": "https://glygen.org/publication/PubMed/24736082" } ] }, { "title": "A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Barraud P, Banerjee S, Mohamed WI, Jantsch MF, Allain FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "24753571", "url": "https://glygen.org/publication/PubMed/24753571" } ] }, { "title": "Isolation and characterization of a molecular cDNA clone of a human mRNA from interferon-treated cells encoding nucleolar protein B23, numatrin.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Zhang XX, Thomis DC, Samuel CE", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "2478125", "url": "https://glygen.org/publication/PubMed/2478125" } ] }, { "title": "Phosphorylation of multifunctional nucleolar protein nucleophosmin (NPM1) by aurora kinase B is critical for mitotic progression.", "journal": "FEBS letters", "date": "2014", "authors": "Shandilya J, Senapati P, Dhanasekaran K, Bangalore SS, Kumar M, Kishore AH, Bhat A, Kodaganur GS, Kundu TK", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "24857377", "url": "https://glygen.org/publication/PubMed/24857377" } ] }, { "title": "Ki-67 is a PP1-interacting protein that organises the mitotic chromosome periphery.", "journal": "eLife", "date": "2014-05-27", "authors": "Booth Daniel G, Takagi Masatoshi, Sanchez-Pulido Luis, Petfalski Elizabeth, Vargiu Giulia, Samejima Kumiko, Imamoto Naoko, Ponting Chris P, Tollervey David, Earnshaw William C, Vagnarelli Paola", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "24867636", "url": "https://glygen.org/publication/PubMed/24867636" } ] }, { "title": "AKT regulates NPM dependent ARF localization and p53mut stability in tumors.", "journal": "Oncotarget", "date": "2014-08-15", "authors": "Hamilton Garth, Abraham Aswin G, Morton Jennifer, Sampson Oliver, Pefani Dafni E, Khoronenkova Svetlana, Grawenda Anna, Papaspyropoulos Angelos, Jamieson Nigel, McKay Colin, Sansom Owen, Dianov Grigory L, O'Neill Eric", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "25071014", "url": "https://glygen.org/publication/PubMed/25071014" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "Two novel ALK mutations mediate acquired resistance to the next-generation ALK inhibitor alectinib.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2014", "authors": "Katayama R, Friboulet L, Koike S, Lockerman EL, Khan TM, Gainor JF, Iafrate AJ, Takeuchi K, Taiji M, Okuno Y, Fujita N, Engelman JA, Shaw AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "25228534", "url": "https://glygen.org/publication/PubMed/25228534" } ] }, { "title": "Revisiting STAT3 signalling in cancer: new and unexpected biological functions.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Yu H, Lee H, Herrmann A, Buettner R, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25342631", "url": "https://glygen.org/publication/PubMed/25342631" } ] }, { "title": "Identification of a novel HIP1-ALK fusion variant in Non-Small-Cell Lung Cancer (NSCLC) and discovery of ALK I1171 (I1171N/S) mutations in two ALK-rearranged NSCLC patients with resistance to Alectinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2014", "authors": "Ou SH, Klempner SJ, Greenbowe JR, Azada M, Schrock AB, Ali SM, Ross JS, Stephens PJ, Miller VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "25393796", "url": "https://glygen.org/publication/PubMed/25393796" } ] }, { "title": "Treatment Efficacy and Resistance Mechanisms Using the Second-Generation ALK Inhibitor AP26113 in Human NPM-ALK-Positive Anaplastic Large Cell Lymphoma.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Ceccon M, Mologni L, Giudici G, Piazza R, Pirola A, Fontana D, Gambacorti-Passerini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "25421750", "url": "https://glygen.org/publication/PubMed/25421750" } ] }, { "title": "Interactions of the natural product (+)-avrainvillamide with nucleophosmin and exportin-1 Mediate the cellular localization of nucleophosmin and its AML-associated mutants.", "journal": "ACS chemical biology", "date": "2015", "authors": "Mukherjee H, Chan KP, Andresen V, Hanley ML, Gjertsen BT, Myers AG", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "25531824", "url": "https://glygen.org/publication/PubMed/25531824" } ] }, { "title": "p53-derived host restriction of HIV-1 replication by protein kinase R-mediated Tat phosphorylation and inactivation.", "journal": "Journal of virology", "date": "2015-04", "authors": "Yoon Cheol-Hee, Kim Sang-Yoon, Byeon Se Eun, Jeong Yideul, Lee Jinjoo, Kim Kwang Pyo, Park Jinseu, Bae Yong-Soo", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "25653431", "url": "https://glygen.org/publication/PubMed/25653431" } ] }, { "title": "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability.", "journal": "Mol. Cell. Proteomics", "date": "2015", "authors": "Xiao Zhenyu, Chang Jer-Gung, Hendriks Ivo A, Sigur\u00f0sson J\u00f3n Otti, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "25755297", "url": "https://glygen.org/publication/PubMed/25755297" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "The chromatin scaffold protein SAFB1 localizes SUMO-1 to the promoters of ribosomal protein genes to facilitate transcription initiation and splicing.", "journal": "Nucleic acids research", "date": "2015", "authors": "Liu HW, Banerjee T, Guan X, Freitas MA, Parvin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3899300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300" } ], "reference": [ { "type": "PubMed", "id": "25800734", "url": "https://glygen.org/publication/PubMed/25800734" } ] }, { "title": "Novel ALK fusion partners in lung cancer.", "journal": "Cancer letters", "date": "2015", "authors": "Iyevleva AG, Raskin GA, Tiurin VI, Sokolenko AP, Mitiushkina NV, Aleksakhina SN, Garifullina AR, Strelkova TN, Merkulov VO, Ivantsov AO, Kuligina ESh, Pozharisski KM, Togo AV, Imyanitov EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "25813404", "url": "https://glygen.org/publication/PubMed/25813404" } ] }, { "title": "GLTSCR2 is an upstream negative regulator of nucleophosmin in cervical cancer.", "journal": "Journal of cellular and molecular medicine", "date": "2015", "authors": "Kim JY, Cho YE, An YM, Kim SH, Lee YG, Park JH, Lee S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "25818168", "url": "https://glygen.org/publication/PubMed/25818168" } ] }, { "title": "Potential role for snoRNAs in PKR activation during metabolic stress.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015-04-21", "authors": "Youssef Osama A, Safran Sarah A, Nakamura Takahisa, Nix David A, Hotamisligil G\u00f6khan S, Bass Brenda L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "25848059", "url": "https://glygen.org/publication/PubMed/25848059" } ] }, { "title": "The HBx oncoprotein of hepatitis B virus engages nucleophosmin to promote rDNA transcription and cellular proliferation.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Ahuja R, Kapoor NR, Kumar V", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "25918010", "url": "https://glygen.org/publication/PubMed/25918010" } ] }, { "title": "The Nucleolar Protein GLTSCR2 Is an Upstream Negative Regulator of the Oncogenic Nucleophosmin-MYC Axis.", "journal": "The American journal of pathology", "date": "2015", "authors": "Kim JY, Cho YE, Park JH", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "25956029", "url": "https://glygen.org/publication/PubMed/25956029" } ] }, { "title": "BIRC6-ALK, a Novel Fusion Gene in ALK Break-Apart FISH-Negative Lung Adenocarcinoma, Responds to Crizotinib.", "journal": "Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer", "date": "2015", "authors": "Shan L, Jiang P, Xu F, Zhang W, Guo L, Wu J, Zeng Y, Jiao Y, Ying J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "26001147", "url": "https://glygen.org/publication/PubMed/26001147" } ] }, { "title": "Nucleotide sequence of a cDNA clone representing a third allele of human protein B23.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Hale T K, Mansfield B C", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "2602120", "url": "https://glygen.org/publication/PubMed/2602120" } ] }, { "title": "STUMP un`stumped`: anti-tumor response to anaplastic lymphoma kinase (ALK) inhibitor based targeted therapy in uterine inflammatory myofibroblastic tumor with myxoid features harboring DCTN1-ALK fusion.", "journal": "Journal of hematology & oncology", "date": "2015", "authors": "Subbiah V, McMahon C, Patel S, Zinner R, Silva EG, Elvin JA, Subbiah IM, Ohaji C, Ganeshan DM, Anand D, Levenback CF, Berry J, Brennan T, Chmielecki J, Chalmers ZR, Mayfield J, Miller VA, Stephens PJ, Ross JS, Ali SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "26062823", "url": "https://glygen.org/publication/PubMed/26062823" } ] }, { "title": "Cytoplasmic nucleophosmin has elevated T199 phosphorylation upon which G2/M phase progression is dependent.", "journal": "Scientific reports", "date": "2015", "authors": "Chan N, Lim TM", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "26123729", "url": "https://glygen.org/publication/PubMed/26123729" } ] }, { "title": "RAS-MAPK dependence underlies a rational polytherapy strategy in EML4-ALK-positive lung cancer.", "journal": "Nature medicine", "date": "2015", "authors": "Hrustanovic G, Olivas V, Pazarentzos E, Tulpule A, Asthana S, Blakely CM, Okimoto RA, Lin L, Neel DS, Sabnis A, Flanagan J, Chan E, Varella-Garcia M, Aisner DL, Vaishnavi A, Ou SH, Collisson EA, Ichihara E, Mack PC, Lovly CM, Karachaliou N, Rosell R, Riess JW, Doebele RC, Bivona TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "26301689", "url": "https://glygen.org/publication/PubMed/26301689" } ] }, { "title": "The Regulatory and Kinase Domains but Not the Interdomain Linker Determine Human Double-stranded RNA-activated Kinase (PKR) Sensitivity to Inhibition by Viral Non-coding RNAs.", "journal": "The Journal of biological chemistry", "date": "2015-11-20", "authors": "Sunita S, Schwartz Samantha L, Conn Graeme L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26432638", "url": "https://glygen.org/publication/PubMed/26432638" } ] }, { "title": "Activated PKR inhibits pancreatic \u03b2-cell proliferation through sumoylation-dependent stabilization of P53.", "journal": "Molecular immunology", "date": "2015-12", "authors": "Song Ying, Wan XiaoMeng, Gao LiLi, Pan Yi, Xie WeiPing, Wang Hong, Guo Jun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26446704", "url": "https://glygen.org/publication/PubMed/26446704" } ] }, { "title": "ALK F1174V mutation confers sensitivity while ALK I1171 mutation confers resistance to alectinib. The importance of serial biopsy post progression.", "journal": "Lung cancer (Amsterdam, Netherlands)", "date": "2016", "authors": "Ou SH, Milliken JC, Azada MC, Miller VA, Ali SM, Klempner SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "26464158", "url": "https://glygen.org/publication/PubMed/26464158" } ] }, { "title": "Regulation of PKR by RNA: formation of active and inactive dimers.", "journal": "Biochemistry", "date": "2015-11-10", "authors": "Husain Bushra, Hesler Stephen, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26488609", "url": "https://glygen.org/publication/PubMed/26488609" } ] }, { "title": "Phosphorylation of nucleophosmin at threonine 234/237 is associated with HCC metastasis.", "journal": "Oncotarget", "date": "2015", "authors": "Ching RH, Lau EY, Ling PM, Lee JM, Ma MK, Cheng BY, Lo RC, Ng IO, Lee TK", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "26536659", "url": "https://glygen.org/publication/PubMed/26536659" } ] }, { "title": "Essential role of protein kinase R antagonism by TRS1 in human cytomegalovirus replication.", "journal": "Virology", "date": "2016-02", "authors": "Braggin Jacquelyn E, Child Stephanie J, Geballe Adam P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26716879", "url": "https://glygen.org/publication/PubMed/26716879" } ] }, { "title": "Editing of Cellular Self-RNAs by Adenosine Deaminase ADAR1 Suppresses Innate Immune Stress Responses.", "journal": "The Journal of biological chemistry", "date": "2016-03-18", "authors": "George Cyril X, Ramaswami Gokul, Li Jin Billy, Samuel Charles E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "26817845", "url": "https://glygen.org/publication/PubMed/26817845" } ] }, { "title": "Entrectinib, a Pan-TRK, ROS1, and ALK Inhibitor with Activity in Multiple Molecularly Defined Cancer Indications.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "Ardini E, Menichincheri M, Banfi P, Bosotti R, De Ponti C, Pulci R, Ballinari D, Ciomei M, Texido G, Degrassi A, Avanzi N, Amboldi N, Saccardo MB, Casero D, Orsini P, Bandiera T, Mologni L, Anderson D, Wei G, Harris J, Vernier JM, Li G, Felder E, Donati D, Isacchi A, Pesenti E, Magnaghi P, Galvani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "26939704", "url": "https://glygen.org/publication/PubMed/26939704" } ] }, { "title": "Implication of NPM1 phosphorylation and preclinical evaluation of the nucleoprotein antagonist N6L in prostate cancer.", "journal": "Oncotarget", "date": "2016", "authors": "Destouches D, Sader M, Terry S, Marchand C, Maille P, Soyeux P, Carpentier G, Semprez F, Ceraline J, Allory Y, Courty J, De La Taille A, Vacherot F", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "26993766", "url": "https://glygen.org/publication/PubMed/26993766" } ] }, { "title": "Characterization of the cDNA encoding human nucleophosmin and studies of its role in normal and abnormal growth.", "journal": "Biochemistry", "date": "1989", "authors": "Chan W Y, Liu Q R, Borjigin J, Busch H, Rennert O M, Tease L A, Chan P K", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "2713355", "url": "https://glygen.org/publication/PubMed/2713355" } ] }, { "title": "Activation of PKR by short stem-loop RNAs containing single-stranded arms.", "journal": "RNA (New York, N.Y.)", "date": "2016-07", "authors": "Mayo Christopher B, Wong C Jason, Lopez Prisma E, Lary Jeffrey W, Cole James L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27208315", "url": "https://glygen.org/publication/PubMed/27208315" } ] }, { "title": "Comprehensive Genomic Profiling Identifies a Subset of Crizotinib-Responsive ALK-Rearranged Non-Small Cell Lung Cancer Not Detected by Fluorescence In Situ Hybridization.", "journal": "The oncologist", "date": "2016", "authors": "Ali SM, Hensing T, Schrock AB, Allen J, Sanford E, Gowen K, Kulkarni A, He J, Suh JH, Lipson D, Elvin JA, Yelensky R, Chalmers Z, Chmielecki J, Peled N, Klempner SJ, Firozvi K, Frampton GM, Molina JR, Menon S, Brahmer JR, MacMahon H, Nowak J, Ou SH, Zauderer M, Ladanyi M, Zakowski M, Fischbach N, Ross JS, Stephens PJ, Miller VA, Wakelee H, Ganesan S, Salgia R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "27245569", "url": "https://glygen.org/publication/PubMed/27245569" } ] }, { "title": "Discriminating Self and Non-Self by RNA: Roles for RNA Structure, Misfolding, and Modification in Regulating the Innate Immune Sensor PKR.", "journal": "Accounts of chemical research", "date": "2016-06-21", "authors": "Hull Chelsea M, Bevilacqua Philip C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27269119", "url": "https://glygen.org/publication/PubMed/27269119" } ] }, { "title": "NF90 is a novel influenza A virus NS1-interacting protein that antagonizes the inhibitory role of NS1 on PKR phosphorylation.", "journal": "FEBS letters", "date": "2016-08", "authors": "Li Ting, Li Xi, Zhu WenFei, Wang HuiYu, Mei Lin, Wu ShaoQiang, Lin XiangMei, Han XueQing", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27423063", "url": "https://glygen.org/publication/PubMed/27423063" } ] }, { "title": "Nucleophosmin: from structure and function to disease development.", "journal": "BMC molecular biology", "date": "2016", "authors": "Box JK, Paquet N, Adams MN, Boucher D, Bolderson E, O'Byrne KJ, Richard DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "27553022", "url": "https://glygen.org/publication/PubMed/27553022" } ] }, { "title": "The role of the ALK receptor in cancer biology.", "journal": "Annals of oncology : official journal of the European Society for Medical Oncology", "date": "2016", "authors": "Hallberg B, Palmer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "27573755", "url": "https://glygen.org/publication/PubMed/27573755" } ] }, { "title": "PPM1D controls nucleolar formation by up-regulating phosphorylation of nucleophosmin.", "journal": "Scientific reports", "date": "2016", "authors": "Kozakai Y, Kamada R, Furuta J, Kiyota Y, Chuman Y, Sakaguchi K", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "27619510", "url": "https://glygen.org/publication/PubMed/27619510" } ] }, { "title": "The nucleotide sequence of a human cDNA encoding the highly conserved nucleolar phosphoprotein B23.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Li X Z, McNeilage L J, Whittingham S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "2775293", "url": "https://glygen.org/publication/PubMed/2775293" } ] }, { "title": "ALK oncoproteins in atypical inflammatory myofibroblastic tumours: novel RRBP1-ALK fusions in epithelioid inflammatory myofibroblastic sarcoma.", "journal": "The Journal of pathology", "date": "2017", "authors": "Lee JC, Li CF, Huang HY, Zhu MJ, Marino-Enriquez A, Lee CT, Ou WB, Hornick JL, Fletcher JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "27874193", "url": "https://glygen.org/publication/PubMed/27874193" } ] }, { "title": "Mechanism of Protein Kinase R Inhibition by Human Cytomegalovirus pTRS1.", "journal": "Journal of virology", "date": "2017", "authors": "Vincent HA, Ziehr B, Moorman NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "27974558", "url": "https://glygen.org/publication/PubMed/27974558" } ] }, { "title": "Nucleocapsid Interacts with NPM1 and Protects it from Proteolytic Cleavage, Enhancing Cell Survival, and is Involved in PEDV Growth.", "journal": "Scientific reports", "date": "2017", "authors": "Shi D, Shi H, Sun D, Chen J, Zhang X, Wang X, Zhang J, Ji Z, Liu J, Cao L, Zhu X, Yuan J, Dong H, Wang X, Chang T, Liu Y, Feng L", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "28045037", "url": "https://glygen.org/publication/PubMed/28045037" } ] }, { "title": "Human noncoding RNA 886 (nc886) adopts two structurally distinct conformers that are functionally opposing regulators of PKR.", "journal": "RNA (New York, N.Y.)", "date": "2017-04", "authors": "Calderon Brenda M, Conn Graeme L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28069888", "url": "https://glygen.org/publication/PubMed/28069888" } ] }, { "title": "ADAR1 and PACT contribute to efficient translation of transcripts containing HIV-1 trans-activating response (TAR) element.", "journal": "The Biochemical journal", "date": "2017", "authors": "Chukwurah E, Handy I, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28167698", "url": "https://glygen.org/publication/PubMed/28167698" } ] }, { "title": "Serine ADP-Ribosylation Depends on HPF1.", "journal": "Molecular cell", "date": "2017", "authors": "Bonfiglio JJ, Fontana P, Zhang Q, Colby T, Gibbs-Seymour I, Atanassov I, Bartlett E, Zaja R, Ahel I, Matic I", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "28190768", "url": "https://glygen.org/publication/PubMed/28190768" } ] }, { "title": "Auto-phosphorylation Represses Protein Kinase R Activity.", "journal": "Scientific reports", "date": "2017-03-10", "authors": "Wang Die, de Weerd Nicole A, Willard Belinda, Polekhina Galina, Williams Bryan R G, Sadler Anthony J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28281686", "url": "https://glygen.org/publication/PubMed/28281686" } ] }, { "title": "Identification of a novel crizotinib-sensitive BCL11A-ALK gene fusion in a nonsmall cell lung cancer patient.", "journal": "The European respiratory journal", "date": "2017", "authors": "Tian Q, Deng WJ, Li ZW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "28404650", "url": "https://glygen.org/publication/PubMed/28404650" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene.", "journal": "Haematologica", "date": "2017", "authors": "van der Krogt JA, Bempt MV, Ferreiro JF, Mentens N, Jacobs K, Pluys U, Doms K, Geerdens E, Uyttebroeck A, Pierre P, Michaux L, Devos T, Vandenberghe P, Tousseyn T, Cools J, Wlodarska I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "28659337", "url": "https://glygen.org/publication/PubMed/28659337" } ] }, { "title": "Molecular breakdown: a comprehensive view of anaplastic lymphoma kinase (ALK)-rearranged non-small cell lung cancer.", "journal": "The Journal of pathology", "date": "2017", "authors": "Noh KW, Lee MS, Lee SE, Song JY, Shin HT, Kim YJ, Oh DY, Jung K, Sung M, Kim M, An S, Han J, Shim YM, Zo JI, Kim J, Park WY, Lee SH, Choi YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "28741662", "url": "https://glygen.org/publication/PubMed/28741662" } ] }, { "title": "Non-coding RNA 886 promotes renal cell carcinoma growth and metastasis through the Janus kinase 2/signal transducer and activator of transcription 3 signaling pathway.", "journal": "Molecular medicine reports", "date": "2017-10", "authors": "Lei Jun, Xiao Ju-Hua, Zhang Shou-Hua, Liu Zhi-Qiang, Huang Kai, Luo Zhi-Peng, Xiao Xin-Lan, Hong Zheng-Dong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "28765891", "url": "https://glygen.org/publication/PubMed/28765891" } ] }, { "title": "Inhibition of the inflammatory response to stress by targeting interaction between PKR and its cellular activator PACT.", "journal": "Scientific reports", "date": "2017-11-23", "authors": "Dabo Stephanie, Maillard Patrick, Collados Rodriguez Milagros, Hansen Marianne Dor\u00e9, Mazouz Sabrina, Bigot Donna-Joe, Tible Marion, Janvier Genevi\u00e8ve, Helynck Olivier, Cassonnet Patricia, Jacob Yves, Bellalou Jacques, Gatignol Anne, Patel Rekha C, Hugon Jacques, Munier-Lehmann H\u00e9l\u00e8ne, Meurs Eliane F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29170442", "url": "https://glygen.org/publication/PubMed/29170442" } ] }, { "title": "PPP2R5A: A multirole protein phosphatase subunit in regulating cancer development.", "journal": "Cancer letters", "date": "2018", "authors": "Mao Z, Liu C, Lin X, Sun B, Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29175459", "url": "https://glygen.org/publication/PubMed/29175459" } ] }, { "title": "Contribution of the two dsRBM motifs to the double-stranded RNA binding and protein interactions of PACT.", "journal": "Journal of cellular biochemistry", "date": "2018-04", "authors": "Chukwurah Evelyn, Willingham Victoria, Singh Madhurima, Castillo-Azofeifa David, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29231267", "url": "https://glygen.org/publication/PubMed/29231267" } ] }, { "title": "Stress-induced TRBP phosphorylation enhances its interaction with PKR to regulate cellular survival.", "journal": "Scientific reports", "date": "2018", "authors": "Chukwurah E, Patel RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29348664", "url": "https://glygen.org/publication/PubMed/29348664" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "database": "O-GlcNAc Atlas", "id": "P06748", "url": "https://oglcnac.org/atlas/detail/P06748" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Nc886 is epigenetically repressed in prostate cancer and acts as a tumor suppressor through the inhibition of cell growth.", "journal": "BMC cancer", "date": "2018-02-02", "authors": "Fort Rafael Sebasti\u00e1n, Math\u00f3 Cecilia, Geraldo Murilo Vieira, Ottati Mar\u00eda Carolina, Yamashita Alex Shimura, Saito Kelly Cristina, Leite Katia Ramos Moreira, M\u00e9ndez Manuel, Maedo Noem\u00ed, M\u00e9ndez Laura, Garat Beatriz, Kimura Edna Teruko, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29394925", "url": "https://glygen.org/publication/PubMed/29394925" } ] }, { "title": "Human ADAR1 Prevents Endogenous RNA from Triggering Translational Shutdown.", "journal": "Cell", "date": "2018-02-08", "authors": "Chung Hachung, Calis Jorg J A, Wu Xianfang, Sun Tony, Yu Yingpu, Sarbanes Stephanie L, Dao Thi Viet Loan, Shilvock Abigail R, Hoffmann H-Heinrich, Rosenberg Brad R, Rice Charles M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29395325", "url": "https://glygen.org/publication/PubMed/29395325" } ] }, { "title": "Role of eIF2\u03b1 Kinases in Translational Control and Adaptation to Cellular Stress.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2018-07-02", "authors": "Wek Ronald C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29440070", "url": "https://glygen.org/publication/PubMed/29440070" } ] }, { "title": "Role and targeting of anaplastic lymphoma kinase in cancer.", "journal": "Molecular cancer", "date": "2018", "authors": "Della Corte CM, Viscardi G, Di Liello R, Fasano M, Martinelli E, Troiani T, Ciardiello F, Morgillo F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "29455642", "url": "https://glygen.org/publication/PubMed/29455642" } ] }, { "title": "Inflammation kinase PKR phosphorylates \u03b1-synuclein and causes \u03b1-synuclein-dependent cell death.", "journal": "Neurobiology of disease", "date": "2018-07", "authors": "Reimer Lasse, Vesterager Louise Buur, Betzer Cristine, Zheng Jin, Nielsen L\u00e6rke Dalsgaard, Kofoed Rikke Hahn, Lassen Louise Berkhoudt, B\u00f8lcho Ulrik, Paludan S\u00f8ren Riis, Fog Karina, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "29501855", "url": "https://glygen.org/publication/PubMed/29501855" } ] }, { "title": "The AP-1-BATF and -BATF3 module is essential for growth, survival and TH17/ILC3 skewing of anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2018", "authors": "Schleussner N, Merkel O, Costanza M, Liang HC, Hummel F, Romagnani C, Durek P, Anagnostopoulos I, Hummel M, Johrens K, Niedobitek A, Griffin PR, Piva R, Sczakiel HL, Woessmann W, Damm-Welk C, Hinze C, Stoiber D, Gillissen B, Turner SD, Kaergel E, von Hoff L, Grau M, Lenz G, Dorken B, Scheidereit C, Kenner L, Janz M, Mathas S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "29588546", "url": "https://glygen.org/publication/PubMed/29588546" } ] }, { "title": "Interaction of CacyBP/SIP with NPM1 and its influence on NPM1 localization and function in oxidative stress.", "journal": "Journal of cellular physiology", "date": "2018", "authors": "Rosinska S, Filipek A", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "29806702", "url": "https://glygen.org/publication/PubMed/29806702" } ] }, { "title": "STAT3: a multifaceted oncoprotein.", "journal": "Growth factors (Chur, Switzerland)", "date": "2018", "authors": "Guanizo AC, Fernando CD, Garama DJ, Gough DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "29873274", "url": "https://glygen.org/publication/PubMed/29873274" } ] }, { "title": "Dependency on the TYK2/STAT1/MCL1 axis in anaplastic large cell lymphoma.", "journal": "Leukemia", "date": "2019", "authors": "Prutsch N, Gurnhofer E, Suske T, Liang HC, Schlederer M, Roos S, Wu LC, Simonitsch-Klupp I, Alvarez-Hernandez A, Kornauth C, Leone DA, Svinka J, Eferl R, Limberger T, Aufinger A, Shirsath N, Wolf P, Hielscher T, Aberger F, Schmoellerl J, Stoiber D, Strobl B, Jager U, Staber PB, Grebien F, Moriggl R, Muller M, Inghirami GG, Sanda T, Look AT, Turner SD, Kenner L, Merkel O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "30131584", "url": "https://glygen.org/publication/PubMed/30131584" } ] }, { "title": "PKR Senses Nuclear and Mitochondrial Signals by Interacting with Endogenous Double-Stranded RNAs.", "journal": "Molecular cell", "date": "2018-09-20", "authors": "Kim Yoosik, Park Joha, Kim Sujin, Kim MinA, Kang Myeong-Gyun, Kwak Chulhwan, Kang Minjeong, Kim Baekgyu, Rhee Hyun-Woo, Kim V Narry", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "30174290", "url": "https://glygen.org/publication/PubMed/30174290" } ] }, { "title": "O-GlcNAc-induced nuclear translocation of hnRNP-K is associated with progression and metastasis of cholangiocarcinoma.", "journal": "Molecular oncology", "date": "2019", "authors": "Phoomak C, Park D, Silsirivanit A, Sawanyawisuth K, Vaeteewoottacharn K, Detarya M, Wongkham C, Lebrilla CB, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "30444036", "url": "https://glygen.org/publication/PubMed/30444036" } ] }, { "title": "Phosphoproteome Profiling Reveals Multifunctional Protein NPM1 as part of the Irradiation Response of Tumor Cells.", "journal": "Translational oncology", "date": "2019", "authors": "Wiesmann N, Gieringer R, Grus F, Brieger J", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "30453269", "url": "https://glygen.org/publication/PubMed/30453269" } ] }, { "title": "The Transcriptional Regulator Sin3A Contributes to the Oncogenic Potential of STAT3.", "journal": "Cancer research", "date": "2019", "authors": "Gambi G, Di Simone E, Basso V, Ricci L, Wang R, Verma A, Elemento O, Ponzoni M, Inghirami G, Icardi L, Mondino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "30692217", "url": "https://glygen.org/publication/PubMed/30692217" } ] }, { "title": "The search for a PKR code-differential regulation of protein kinase R activity by diverse RNA and protein regulators.", "journal": "RNA (New York, N.Y.)", "date": "2019", "authors": "Bou-Nader C, Gordon JM, Henderson FE, Zhang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "30770398", "url": "https://glygen.org/publication/PubMed/30770398" } ] }, { "title": "Structure and Degradation of Circular RNAs Regulate PKR Activation in Innate Immunity.", "journal": "Cell", "date": "2019-05-02", "authors": "Liu Chu-Xiao, Li Xiang, Nan Fang, Jiang Shan, Gao Xiang, Guo Si-Kun, Xue Wei, Cui Yange, Dong Kaige, Ding Huihua, Qu Bo, Zhou Zhaocai, Shen Nan, Yang Li, Chen Ling-Ling", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "31031002", "url": "https://glygen.org/publication/PubMed/31031002" } ] }, { "title": "Palbociclib Promotes Dephosphorylation of NPM/B23 at Threonine 199 and Inhibits Endometrial Cancer Cell Growth.", "journal": "Cancers", "date": "2019", "authors": "Lin CY, Lee LY, Wang TH, Hsu CL, Tsai CL, Chao A, Lai CH", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "31330844", "url": "https://glygen.org/publication/PubMed/31330844" } ] }, { "title": "The Transcriptional Roles of ALK Fusion Proteins in Tumorigenesis.", "journal": "Cancers", "date": "2019", "authors": "Ducray SP, Natarajan K, Garland GD, Turner SD, Egger G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "31366041", "url": "https://glygen.org/publication/PubMed/31366041" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "database": "O-GlcNAc Atlas", "id": "P06748", "url": "https://oglcnac.org/atlas/detail/P06748" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "Molecular Modeling of ALK L1198F and/or G1202R Mutations to Determine Differential Crizotinib Sensitivity.", "journal": "Scientific reports", "date": "2019", "authors": "Chuang YC, Huang BY, Chang HW, Yang CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9700645", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645" } ], "reference": [ { "type": "PubMed", "id": "31388026", "url": "https://glygen.org/publication/PubMed/31388026" } ] }, { "title": "NPM-ALK Is a Key Regulator of the Oncoprotein FOXM1 in ALK-Positive Anaplastic Large Cell Lymphoma.", "journal": "Cancers", "date": "2019", "authors": "Haque M, Li J, Huang YH, Almowaled M, Barger CJ, Karpf AR, Wang P, Chen W, Turner SD, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "31390744", "url": "https://glygen.org/publication/PubMed/31390744" } ] }, { "title": "Proteomic Phosphosite Analysis Identified Crucial NPM-ALK-Mediated NIPA Serine and Threonine Residues.", "journal": "International journal of molecular sciences", "date": "2019", "authors": "Gengenbacher A, Muller-Rudorf A, Poggio T, Grassel L, Dumit VI, Kreutmair S, Lippert LJ, Duyster J, Illert AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "31434245", "url": "https://glygen.org/publication/PubMed/31434245" } ] }, { "title": "Global profiling of O-GlcNAcylated and/or phosphorylated proteins in hepatoblastoma.", "journal": "Signal transduction and targeted therapy", "date": "2019", "authors": "Song H, Ma J, Bian Z, Chen S, Zhu J, Wang J, Huang N, Yin M, Sun F, Xu M, Pan Q", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" }, { "database": "O-GlcNAc Atlas", "id": "P06748", "url": "https://oglcnac.org/atlas/detail/P06748" } ], "reference": [ { "type": "PubMed", "id": "31637018", "url": "https://glygen.org/publication/PubMed/31637018" } ] }, { "title": "vtRNA2-1/nc886 Produces a Small RNA That Contributes to Its Tumor Suppression Action through the microRNA Pathway in Prostate Cancer.", "journal": "Non-coding RNA", "date": "2020-02-20", "authors": "Fort Rafael Sebasti\u00e1n, Garat Beatriz, Sotelo-Silveira Jos\u00e9 Roberto, Duhagon Mar\u00eda Ana", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32093270", "url": "https://glygen.org/publication/PubMed/32093270" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Aurora-B Promotes Osteosarcoma Cell Growth and Metastasis Through Activation of the NPM1/ERK/NF-\u03ba\u03b2/MMPs Axis.", "journal": "Cancer management and research", "date": "2020", "authors": "Song Honghai, Zhou Yang, Peng Aifen, Liu Jiaming, Wu Xin, Chen Wenzhao, Liu Zhili", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "32606971", "url": "https://glygen.org/publication/PubMed/32606971" } ] }, { "title": "T95 nucleophosmin phosphorylation as a novel mediator and marker of regulated cell death in acute kidney injury.", "journal": "American journal of physiology. Renal physiology", "date": "2020-09-01", "authors": "Wang Zhiyong, Belghasem Mostafa, Salih Erdjan, Henderson Joel, Igwebuike Chinaemere, Havasi Andrea, Borkan Steven C", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "32686519", "url": "https://glygen.org/publication/PubMed/32686519" } ] }, { "title": "PKR kinase directly regulates tau expression and Alzheimer's disease-related tau phosphorylation.", "journal": "Brain pathology (Zurich, Switzerland)", "date": "2021-01", "authors": "Reimer Lasse, Betzer Cristine, Kofoed Rikke Hahn, Volbracht Christiane, Fog Karina, Kurhade Chaitanya, Nilsson Emma, \u00d6verby Anna K, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32716602", "url": "https://glygen.org/publication/PubMed/32716602" } ] }, { "title": "Cell fate determined by the activation balance between PKR and SPHK1.", "journal": "Cell death and differentiation", "date": "2021-01", "authors": "Qiao Han, Jiang Tianqing, Mu Peiqiang, Chen Xiaoxuan, Wen Xianhui, Hu Zhangsheng, Tang Shulin, Wen Jikai, Deng Yiqun", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "32801355", "url": "https://glygen.org/publication/PubMed/32801355" } ] }, { "title": "Nucleolar protein NPM1 is essential for circovirus replication by binding to viral capsid.", "journal": "Virulence", "date": "2020-12", "authors": "Zhou Jianwei, Dai Yadong, Lin Cui, Zhang Ying, Feng Zixuan, Dong Weiren, Jin Yulan, Yan Yan, Zhou Jiyong, Gu Jinyan", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "33073687", "url": "https://glygen.org/publication/PubMed/33073687" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "G protein coupled receptor kinase 5 modifies the nucleolar stress response activated by actinomycin D.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2021-08", "authors": "Sok Vanessa, Jacinto Alec Z, Peng Natalie, Eldemerdash Mohamed, Le Lysa, Tran Philip D, Feng Li Feng, Patel Jigisha R, Gi Michael, Ammon Jane C, So Christopher H", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "33507833", "url": "https://glygen.org/publication/PubMed/33507833" } ] }, { "title": "Nucleophosmin Protein Dephosphorylation by DUSP3 Is a Fine-Tuning Regulator of p53 Signaling to Maintain Genomic Stability.", "journal": "Frontiers in cell and developmental biology", "date": "2021", "authors": "Russo Lilian C, Ferruzo Pault Y M, Forti Fabio L", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "33777934", "url": "https://glygen.org/publication/PubMed/33777934" } ] }, { "title": "The PKR/P38/RIPK1 Signaling Pathway as a Therapeutic Target in Alzheimer's Disease.", "journal": "International journal of molecular sciences", "date": "2021-03-19", "authors": "Hugon Jacques, Paquet Claire", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "33808629", "url": "https://glygen.org/publication/PubMed/33808629" } ] }, { "title": "PKR activity modulation by phosphomimetic mutations of serine residues located three aminoacids upstream of double-stranded RNA binding motifs.", "journal": "Scientific reports", "date": "2021-04-28", "authors": "Cesaro Teresa, Hayashi Yohei, Borghese Fabian, Vertommen Didier, Wavreil Fanny, Michiels Thomas", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "33911136", "url": "https://glygen.org/publication/PubMed/33911136" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Regulation of PKR activation and apoptosis during oxidative stress by TRBP phosphorylation.", "journal": "The international journal of biochemistry & cell biology", "date": "2021-08", "authors": "Ukhueduan Benedicth, Chukwurah Evelyn, Patel Rekha C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "34174402", "url": "https://glygen.org/publication/PubMed/34174402" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "4-Deoxy-4-fluoro-GalNAz (4FGalNAz) Is a Metabolic Chemical Reporter of O-GlcNAc Modifications, Highlighting the Notable Substrate Flexibility of O-GlcNAc Transferase.", "journal": "ACS chemical biology", "date": "2022", "authors": "Jackson EG, Cutolo G, Yang B, Yarravarapu N, Burns MWN, Bineva-Todd G, Roustan C, Thoden JB, Lin-Jones HM, van Kuppevelt TH, Holden HM, Schumann B, Kohler JJ, Woo CM, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "34931806", "url": "https://glygen.org/publication/PubMed/34931806" } ] }, { "title": "Nc886 promotes renal cancer cell drug-resistance by enhancing EMT through Rock2 phosphorylation-mediated \u03b2-catenin nuclear translocation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2022-02", "authors": "Gao Weiyin, Zhang Shouhua, Guorong Li, Liu Queling, Zhu Anyi, Gui Fu, Zou Yan, Wu Yiguo, Luo Yang, Hong Zhengdong", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "34974812", "url": "https://glygen.org/publication/PubMed/34974812" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Downregulation of nc886 contributes to prostate cancer cell invasion and TGF\u03b21-induced EMT.", "journal": "Genes & diseases", "date": "2022-07", "authors": "Yang Ronghui, Zuo Lingkun, Ma Hui, Zhou Ying, Zhou Ping, Wang Liyong, Wang Miao, Latif Mahrukh, Kong Lu", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "35685460", "url": "https://glygen.org/publication/PubMed/35685460" } ] }, { "title": "Mitochondrial double-stranded RNAs govern the stress response in chondrocytes to promote osteoarthritis development.", "journal": "Cell reports", "date": "2022-08-09", "authors": "Kim Sujin, Lee Keonyong, Choi Yong Seok, Ku Jayoung, Kim Hyeonkyeong, Kharbash Raisa, Yoon Jimin, Lee Yong Seuk, Kim Jin-Hong, Lee Yun Jong, Kim Yoosik", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "35947956", "url": "https://glygen.org/publication/PubMed/35947956" } ] }, { "title": "Protein kinase R dependent phosphorylation of \u03b1-synuclein regulates its membrane binding and aggregation.", "journal": "PNAS nexus", "date": "2022-11", "authors": "Reimer Lasse, Gram Hjalte, Jensen Nanna M\u00f8ller, Betzer Cristine, Yang Li, Jin Lorrain, Shi Min, Boudeffa Driss, Fusco Giuliana, De Simone Alfonso, Kirik Deniz, Lashuel Hilal A, Zhang Jing, Jensen Poul Henning", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "36712380", "url": "https://glygen.org/publication/PubMed/36712380" } ] }, { "title": "Inhibition of RNA-binding proteins with small molecules.", "journal": "Nature reviews. Chemistry", "date": "2020-09", "authors": "Wu Peng", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "37127961", "url": "https://glygen.org/publication/PubMed/37127961" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06748", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06748" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "KLF2 transcription suppresses endometrial cancer cell proliferation, invasion, and migration through the inhibition of NPM1.", "journal": "Journal of obstetrics and gynaecology : the journal of the Institute of Obstetrics and Gynaecology", "date": "2023-12", "authors": "Cheng Xiyun, Shen Changmei, Liao Zhenrong", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ], "reference": [ { "type": "PubMed", "id": "37610103", "url": "https://glygen.org/publication/PubMed/37610103" } ] }, { "title": "DDX24 Mutation Alters NPM1 Phase Behavior and Disrupts Nucleolar Homeostasis in Vascular Malformations.", "journal": "International journal of biological sciences", "date": "2023", "authors": "Zhang Haopei, Chen Qiuyue, Zhang Qianqian, Gan Hairun, Li Hanjie, Chen Shoudeng, Shan Hong, Pang Pengfei, He Huanhuan", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ], "reference": [ { "type": "PubMed", "id": "37705750", "url": "https://glygen.org/publication/PubMed/37705750" } ] }, { "title": "The acidic stretch and the C-terminal nuclear export signal motif of NPM1 mutant: are they druggable in AML?", "journal": "Leukemia", "date": "2023-11", "authors": "Falini Brunangelo, Gjertsen Bjorn T, Andresen Vibeke", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ], "reference": [ { "type": "PubMed", "id": "37740103", "url": "https://glygen.org/publication/PubMed/37740103" } ] }, { "title": "The acetylation of STAT3 at K685 attenuates NPM-ALK-induced tumorigenesis.", "journal": "Cellular signalling", "date": "2024-02", "authors": "Korai Akira, Lin Xin, Tago Kenji, Funakoshi-Tago Megumi", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ], "reference": [ { "type": "PubMed", "id": "38000524", "url": "https://glygen.org/publication/PubMed/38000524" } ] }, { "title": "Pumilio1 regulates NPM3/NPM1 axis to promote PD-L1-mediated immune escape in gastric cancer.", "journal": "Cancer letters", "date": "2024-01-28", "authors": "Wang Han, Zhou Zhijun, Zhang Junchang, Hao Tengfei, Wang Pengliang, Wu Pei, Su Rishun, Yang Huan, Deng Guofei, Chen Songyao, Gu Liang, He Yulong, Zeng Leli, Zhang Changhua, Yin Songcheng", "evidence": [ { "database": "RefSeq", "id": "NP_001032827", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032827" } ], "reference": [ { "type": "PubMed", "id": "38029539", "url": "https://glygen.org/publication/PubMed/38029539" } ] }, { "title": "Amino acid sequence of protein B23 phosphorylation site.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Chan PK, Aldrich M, Cook RG, Busch H", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "3944116", "url": "https://glygen.org/publication/PubMed/3944116" } ] }, { "title": "Sequence of a phosphorylation site in nucleolar protein B23.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Jones CE, Busch H, Olson MO", "evidence": [ { "database": "iPTMnet", "id": "P06748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748" } ], "reference": [ { "type": "PubMed", "id": "7213797", "url": "https://glygen.org/publication/PubMed/7213797" } ] }, { "title": "HIV-1 Tat directly interacts with the interferon-induced, double-stranded RNA-dependent kinase, PKR.", "journal": "Virology", "date": "1995-11-10", "authors": "McMillan N A, Chun R F, Siderovski D P, Galabru J, Toone W M, Samuel C E, Mak T W, Hovanessian A G, Jeang K T, Williams B R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7491766", "url": "https://glygen.org/publication/PubMed/7491766" } ] }, { "title": "TAR RNA-binding protein is an inhibitor of the interferon-induced protein kinase PKR.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-05-24", "authors": "Park H, Davies M V, Langland J O, Chang H W, Nam Y S, Tartaglia J, Paoletti E, Jacobs B L, Kaufman R J, Venkatesan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7515177", "url": "https://glygen.org/publication/PubMed/7515177" } ] }, { "title": "The interferon-inducible double-stranded RNA-activated protein kinase self-associates in vitro and in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995-08-29", "authors": "Patel R C, Stanton P, McMillan N M, Williams B R, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7545299", "url": "https://glygen.org/publication/PubMed/7545299" } ] }, { "title": "Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase.", "journal": "Molecular and cellular biology", "date": "1995-10", "authors": "Patterson J B, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7565688", "url": "https://glygen.org/publication/PubMed/7565688" } ] }, { "title": "Modification of nucleolar protein B23 after exposure to ionizing radiation.", "journal": "Radiat. Res.", "date": "1995", "authors": "Ramsamooj P, Notario V, Dritschilo A", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "7631008", "url": "https://glygen.org/publication/PubMed/7631008" } ] }, { "title": "Mechanism of interferon action: evidence for intermolecular autophosphorylation and autoactivation of the interferon-induced, RNA-dependent protein kinase PKR.", "journal": "Journal of virology", "date": "1993-12", "authors": "Thomis D C, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7693978", "url": "https://glygen.org/publication/PubMed/7693978" } ] }, { "title": "Nuclear localization of the interferon-inducible protein kinase PKR in human cells and transfected mouse cells.", "journal": "Experimental cell research", "date": "1995-05", "authors": "Jeffrey I W, Kadereit S, Meurs E F, Metzger T, Bachmann M, Schwemmle M, Hovanessian A G, Clemens M J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7737357", "url": "https://glygen.org/publication/PubMed/7737357" } ] }, { "title": "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Morris SW, Kirstein MN, Valentine MB, Dittmer K, Shapiro DN, Look AT, Saltman DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "7824924", "url": "https://glygen.org/publication/PubMed/7824924" } ] }, { "title": "Organization of the double-stranded RNA-activated protein kinase DAI and virus-associated VA RNAI in adenovirus-2-infected HeLa cells.", "journal": "Journal of cell science", "date": "1993-09", "authors": "Jim\u00e9nez-Garc\u00eda L F, Green S R, Mathews M B, Spector D L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "7903669", "url": "https://glygen.org/publication/PubMed/7903669" } ] }, { "title": "Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.", "journal": "Science", "date": "1994", "authors": "Morris S W, Kirstein M N, Valentine M B, Dittmer K G, Shapiro D N, Saltman D L, Look A T", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "8122112", "url": "https://glygen.org/publication/PubMed/8122112" } ] }, { "title": "Nucleolar targeting signal of Rex protein of human T-cell leukemia virus type I specifically binds to nucleolar shuttle protein B-23.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Adachi Y, Copeland T D, Hatanaka M, Oroszlan S", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "8314759", "url": "https://glygen.org/publication/PubMed/8314759" } ] }, { "title": "The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.", "journal": "Blood", "date": "1996", "authors": "Redner R L, Rush E A, Faas S, Rudert W A, Corey S J", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "8562957", "url": "https://glygen.org/publication/PubMed/8562957" } ] }, { "title": "The t(3;5)(q25.1;q34) of myelodysplastic syndrome and acute myeloid leukemia produces a novel fusion gene, NPM-MLF1.", "journal": "Oncogene", "date": "1996", "authors": "Yoneda-Kato N, Look AT, Kirstein MN, Valentine MB, Raimondi SC, Cohen KJ, Carroll AJ, Morris SW", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "8570204", "url": "https://glygen.org/publication/PubMed/8570204" } ] }, { "title": "The P58 cellular inhibitor complexes with the interferon-induced, double-stranded RNA-dependent protein kinase, PKR, to regulate its autophosphorylation and activity.", "journal": "The Journal of biological chemistry", "date": "1996-01-19", "authors": "Polyak S J, Tang N, Wambach M, Barber G N, Katze M G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8576172", "url": "https://glygen.org/publication/PubMed/8576172" } ] }, { "title": "Double-stranded (ds) RNA binding and not dimerization correlates with the activation of the dsRNA-dependent protein kinase (PKR).", "journal": "The Journal of biological chemistry", "date": "1996-01-19", "authors": "Wu S, Kaufman R J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8576179", "url": "https://glygen.org/publication/PubMed/8576179" } ] }, { "title": "Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Fujimoto J, Shiota M, Iwahara T, Seki N, Satoh H, Mori S, Yamamoto T", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "8633037", "url": "https://glygen.org/publication/PubMed/8633037" } ] }, { "title": "Characterization of the heparin-mediated activation of PKR, the interferon-inducible RNA-dependent protein kinase.", "journal": "Virology", "date": "1996-07-01", "authors": "George C X, Thomis D C, McCormack S J, Svahn C M, Samuel C E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8661426", "url": "https://glygen.org/publication/PubMed/8661426" } ] }, { "title": "Specific mutations near the amino terminus of double-stranded RNA-dependent protein kinase (PKR) differentially affect its double-stranded RNA binding and dimerization properties.", "journal": "The Journal of biological chemistry", "date": "1996-10-11", "authors": "Patel R C, Stanton P, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8810342", "url": "https://glygen.org/publication/PubMed/8810342" } ] }, { "title": "The 58-kDa cellular inhibitor of the double stranded RNA-dependent protein kinase requires the tetratricopeptide repeat 6 and DnaJ motifs to stimulate protein synthesis in vivo.", "journal": "The Journal of biological chemistry", "date": "1996-11-08", "authors": "Tang N M, Ho C Y, Katze M G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "8910500", "url": "https://glygen.org/publication/PubMed/8910500" } ] }, { "title": "Identification of BTG2, an antiproliferative p53-dependent component of the DNA damage cellular response pathway.", "journal": "Nature genetics", "date": "1996", "authors": "Rouault JP, Falette N, Guehenneux F, Guillot C, Rimokh R, Wang Q, Berthet C, Moyret-Lalle C, Savatier P, Pain B, Shaw P, Berger R, Samarut J, Magaud JP, Ozturk M, Samarut C, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "8944033", "url": "https://glygen.org/publication/PubMed/8944033" } ] }, { "title": "Oncogenic potential of TAR RNA binding protein TRBP and its regulatory interaction with RNA-dependent protein kinase PKR.", "journal": "The EMBO journal", "date": "1997-02-03", "authors": "Benkirane M, Neuveut C, Chun R F, Smith S M, Samuel C E, Gatignol A, Jeang K T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9034343", "url": "https://glygen.org/publication/PubMed/9034343" } ] }, { "title": "The Tat protein of human immunodeficiency virus type 1 is a substrate and inhibitor of the interferon-induced, virally activated protein kinase, PKR.", "journal": "The Journal of biological chemistry", "date": "1997-03-28", "authors": "Brand S R, Kobayashi R, Mathews M B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9079663", "url": "https://glygen.org/publication/PubMed/9079663" } ] }, { "title": "Isolation and characterization of the human nucleophosmin/B23 (NPM) gene: identification of the YY1 binding site at the 5' enhancer region.", "journal": "Nucleic Acids Res.", "date": "1997", "authors": "Chan P K, Chan F Y, Morris S W, Xie Z", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "9092633", "url": "https://glygen.org/publication/PubMed/9092633" } ] }, { "title": "Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin.", "journal": "Biochemistry", "date": "1997", "authors": "Szebeni A, Mehrotra B, Baumann A, Adam SA, Wingfield PT, Olson MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "9092824", "url": "https://glygen.org/publication/PubMed/9092824" } ] }, { "title": "A two-dimensional gel database of human colon carcinoma proteins.", "journal": "Electrophoresis", "date": "1997", "authors": "Ji H, Reid GE, Moritz RL, Eddes JS, Burgess AW, Simpson RJ", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "reference": [ { "type": "PubMed", "id": "9150948", "url": "https://glygen.org/publication/PubMed/9150948" } ] }, { "title": "Regulation of apoptosis and cell cycle arrest by Zac1, a novel zinc finger protein expressed in the pituitary gland and the brain.", "journal": "The EMBO journal", "date": "1997", "authors": "Spengler D, Villalba M, Hoffmann A, Pantaloni C, Houssami S, Bockaert J, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9184226", "url": "https://glygen.org/publication/PubMed/9184226" } ] }, { "title": "missing tag=TI", "journal": "missing tag=JT", "date": "missing", "authors": "author information missing", "evidence": [ { "database": "iPTMnet", "id": "P06748-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06748-1" } ], "reference": [ { "type": "PubMed", "id": "93076812", "url": "https://glygen.org/publication/PubMed/93076812" } ] }, { "title": "Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta.", "journal": "Journal of molecular biology", "date": "1997", "authors": "Henderson BR, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "9405152", "url": "https://glygen.org/publication/PubMed/9405152" } ] }, { "title": "DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.", "journal": "The Journal of biological chemistry", "date": "1998-01-23", "authors": "Ting N S, Kao P N, Chan D W, Lintott L G, Lees-Miller S P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9442054", "url": "https://glygen.org/publication/PubMed/9442054" } ] }, { "title": "Ultrastructural localization of interferon-inducible double-stranded RNA-activated enzymes in human cells.", "journal": "Experimental cell research", "date": "1998-03-15", "authors": "Besse S, Rebouillat D, Marie I, Puvion-Dutilleul F, Hovanessian A G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9521856", "url": "https://glygen.org/publication/PubMed/9521856" } ] }, { "title": "Autophosphorylation in the activation loop is required for full kinase activity in vivo of human and yeast eukaryotic initiation factor 2alpha kinases PKR and GCN2.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Romano PR, Garcia-Barrio MT, Zhang X, Wang Q, Taylor DR, Zhang F, Herring C, Mathews MB, Qin J, Hinnebusch AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9528799", "url": "https://glygen.org/publication/PubMed/9528799" } ] }, { "title": "hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Varrault A, Ciani E, Apiou F, Bilanges B, Hoffmann A, Pantaloni C, Bockaert J, Spengler D, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9671765", "url": "https://glygen.org/publication/PubMed/9671765" } ] }, { "title": "PACT, a protein activator of the interferon-induced protein kinase, PKR.", "journal": "The EMBO journal", "date": "1998", "authors": "Patel RC, Sen GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9687506", "url": "https://glygen.org/publication/PubMed/9687506" } ] }, { "title": "Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rouault JP, Prevot D, Berthet C, Birot AM, Billaud M, Magaud JP, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9712883", "url": "https://glygen.org/publication/PubMed/9712883" } ] }, { "title": "Tumor suppressor p53 as a component of the tumor necrosis factor-induced, protein kinase PKR-mediated apoptotic pathway in human promonocytic U937 cells.", "journal": "The Journal of biological chemistry", "date": "1998-09-25", "authors": "Yeung M C, Lau A S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9737981", "url": "https://glygen.org/publication/PubMed/9737981" } ] }, { "title": "Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Bai RY, Dieter P, Peschel C, Morris SW, Duyster J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725370", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370" } ], "reference": [ { "type": "PubMed", "id": "9819383", "url": "https://glygen.org/publication/PubMed/9819383" } ] }, { "title": "Requirement of PKR dimerization mediated by specific hydrophobic residues for its activation by double-stranded RNA and its antigrowth effects in yeast.", "journal": "Molecular and cellular biology", "date": "1998-12", "authors": "Patel R C, Sen G C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9819388", "url": "https://glygen.org/publication/PubMed/9819388" } ] }, { "title": "The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Melville MW, Tan SL, Wambach M, Song J, Morimoto RI, Katze MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482" } ], "reference": [ { "type": "PubMed", "id": "9920933", "url": "https://glygen.org/publication/PubMed/9920933" } ] }, { "title": "ICOS is an inducible T-cell co-stimulator structurally and functionally related to CD28.", "journal": "Nature", "date": "1999", "authors": "Hutloff A, Dittrich AM, Beier KC, Eljaschewitsch B, Kraft R, Anagnostopoulos I, Kroczek RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9725371", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371" } ], "reference": [ { "type": "PubMed", "id": "9930702", "url": "https://glygen.org/publication/PubMed/9930702" } ] } ], "pathway": [ { "id": "hsa:4869", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4869", "resource": "KEGG Pathway" }, { "id": "R-HSA-180746", "name": "Nuclear import of Rev protein", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746", "resource": "Reactome", "description": "Nuclear import of Rev protein" }, { "id": "R-HSA-3899300", "name": "SUMOylation of transcription cofactors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3899300", "resource": "Reactome", "description": "SUMOylation of transcription cofactors" }, { "id": "R-HSA-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-606279", "resource": "Reactome", "description": "Deposition of new CENPA-containing nucleosomes at the centromere" }, { "id": "R-HSA-6804115", "name": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "resource": "Reactome", "description": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain" }, { "id": "R-HSA-8869496", "name": "TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8869496", "resource": "Reactome", "description": "TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation" }, { "id": "R-HSA-9692914", "name": "SARS-CoV-1-host interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9692914", "resource": "Reactome", "description": "SARS-CoV-1-host interactions" }, { "id": "R-HSA-9700645", "name": "ALK mutants bind TKIs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9700645", "resource": "Reactome", "description": "ALK mutants bind TKIs" }, { "id": "R-HSA-9725370", "name": "Signaling by ALK fusions and activated point mutants", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725370", "resource": "Reactome", "description": "Signaling by ALK fusions and activated point mutants" }, { "id": "R-HSA-9725371", "name": "Nuclear events stimulated by ALK signaling in cancer", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9725371", "resource": "Reactome", "description": "Nuclear events stimulated by ALK signaling in cancer" }, { "id": "R-HSA-9833482", "name": "PKR-mediated signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833482", "resource": "Reactome", "description": "PKR-mediated signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P13084-1", "protein_name": "Nucleophosmin", "gene_name": "Npm1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 292 }, "evidence": [ { "id": "45922185", "url": "http://www.informatics.jax.org/homology/45922185", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61937-1", "protein_name": "Nucleophosmin", "gene_name": "Npm1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL", "length": 292 }, "evidence": [ { "id": "45922185", "url": "http://www.informatics.jax.org/homology/45922185", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 16, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein-DNA complex", "id": "GO:0032993", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032993", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "small ribosomal subunit", "id": "GO:0015935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015935", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "spindle pole centrosome", "id": "GO:0031616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031616", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "granular component", "id": "GO:0001652", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001652", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "large ribosomal subunit", "id": "GO:0015934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015934", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 17, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein kinase inhibitor activity", "id": "GO:0004860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004860", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal small subunit binding", "id": "GO:0043024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043024", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "NF-kappaB binding", "id": "GO:0051059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051059", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "Tat protein binding", "id": "GO:0030957", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030957", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "rRNA binding", "id": "GO:0019843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019843", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "core promoter sequence-specific DNA binding", "id": "GO:0001046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001046", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal large subunit binding", "id": "GO:0043023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043023", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "molecular condensate scaffold activity", "id": "GO:0140693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140693", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 40, "go_terms": [ { "name": "regulation of centrosome duplication", "id": "GO:0010824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010824", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal large subunit export from nucleus", "id": "GO:0000055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000055", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of DNA damage response, signal transduction by p53 class mediator", "id": "GO:0043516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043516", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "nucleocytoplasmic transport", "id": "GO:0006913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006913", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal large subunit biogenesis", "id": "GO:0042273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042273", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "cell volume homeostasis", "id": "GO:0006884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006884", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of cell growth", "id": "GO:0001558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001558", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "negative regulation of mRNA splicing, via spliceosome", "id": "GO:0048025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048025", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "centrosome cycle", "id": "GO:0007098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007098", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "cellular senescence", "id": "GO:0090398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090398", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "cellular response to UV", "id": "GO:0034644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034644", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "negative regulation of protein kinase activity by regulation of protein phosphorylation", "id": "GO:0044387", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044387", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of centriole replication", "id": "GO:0046599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046599", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosome assembly", "id": "GO:0042255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042255", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "rRNA export from nucleus", "id": "GO:0006407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006407", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of endodeoxyribonuclease activity", "id": "GO:0032071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032071", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of endoribonuclease activity", "id": "GO:0060699", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060699", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of eIF2 alpha phosphorylation by dsRNA", "id": "GO:0060735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060735", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "negative regulation of centrosome duplication", "id": "GO:0010826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010826", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of cell cycle G2/M phase transition", "id": "GO:1902751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902751", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of centrosome duplication", "id": "GO:0010825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010825", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal small subunit export from nucleus", "id": "GO:0000056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000056", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "ribosomal small subunit biogenesis", "id": "GO:0042274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042274", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "positive regulation of protein localization to nucleolus", "id": "GO:1904751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904751", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" }, { "name": "regulation of mRNA stability involved in cellular response to UV", "id": "GO:1902629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902629", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Acetylated at C-terminal lysine residues, thereby increasing affinity to histones.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "16107701", "url": "https://glygen.org/publication/PubMed/16107701" } ] }, { "annotation": "Phosphorylated at Ser-4 by PLK1 and PLK2. Phosphorylation at Ser-4 by PLK2 in S phase is required for centriole duplication and is sufficient to trigger centriole replication. Phosphorylation at Ser-4 by PLK1 takes place during mitosis. Phosphorylated by CDK2 at Ser-125 and Thr-199. Phosphorylation at Thr-199 may trigger initiation of centrosome duplication. Phosphorylated by CDK1 at Thr-199, Thr-219, Thr-234 and Thr-237 during cell mitosis. When these four sites are phosphorated, RNA-binding activity seem to be abolished. May be phosphorylated at Ser-70 by NEK2. The Thr-199 phosphorylated form has higher affinity for ROCK2. CDK6 triggers Thr-199 phosphorylation when complexed to Kaposi's sarcoma herpesvirus (KSHV) V-cyclin, leading to viral reactivation by reducing viral LANA levels.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" }, { "database": "PubMed", "id": "12058066", "url": "https://glygen.org/publication/PubMed/12058066" }, { "database": "PubMed", "id": "20333249", "url": "https://glygen.org/publication/PubMed/20333249" }, { "database": "PubMed", "id": "15388344", "url": "https://glygen.org/publication/PubMed/15388344" }, { "database": "PubMed", "id": "11051553", "url": "https://glygen.org/publication/PubMed/11051553" }, { "database": "PubMed", "id": "15190079", "url": "https://glygen.org/publication/PubMed/15190079" }, { "database": "PubMed", "id": "12882984", "url": "https://glygen.org/publication/PubMed/12882984" } ] }, { "annotation": "Sumoylated by ARF.", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "15897463", "url": "https://glygen.org/publication/PubMed/15897463" } ] }, { "annotation": "Ubiquitinated. Ubiquitination leads to proteasomal degradation. Deubiquitinated by USP36 (PubMed:19208757).", "evidence": [ { "database": "UniProtKB", "id": "P06748", "url": "https://www.uniprot.org/uniprot/P06748" }, { "database": "PubMed", "id": "25818168", "url": "https://glygen.org/publication/PubMed/25818168" }, { "database": "PubMed", "id": "19208757", "url": "https://glygen.org/publication/PubMed/19208757" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Nucleophosmin (NPM)", "biomarker_id": "A0332", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "20515654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20515654" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "increased NPM level", "disease": { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, "tissue": { "name": "thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "20515654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20515654" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 75, 82, 88, 95, 106, 112, 125 ], "snv_sites": [ 8, 88, 106, 112, 193 ], "glycation_sites": [], "phosphorylation_sites": [ 4, 10, 17, 29, 43, 46, 48, 67, 70, 75, 78, 88, 95, 106, 112, 125, 137, 139, 195, 199, 217, 218, 219, 222, 227, 234, 237, 242, 243, 254, 260, 271, 279 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 48 }, { "field": "total_sites", "count": 33 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 477 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }