{ "uniprot_canonical_ac": "P06733-1", "uniprot_ac": "P06733", "uniprot_id": "ENOA_HUMAN", "mass": { "chemical_mass": 47169.0, "monoisotopic_mass": 47169.0 }, "refseq": { "ac": "NP_001188412", "name": "c-myc promoter-binding protein-1 isoform MBP-1", "summary": "This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" }, "gene_names": [ { "name": "ENO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06733", "id": "P06733" }, { "name": "ENO1-IT1; ENO1L1; HEL-S-17; MPB1; NNE; PPH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412", "id": "NP_001188412" }, { "name": "ENO1L1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06733", "id": "P06733" }, { "name": "ENO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412", "id": "NP_001188412" }, { "name": "MBPB1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06733", "id": "P06733" }, { "name": "MPB1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06733", "id": "P06733" } ], "protein_names": [ { "name": "Alpha-enolase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06733" }, { "name": "2-phospho-D-glycerate hydro-lyase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "4.2.1.11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "C-myc promoter-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "Enolase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "MBP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "MPB-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "MYC promoter-binding protein 1; non-neural enolase; 2-phospho-D-glycerate hydro-lyase; tau-crystallin; c-myc promoter-binding protein-1; phosphopyruvate hydratase; alpha enolase like 1; plasminogen-binding protein; enolase-alpha; epididymis secretory protein Li 17; enolase 1, (alpha); ENO1 intronic transcript 1; ENO1 intronic transcript 1 (non-protein coding)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412", "id": "NP_001188412" }, { "name": "NNE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "Non-neural enolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "Phosphopyruvate hydratase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "Plasminogen-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06733" }, { "name": "c-myc promoter-binding protein-1 isoform MBP-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412", "id": "NP_001188412" } ], "function": [ { "annotation": "Binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733#function" }, { "database": "PubMed", "id": "10082554", "url": "https://glygen.org/publication/PubMed/10082554" } ] }, { "annotation": "Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate (PubMed:29775581, PubMed:1369209). In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic responses (PubMed:2005901, PubMed:10802057, PubMed:12666133, PubMed:29775581). May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons (PubMed:12666133). Stimulates immunoglobulin production (PubMed:1369209).", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733#function" }, { "database": "PubMed", "id": "29775581", "url": "https://glygen.org/publication/PubMed/29775581" }, { "database": "PubMed", "id": "2005901", "url": "https://glygen.org/publication/PubMed/2005901" }, { "database": "PubMed", "id": "1369209", "url": "https://glygen.org/publication/PubMed/1369209" }, { "database": "PubMed", "id": "10802057", "url": "https://glygen.org/publication/PubMed/10802057" }, { "database": "PubMed", "id": "12666133", "url": "https://glygen.org/publication/PubMed/12666133" } ] }, { "annotation": "Long non-coding RNA NMRAL2P promotes glycolysis and reduces ROS in head and neck tumors by interacting with the ENO1 protein and promoting GPX2 transcription. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" }, { "database": "PubMed", "id": "37810778", "url": "https://glygen.org/publication/PubMed/37810778" } ] }, { "annotation": "N6-methyladenosine methyltransferase KIAA1429 promoted ovarian cancer aerobic glycolysis and progression through enhancing ENO1 expression. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" }, { "database": "PubMed", "id": "37807062", "url": "https://glygen.org/publication/PubMed/37807062" } ] }, { "annotation": "Novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" }, { "database": "PubMed", "id": "20849415", "url": "https://glygen.org/publication/PubMed/20849415" } ] }, { "annotation": "This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" } ] }, { "annotation": "Unrevealed roles of extracellular enolase-1 (ENO1) in promoting glycolysis and pro-cancer activities in multiple myeloma via hypoxia-inducible factor 1alpha.", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" }, { "database": "PubMed", "id": "37800625", "url": "https://glygen.org/publication/PubMed/37800625" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs752870645", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752870645" }, { "id": "rs752870645", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752870645" }, { "id": "rs752870645", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752870645" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 153, "end_pos": 153, "sequence_org": "I", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVI->NVS).", "chr_id": "1", "chr_pos": "8866488", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06733", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06733" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 153, "end_pos": 153, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NVI->NVT).", "chr_id": "1", "chr_pos": "8866488", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "I153", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P06733", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06733" }, { "id": "rs750183904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750183904" }, { "id": "rs750183904", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750183904" }, { "id": "rs750183904", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750183904" }, { "id": "rs750183904", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750183904#frequency_tab" }, { "id": "rs750183904", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750183904" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 156, "end_pos": 156, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "G", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "1", "chr_pos": "8866480", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "G156", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1211983641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211983641" }, { "id": "rs1211983641", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1211983641#frequency_tab" }, { "id": "rs1211983641", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1211983641" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 18, "end_pos": 18, "sequence_org": "P", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NHT).", "chr_id": "1", "chr_pos": "8874856", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P18", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1211983641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211983641" }, { "id": "rs1211983641", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1211983641#frequency_tab" }, { "id": "rs1211983641", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1211983641" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 18, "end_pos": 18, "sequence_org": "P", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NRT).", "chr_id": "1", "chr_pos": "8874856", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P18", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs146938354", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146938354" }, { "id": "rs146938354", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146938354" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 18, "end_pos": 18, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NST).", "chr_id": "1", "chr_pos": "8870469", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P18", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1186220763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1186220763" }, { "id": "rs1186220763", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1186220763" }, { "id": "rs146938354", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146938354" }, { "id": "rs146938354", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146938354" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 18, "end_pos": 18, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NTT).", "chr_id": "1", "chr_pos": "8874857", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P18", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377334028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377334028" }, { "id": "rs377334028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377334028" }, { "id": "rs377334028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377334028#frequency_tab" }, { "id": "rs377334028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377334028" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "1", "chr_pos": "8865335", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S272", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1354424562", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1354424562" }, { "id": "rs1354424562", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1354424562#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "1", "chr_pos": "8865336", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S272", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs377334028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377334028" }, { "id": "rs377334028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377334028" }, { "id": "rs377334028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377334028#frequency_tab" }, { "id": "rs377334028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377334028" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 272, "end_pos": 272, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->W).", "chr_id": "1", "chr_pos": "8865335", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S272", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1404080418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1404080418" }, { "id": "rs1404080418", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1404080418" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 308, "end_pos": 308, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "1", "chr_pos": "8864035", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1037805406", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1037805406" }, { "id": "rs1037805406", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1037805406" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 319, "end_pos": 319, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "1", "chr_pos": "8864003", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D319", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1457370145", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457370145" }, { "id": "rs1457370145", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457370145" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 347, "end_pos": 347, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQI->NQT).", "chr_id": "1", "chr_pos": "8863918", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I347", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 281, "end_pos": 281, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased 2-hydroxyisobutyrylation leading to decreased phosphopyruvate hydratase activity.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "29775581", "url": "https://glygen.org/publication/PubMed/29775581" } ] }, { "start_pos": 384, "end_pos": 384, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of transcriptional repression and cell growth inhibition; when associated with A-388.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "10082554", "url": "https://glygen.org/publication/PubMed/10082554" } ] }, { "start_pos": 388, "end_pos": 388, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of transcriptional repression and cell growth inhibition; when associated with A-384.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "10082554", "url": "https://glygen.org/publication/PubMed/10082554" } ] }, { "start_pos": 94, "end_pos": 94, "sequence_org": "M", "sequence_mut": "I", "comment": "MBP1 protein production. No MBP1 protein production; when associated with I-97.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "10681589", "url": "https://glygen.org/publication/PubMed/10681589" } ] }, { "start_pos": 97, "end_pos": 97, "sequence_org": "M", "sequence_mut": "I", "comment": "MBP1 protein production. No MBP1 protein production; when associated with I-94.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "10681589", "url": "https://glygen.org/publication/PubMed/10681589" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06733" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "common_name": "Human" } ], "gene": [ { "name": "ENO1", "url": "https://www.uniprot.org/uniprot/P06733", "locus": { "chromosome": "1", "start_pos": 23093, "end_pos": 5407, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_1165", "url": "https://www.ensembl.org/id/LRG_1165" } ] } } ], "crossref": [ { "id": "ENSG00000074800", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000074800", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P06733", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06733", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "4.2.1.11", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.2.1.11&UniProtAcc=P06733", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03313", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03313", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3298", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3298", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ENO1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ENO1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2023", "url": "https://www.ncbi.nlm.nih.gov/gene/2023", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3350", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3350", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P06733", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06733*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000941", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000941", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020810", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020810", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029017", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029017", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2023", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2023", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "172430", "url": "http://www.omim.org/entry/172430", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06733", "url": "https://www.nextprot.org/entry/NX_P06733", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EFMIIPV", "url": "https://omabrowser.org/oma/group/EFMIIPV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1093250at2759", "url": "http://www.orthodb.org/?query=1093250at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11902", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11902", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11902:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11902:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2PSN", "url": "https://www.rcsb.org/structure/2PSN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B97", "url": "https://www.rcsb.org/structure/3B97", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JLZ", "url": "https://www.rcsb.org/structure/5JLZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LAX", "url": "https://www.rcsb.org/structure/5LAX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NI9", "url": "https://www.rcsb.org/structure/5NI9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NIG", "url": "https://www.rcsb.org/structure/5NIG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OCK", "url": "https://www.rcsb.org/structure/5OCK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00113", "url": "http://pfam.xfam.org/family/PF00113", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03952", "url": "http://pfam.xfam.org/family/PF03952", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06733", "url": "https://pharos.nih.gov/targets/P06733", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053592", "url": "https://proconsortium.org/app/entry/PR:000053592", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P06733", "url": "http://purl.obolibrary.org/obo/PR_P06733", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9636667", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636667", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10164", "url": "https://www.rhea-db.org/rhea/10164", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P06733", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A2R8Y6G6", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6G6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6G6-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6G6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6I8", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6I8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6I8-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6I8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y798", "url": "https://www.uniprot.org/uniprot/A0A2R8Y798", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y798-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y798-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y879", "url": "https://www.uniprot.org/uniprot/A0A2R8Y879", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y879-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y879-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YEG5", "url": "https://www.uniprot.org/uniprot/A0A2R8YEG5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YEG5-1", "url": "https://www.uniprot.org/uniprot/A0A2R8YEG5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YEM5", "url": "https://www.uniprot.org/uniprot/A0A2R8YEM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YEM5-1", "url": "https://www.uniprot.org/uniprot/A0A2R8YEM5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EM90", "url": "https://www.uniprot.org/uniprot/K7EM90", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EM90-1", "url": "https://www.uniprot.org/uniprot/K7EM90-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ERS8", "url": "https://www.uniprot.org/uniprot/K7ERS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ERS8-1", "url": "https://www.uniprot.org/uniprot/K7ERS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06733-1", "url": "https://www.uniprot.org/uniprot/P06733-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06733-2", "url": "https://www.uniprot.org/uniprot/P06733-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK", "length": 434, "header": "sp|P06733-1|ENOA_HUMAN Isoform 1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 CANONICAL=P06733-1" }, "isoforms": [ { "isoform_ac": "A0A2R8Y6G6-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSRPIKYINEFLAPALCTQKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK", "length": 434, "header": "tr|A0A2R8Y6G6-1|ENOA_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8861363, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000647408.1", "url": "https://www.ensembl.org/id/ENST00000647408.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495530.1", "url": "https://www.ensembl.org/id/ENSP00000495530.1" } ] } }, { "isoform_ac": "A0A2R8Y6I8-1", "url": "", "sequence": { "sequence": "MGKGVSKAVEHINKTIAPALVSKKLNVTEQEKI", "length": 33, "header": "tr|A0A2R8Y6I8-1|ENOA_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8871900, "end_pos": 8868028, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646156.1", "url": "https://www.ensembl.org/id/ENST00000646156.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495581.1", "url": "https://www.ensembl.org/id/ENSP00000495581.1" } ] } }, { "isoform_ac": "A0A2R8Y798-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKETERHRTRED", "length": 70, "header": "tr|A0A2R8Y798-1|A0A2R8Y798_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8868029, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646680.1", "url": "https://www.ensembl.org/id/ENST00000646680.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495946.1", "url": "https://www.ensembl.org/id/ENSP00000495946.1" } ] } }, { "isoform_ac": "A0A2R8Y879-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVE", "length": 125, "header": "tr|A0A2R8Y879-1|ENOA_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8867186, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646906.1", "url": "https://www.ensembl.org/id/ENST00000646906.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496562.1", "url": "https://www.ensembl.org/id/ENSP00000496562.1" } ] } }, { "isoform_ac": "A0A2R8YEG5-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSRPIKYINEFLAPALCTQVSQRLLSTSIKLLRLPWLARN", "length": 101, "header": "tr|A0A2R8YEG5-1|ENOA_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8868054, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646370.2", "url": "https://www.ensembl.org/id/ENST00000646370.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000495568.1", "url": "https://www.ensembl.org/id/ENSP00000495568.1" } ] } }, { "isoform_ac": "A0A2R8YEM5-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMIL", "length": 171, "header": "tr|A0A2R8YEM5-1|A0A2R8YEM5_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8866433, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646660.1", "url": "https://www.ensembl.org/id/ENST00000646660.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000494470.1", "url": "https://www.ensembl.org/id/ENSP00000494470.1" } ] } }, { "isoform_ac": "K7EM90-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNV", "length": 195, "header": "tr|K7EM90-1|ENOA_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=1 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8866361, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000497492.1", "url": "https://www.ensembl.org/id/ENST00000497492.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000466406.1", "url": "https://www.ensembl.org/id/ENSP00000466406.1" } ] } }, { "isoform_ac": "K7ERS8-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLN", "length": 83, "header": "tr|K7ERS8-1|K7ERS8_HUMAN Computationally mapped isoform of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=9 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8868049, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000489867.2", "url": "https://www.ensembl.org/id/ENST00000489867.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000468392.2", "url": "https://www.ensembl.org/id/ENSP00000468392.2" } ] } }, { "isoform_ac": "P06733-1", "url": "", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK", "length": 434, "header": "sp|P06733-1|ENOA_HUMAN Isoform 1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 CANONICAL=P06733-1" }, "locus": { "chromosome": "1", "start_pos": 8874908, "end_pos": 8861363, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000234590.10", "url": "https://www.ensembl.org/id/ENST00000234590.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000234590.4", "url": "https://www.ensembl.org/id/ENSP00000234590.4" } ] } }, { "isoform_ac": "P06733-2", "url": "", "sequence": { "sequence": "MIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK", "length": 341, "header": "sp|P06733-2|ENOA_HUMAN Isoform 2 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 CANONICAL=P06733-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 272, "start_aa": "Ser", "end_pos": 272, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser272", "evidence": [ { "id": "P06733", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" }, { "id": "16408927", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16408927" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "18369606", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18369606" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22322011", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22322011" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 308, "start_aa": "Thr", "end_pos": 308, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr308", "evidence": [ { "id": "P06733", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr100" }, { "start_pos": 254, "end_pos": 254, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser254" }, { "start_pos": 263, "end_pos": 263, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18510355", "url": "https://glygen.org/publication/PubMed/18510355" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser263" }, { "start_pos": 272, "end_pos": 272, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "site_lbl": "Ser272" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser27" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P06733", "url": "http://phospho.elm.eu.org/byAccession/P06733.html" } ], "site_lbl": "Tyr287" }, { "start_pos": 291, "end_pos": 291, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "site_lbl": "Ser291" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "26096821", "url": "https://glygen.org/publication/PubMed/26096821" } ], "site_lbl": "Ser419" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P06733", "url": "http://phospho.elm.eu.org/byAccession/P06733.html" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "8578591", "url": "https://glygen.org/publication/PubMed/8578591" }, { "database": "PubMed", "id": "24841372", "url": "https://glygen.org/publication/PubMed/24841372" }, { "database": "PubMed", "id": "7629021", "url": "https://glygen.org/publication/PubMed/7629021" } ], "site_lbl": "Tyr44" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "15951569", "url": "https://glygen.org/publication/PubMed/15951569" }, { "database": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P06733", "url": "http://phospho.elm.eu.org/byAccession/P06733.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr44" }, { "start_pos": 57, "end_pos": 57, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "P06733", "url": "http://phospho.elm.eu.org/byAccession/P06733.html" } ], "site_lbl": "Tyr57" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P06733", "url": "http://phospho.elm.eu.org/byAccession/P06733.html" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ], "site_lbl": "Ser63" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ], "site_lbl": "Thr72" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Functional domains of c-myc promoter binding protein 1 involved in transcriptional repression and cell growth regulation.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Ghosh AK, Steele R, Ray RB", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "10082554", "url": "https://glygen.org/publication/PubMed/10082554" } ] }, { "title": "Structure, function and regulation of pyruvate carboxylase.", "journal": "The Biochemical journal", "date": "1999", "authors": "Jitrapakdee S, Wallace JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "10229653", "url": "https://glygen.org/publication/PubMed/10229653" } ] }, { "title": "The gene mutated in adult-onset type II citrullinaemia encodes a putative mitochondrial carrier protein.", "journal": "Nature genetics", "date": "1999", "authors": "Kobayashi K, Sinasac DS, Iijima M, Boright AP, Begum L, Lee JR, Yasuda T, Ikeda S, Hirano R, Terazono H, Crackower MA, Kondo I, Tsui LC, Scherer SW, Saheki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "10369257", "url": "https://glygen.org/publication/PubMed/10369257" } ] }, { "title": "Organization and sequence of the gene for the human mitochondrial dicarboxylate carrier: evolution of the carrier family.", "journal": "The Biochemical journal", "date": "1999", "authors": "Fiermonte G, Dolce V, Arrigoni R, Runswick MJ, Walker JE, Palmieri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "10585886", "url": "https://glygen.org/publication/PubMed/10585886" } ] }, { "title": "Characterization of a second member of the subfamily of calcium-binding mitochondrial carriers expressed in human non-excitable tissues.", "journal": "The Biochemical journal", "date": "2000", "authors": "Del Arco A, Agudo M, Satrustegui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "10642534", "url": "https://glygen.org/publication/PubMed/10642534" } ] }, { "title": "Structural analysis of alpha-enolase. Mapping the functional domains involved in down-regulation of the c-myc protooncogene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Subramanian A, Miller DM", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "10681589", "url": "https://glygen.org/publication/PubMed/10681589" } ] }, { "title": "Human glyceraldehyde 3-phosphate dehydrogenase-2 gene is expressed specifically in spermatogenic cells.", "journal": "Journal of andrology", "date": "2000", "authors": "Welch JE, Brown PL, O'Brien DA, Magyar PL, Bunch DO, Mori C, Eddy EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "10714828", "url": "https://glygen.org/publication/PubMed/10714828" } ] }, { "title": "ENO1 gene product binds to the c-myc promoter and acts as a transcriptional repressor: relationship with Myc promoter-binding protein 1 (MBP-1).", "journal": "FEBS letters", "date": "2000", "authors": "Feo S, Arcuri D, Piddini E, Passantino R, Giallongo A", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "10802057", "url": "https://glygen.org/publication/PubMed/10802057" } ] }, { "title": "A novel 16-kilodalton cellular protein physically interacts with and antagonizes the functional activity of c-myc promoter-binding protein 1.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Ghosh A K, Majumder M, Steele R, White R A, Ray R B", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "11134351", "url": "https://glygen.org/publication/PubMed/11134351" } ] }, { "title": "The crystal structure of human phosphoglucose isomerase at 1.6 A resolution: implications for catalytic mechanism, cytokine activity and haemolytic anaemia.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Read J, Pearce J, Li X, Muirhead H, Chirgwin J, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "11371164", "url": "https://glygen.org/publication/PubMed/11371164" } ] }, { "title": "Multifunctional alpha-enolase: its role in diseases.", "journal": "Cell. Mol. Life Sci.", "date": "2001", "authors": "Pancholi V", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "11497239", "url": "https://glygen.org/publication/PubMed/11497239" } ] }, { "title": "Beta-enolase deficiency, a new metabolic myopathy of distal glycolysis.", "journal": "Annals of neurology", "date": "2001", "authors": "Comi GP, Fortunato F, Lucchiari S, Bordoni A, Prelle A, Jann S, Keller A, Ciscato P, Galbiati S, Chiveri L, Torrente Y, Scarlato G, Bresolin N", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "11506403", "url": "https://glygen.org/publication/PubMed/11506403" } ] }, { "title": "Citrin and aralar1 are Ca(2+)-stimulated aspartate/glutamate transporters in mitochondria.", "journal": "The EMBO journal", "date": "2001", "authors": "Palmieri L, Pardo B, Lasorsa FM, del Arco A, Kobayashi K, Iijima M, Runswick MJ, Walker JE, Saheki T, Satrustegui J, Palmieri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "11566871", "url": "https://glygen.org/publication/PubMed/11566871" } ] }, { "title": "GLUT2 in pancreatic and extra-pancreatic gluco-detection (review).", "journal": "Molecular membrane biology", "date": "2001", "authors": "Thorens B", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "11780755", "url": "https://glygen.org/publication/PubMed/11780755" } ] }, { "title": "Crystal structure of human cytosolic phosphoenolpyruvate carboxykinase reveals a new GTP-binding site.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Dunten P, Belunis C, Crowther R, Hollfelder K, Kammlott U, Levin W, Michel H, Ramsey GB, Swain A, Weber D, Wertheimer SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "11851336", "url": "https://glygen.org/publication/PubMed/11851336" } ] }, { "title": "Transport of phosphoenolpyruvate by the tricarboxylate transporting system in mammalian mitochondria.", "journal": "FEBS letters", "date": "1971", "authors": "Robinson BH", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "11945784", "url": "https://glygen.org/publication/PubMed/11945784" } ] }, { "title": "Effects of synthetic analogues of phosphoenolpyruvate on muscle and liver pyruvate kinase, muscle enolase, liver phosphoenolpyruvate carboxykinase and on the intra-/extra-mitochondrial tricarboxylic acid carrier transport system.", "journal": "FEBS letters", "date": "1971", "authors": "Soling HD, Walter U, Sauer H, Kleineke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "11946196", "url": "https://glygen.org/publication/PubMed/11946196" } ] }, { "title": "The catalytic center of glucose-6-phosphatase. HIS176 is the nucleophile forming the phosphohistidine-enzyme intermediate during catalysis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ghosh A, Shieh JJ, Pan CJ, Sun MS, Chou JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "12093795", "url": "https://glygen.org/publication/PubMed/12093795" } ] }, { "title": "Proteomic analysis of human brain identifies alpha-enolase as a novel autoantigen in Hashimoto's encephalopathy.", "journal": "FEBS Lett.", "date": "2002", "authors": "Ochi Hirofumi, Horiuchi Izumi, Araki Norie, Toda Tosifusa, Araki Tomohiro, Sato Kaori, Murai Hiroyuki, Osoegawa Manabu, Yamada Takeshi, Okamura Ken, Ogino Tomoaki, Mizumoto Kiyohisa, Yamashita Hirohumi, Saya Hideyuki, Kira Jun-ichi", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "12297304", "url": "https://glygen.org/publication/PubMed/12297304" } ] }, { "title": "Expression and characterization of a human pyruvate carboxylase variant by retroviral gene transfer.", "journal": "The Biochemical journal", "date": "2003", "authors": "Carbone MA, Robinson BH", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "12437512", "url": "https://glygen.org/publication/PubMed/12437512" } ] }, { "title": "Relationship of phosphoenolpyruvate transport, acyl coenzyme A inhibition of adenine nucleotide translocase and calcium ion efflux in guinea pig heart mitochondria.", "journal": "Archives of biochemistry and biophysics", "date": "1976", "authors": "Sul HS, Shrago E, Shug AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "1252077", "url": "https://glygen.org/publication/PubMed/1252077" } ] }, { "title": "Pathogenesis and pathophysiology of citrin (a mitochondrial aspartate glutamate carrier) deficiency.", "journal": "Metabolic brain disease", "date": "2002", "authors": "Saheki T, Kobayashi K, Iijima M, Nishi I, Yasuda T, Yamaguchi N, Gao HZ, Jalil MA, Begum L, Li MX", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "12602510", "url": "https://glygen.org/publication/PubMed/12602510" } ] }, { "title": "Cloning and functional characterization of GNPI2, a novel human homolog of glucosamine-6-phosphate isomerase/oscillin.", "journal": "Journal of cellular biochemistry", "date": "2003", "authors": "Zhang J, Zhang W, Zou D, Chen G, Wan T, Li N, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "12616532", "url": "https://glygen.org/publication/PubMed/12616532" } ] }, { "title": "Inhibition of cell surface mediated plasminogen activation by a monoclonal antibody against alpha-Enolase.", "journal": "American journal of hematology", "date": "2003-04", "authors": "L\u00f3pez-Alemany Roser, Longstaff Colin, Hawley Stephen, Mirshahi Massoud, F\u00e1bregas Pere, Jard\u00ed Merce, Merton Elizabeth, Miles Lindsey A, F\u00e9lez Jordi", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "12666133", "url": "https://glygen.org/publication/PubMed/12666133" } ] }, { "title": "Characterization of phosphoglycerate kinase from human spermatozoa.", "journal": "Fertility and sterility", "date": "1976", "authors": "Chen SH, Donahue RP, Scott CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "1278465", "url": "https://glygen.org/publication/PubMed/1278465" } ] }, { "title": "Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study.", "journal": "FEBS letters", "date": "2003", "authors": "Arreola R, Valderrama B, Morante ML, Horjales E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "12965206", "url": "https://glygen.org/publication/PubMed/12965206" } ] }, { "title": "Identification and characterisation of a new human glucose-6-phosphatase isoform.", "journal": "FEBS letters", "date": "2003", "authors": "Guionie O, Clottes E, Stafford K, Burchell A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "12965222", "url": "https://glygen.org/publication/PubMed/12965222" } ] }, { "title": "Enzymes of the human erythrocyte. IV. Phosphoglucose isomerase, purification and properties.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "TSUBOI KK, ESTRADA J, HUDSON PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "13538944", "url": "https://glygen.org/publication/PubMed/13538944" } ] }, { "title": "Purification and characterization of immunoglobulin production stimulating factor-II beta derived from Namalwa cells.", "journal": "Cytotechnology", "date": "1992", "authors": "Sugahara T, Nakajima H, Shirahata S, Murakami H", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "1369209", "url": "https://glygen.org/publication/PubMed/1369209" } ] }, { "title": "Histidine 167 is the phosphate acceptor in glucose-6-phosphatase-beta forming a phosphohistidine enzyme intermediate during catalysis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ghosh A, Shieh JJ, Pan CJ, Chou JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "14718531", "url": "https://glygen.org/publication/PubMed/14718531" } ] }, { "title": "Enzymatic characterization of the pancreatic islet-specific glucose-6-phosphatase-related protein (IGRP).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Petrolonis AJ, Yang Q, Tummino PJ, Fish SM, Prack AE, Jain S, Parsons TF, Li P, Dales NA, Ge L, Langston SP, Schuller AG, An WF, Tartaglia LA, Chen H, Hong SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "14722102", "url": "https://glygen.org/publication/PubMed/14722102" } ] }, { "title": "Developmental regulation and cellular distribution of human cytosolic malate dehydrogenase (MDH1).", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Lo AS, Liew CT, Ngai SM, Tsui SK, Fung KP, Lee CY, Waye MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "15565635", "url": "https://glygen.org/publication/PubMed/15565635" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Phosphoglycerate mutase BB isoenzyme deficiency in a patient with non-spherocytic anemia: familial and metabolic studies.", "journal": "Haematologica", "date": "2005", "authors": "Repiso A, Ramirez Bajo MJ, Corrons JL, Carreras J, Climent F", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "15710582", "url": "https://glygen.org/publication/PubMed/15710582" } ] }, { "title": "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "15951569", "url": "https://glygen.org/publication/PubMed/15951569" } ] }, { "title": "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Giannakopoulos NV, Luo JK, Papov V, Zou W, Lenschow DJ, Jacobs BS, Borden EC, Li J, Virgin HW, Zhang DE", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" } ] }, { "title": "Global identification of O-GlcNAc-modified proteins.", "journal": "Analytical chemistry", "date": "2006", "authors": "Nandi A, Sprung R, Barma DK, Zhao Y, Kim SC, Falck JR, Zhao Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "16408927", "url": "https://glygen.org/publication/PubMed/16408927" } ] }, { "title": "A common phosphotyrosine signature for the Bcr-Abl kinase.", "journal": "Blood", "date": "2006", "authors": "Goss VL, Lee KA, Moritz A, Nardone J, Spek EJ, MacNeill J, Rush J, Comb MJ, Polakiewicz RD", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "16497976", "url": "https://glygen.org/publication/PubMed/16497976" } ] }, { "title": "Structure of a high-resolution crystal form of human triosephosphate isomerase: improvement of crystals using the gel-tube method.", "journal": "Acta crystallographica. Section F, Structural biology and crystallization communications", "date": "2005", "authors": "Kinoshita T, Maruki R, Warizaya M, Nakajima H, Nishimura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "16511037", "url": "https://glygen.org/publication/PubMed/16511037" } ] }, { "title": "Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.", "journal": "Cell. Microbiol.", "date": "2006", "authors": "Leong WF, Chow VT", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "16548883", "url": "https://glygen.org/publication/PubMed/16548883" } ] }, { "title": "An NADH-tetrazolium-coupled sensitive assay for malate dehydrogenase in mitochondria and crude tissue homogenates.", "journal": "Journal of biochemical and biophysical methods", "date": "2006", "authors": "Luo C, Wang X, Long J, Liu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "16740313", "url": "https://glygen.org/publication/PubMed/16740313" } ] }, { "title": "HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Wong JJ, Pung YF, Sze NS, Chin KC", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "16815975", "url": "https://glygen.org/publication/PubMed/16815975" } ] }, { "title": "Porphyrin accumulation in mitochondria is mediated by 2-oxoglutarate carrier.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kabe Y, Ohmori M, Shinouchi K, Tsuboi Y, Hirao S, Azuma M, Watanabe H, Okura I, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "16920706", "url": "https://glygen.org/publication/PubMed/16920706" } ] }, { "title": "Effects of HER2 overexpression on cell signaling networks governing proliferation and migration.", "journal": "Molecular systems biology", "date": "2006", "authors": "Wolf-Yadlin A, Kumar N, Zhang Y, Hautaniemi S, Zaman M, Kim HD, Grantcharova V, Lauffenburger DA, White FM", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "17016520", "url": "https://glygen.org/publication/PubMed/17016520" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Molecular identification of mammalian phosphopentomutase and glucose-1,6-bisphosphate synthase, two members of the alpha-D-phosphohexomutase family.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Maliekal P, Sokolova T, Vertommen D, Veiga-da-Cunha M, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "17804405", "url": "https://glygen.org/publication/PubMed/17804405" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "The glucose-6-phosphate transporter is a phosphate-linked antiporter deficient in glycogen storage disease type Ib and Ic.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Chen SY, Pan CJ, Nandigama K, Mansfield BC, Ambudkar SV, Chou JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "18337460", "url": "https://glygen.org/publication/PubMed/18337460" } ] }, { "title": "Isozymes of glyceraldehyde-3-phosphate dehydrogenase in man and other mammals.", "journal": "Annals of human genetics", "date": "1976", "authors": "Edwards YH, Clark P, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "183598", "url": "https://glygen.org/publication/PubMed/183598" } ] }, { "title": "Identification of new O-GlcNAc modified proteins using a click-chemistry-based tagging.", "journal": "Analytical and bioanalytical chemistry", "date": "2008", "authors": "Gurcel C, Vercoutter-Edouart AS, Fonbonne C, Mortuaire M, Salvador A, Michalski JC, Lemoine J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "18369606", "url": "https://glygen.org/publication/PubMed/18369606" } ] }, { "title": "Mutations in the glucose-6-phosphatase-alpha (G6PC) gene that cause type Ia glycogen storage disease.", "journal": "Human mutation", "date": "2008", "authors": "Chou JY, Mansfield BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "18449899", "url": "https://glygen.org/publication/PubMed/18449899" } ] }, { "title": "Phosphoproteomic analysis of human brain by calcium phosphate precipitation and mass spectrometry.", "journal": "Journal of proteome research", "date": "2008", "authors": "Xia Q, Cheng D, Duong DM, Gearing M, Lah JJ, Levey AI, Peng J", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "18510355", "url": "https://glygen.org/publication/PubMed/18510355" } ] }, { "title": "Structure of human alpha-enolase (hENO1), a multifunctional glycolytic enzyme.", "journal": "Acta Crystallogr. D", "date": "2008", "authors": "Kang HJ, Jung SK, Kim SJ, Chung SJ", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "18560153", "url": "https://glygen.org/publication/PubMed/18560153" } ] }, { "title": "Structure, mechanism and regulation of pyruvate carboxylase.", "journal": "The Biochemical journal", "date": "2008", "authors": "Jitrapakdee S, St Maurice M, Rayment I, Cleland WW, Wallace JC, Attwood PV", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "18613815", "url": "https://glygen.org/publication/PubMed/18613815" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Human liver glucokinase gene: cloning and sequence determination of two alternatively spliced cDNAs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Tanizawa Y, Koranyi LI, Welling CM, Permutt MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "1871135", "url": "https://glygen.org/publication/PubMed/1871135" } ] }, { "title": "Crystalline d-glyceraldehyde-3-phosphate dehydrogenase from rabbit muscle.", "journal": "The Journal of biological chemistry", "date": "1948", "authors": "CORI GT, SLEIN MW, CORI CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "18910716", "url": "https://glygen.org/publication/PubMed/18910716" } ] }, { "title": "The prosthetic group of crystalline d-glyceraldehyde-3-phosphate dehydrogenase.", "journal": "The Journal of biological chemistry", "date": "1948", "authors": "TAYLOR JF, VELICK SF, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "18910717", "url": "https://glygen.org/publication/PubMed/18910717" } ] }, { "title": "Mammalian phosphomannomutase PMM1 is the brain IMP-sensitive glucose-1,6-bisphosphatase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Veiga-da-Cunha M, Vleugels W, Maliekal P, Matthijs G, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "18927083", "url": "https://glygen.org/publication/PubMed/18927083" } ] }, { "title": "A syndrome with congenital neutropenia and mutations in G6PC3.", "journal": "The New England journal of medicine", "date": "2009", "authors": "Boztug K, Appaswamy G, Ashikov A, Schaffer AA, Salzer U, Diestelhorst J, Germeshausen M, Brandes G, Lee-Gossler J, Noyan F, Gatzke AK, Minkov M, Greil J, Kratz C, Petropoulou T, Pellier I, Bellanne-Chantelot C, Rezaei N, Monkemoller K, Irani-Hakimeh N, Bakker H, Gerardy-Schahn R, Zeidler C, Grimbacher B, Welte K, Klein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "19118303", "url": "https://glygen.org/publication/PubMed/19118303" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Cloning and characterization of a human c-myc promoter-binding protein.", "journal": "Molecular and cellular biology", "date": "1991-04", "authors": "Ray R, Miller D M", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "2005901", "url": "https://glygen.org/publication/PubMed/2005901" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P06733-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "MBP-1 is efficiently encoded by an alternative transcript of the ENO1 gene but post-translationally regulated by proteasome-dependent protein turnover.", "journal": "The FEBS journal", "date": "2010", "authors": "Lung J, Liu KJ, Chang JY, Leu SJ, Shih NY", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" } ], "reference": [ { "type": "PubMed", "id": "20849415", "url": "https://glygen.org/publication/PubMed/20849415" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "The first identification of lysine malonylation substrates and its regulatory enzyme.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Peng C, Lu Z, Xie Z, Cheng Z, Chen Y, Tan M, Luo H, Zhang Y, He W, Yang K, Zwaans BM, Tishkoff D, Ho L, Lombard D, He TC, Dai J, Verdin E, Ye Y, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "21908771", "url": "https://glygen.org/publication/PubMed/21908771" } ] }, { "title": "SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.", "journal": "PloS one", "date": "2011", "authors": "Pan CJ, Chen SY, Jun HS, Lin SR, Mansfield BC, Chou JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "21949678", "url": "https://glygen.org/publication/PubMed/21949678" } ] }, { "title": "Expression and role in glycolysis of human ADP-dependent glucokinase.", "journal": "Molecular and cellular biochemistry", "date": "2012", "authors": "Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "22219026", "url": "https://glygen.org/publication/PubMed/22219026" } ] }, { "title": "The lectin Helix pomatia agglutinin recognizes O-GlcNAc containing glycoproteins in human breast cancer.", "journal": "Glycobiology", "date": "2012", "authors": "Rambaruth ND, Greenwell P, Dwek MV", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "22322011", "url": "https://glygen.org/publication/PubMed/22322011" } ] }, { "title": "The amino acid sequence of cytosolic aspartate aminotransferase from human liver.", "journal": "The Biochemical journal", "date": "1990", "authors": "Doyle JM, Schinina ME, Bossa F, Doonan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "2241899", "url": "https://glygen.org/publication/PubMed/2241899" } ] }, { "title": "Resveratrol-induced changes of the human adipocyte secretion profile.", "journal": "J. Proteome Res.", "date": "2012", "authors": "Rosenow Anja, Noben Jean-Paul, Jocken Johan, Kallendrusch Sonja, Fischer-Posovszky Pamela, Mariman Edwin C M, Renes Johan", "evidence": [ { "database": "UniProtKB", "id": "A0A2R8Y6G6", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6G6" } ], "reference": [ { "type": "PubMed", "id": "22905912", "url": "https://glygen.org/publication/PubMed/22905912" } ] }, { "title": "T cell activation is driven by an ADP-dependent glucokinase linking enhanced glycolysis with mitochondrial reactive oxygen species generation.", "journal": "Cell reports", "date": "2012", "authors": "Kaminski MM, Sauer SW, Kaminski M, Opp S, Ruppert T, Grigaravicius P, Grudnik P, Grone HJ, Krammer PH, Gulow K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "23168256", "url": "https://glygen.org/publication/PubMed/23168256" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Disruption of a spermatogenic cell-specific mouse enolase 4 (eno4) gene causes sperm structural defects and male infertility.", "journal": "Biology of reproduction", "date": "2013", "authors": "Nakamura N, Dai Q, Williams J, Goulding EH, Willis WD, Brown PR, Eddy EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "23446454", "url": "https://glygen.org/publication/PubMed/23446454" } ] }, { "title": "The SLC37 family of phosphate-linked sugar phosphate antiporters.", "journal": "Molecular aspects of medicine", "date": "2013", "authors": "Chou JY, Sik Jun H, Mansfield BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "23506893", "url": "https://glygen.org/publication/PubMed/23506893" } ] }, { "title": "Structure of the human gene for alpha-enolase.", "journal": "Eur. J. Biochem.", "date": "1990", "authors": "Giallongo A, Oliva D, Cal\u00ec L, Barba G, Barbieri G, Feo S", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "2373081", "url": "https://glygen.org/publication/PubMed/2373081" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Tau-crystallin/alpha-enolase: one gene encodes both an enzyme and a lens structural protein.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Wistow GJ, Lietman T, Williams LA, Stapel SO, de Jong WW, Horwitz J, Piatigorsky J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "2462567", "url": "https://glygen.org/publication/PubMed/2462567" } ] }, { "title": "Helicobacter pylori cytotoxin-associated gene A protein upregulates alpha-enolase expression via Src/MEK/ERK pathway: implication for progression of gastric cancer.", "journal": "International journal of oncology", "date": "2014", "authors": "Chen S, Duan G, Zhang R, Fan Q", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "24841372", "url": "https://glygen.org/publication/PubMed/24841372" } ] }, { "title": "Coordinated regulatory variation associated with gestational hyperglycaemia regulates expression of the novel hexokinase HKDC1.", "journal": "Nature communications", "date": "2015-02-04", "authors": "Guo Cong, Ludvik Anton E, Arlotto Michelle E, Hayes M Geoffrey, Armstrong Loren L, Scholtens Denise M, Brown Christopher D, Newgard Christopher B, Becker Thomas C, Layden Brian T, Lowe William L, Reddy Timothy E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "25648650", "url": "https://glygen.org/publication/PubMed/25648650" } ] }, { "title": "Phosphorylated alpha-enolase induces autoantibodies in HLA-DR8 pancreatic cancer patients and triggers HLA-DR8 restricted T-cell activation.", "journal": "Immunology letters", "date": "2015", "authors": "Capello M, Caorsi C, Bogantes Hernandez PJ, Dametto E, Bertinetto FE, Magistroni P, Rendine S, Amoroso A, Novelli F", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "26096821", "url": "https://glygen.org/publication/PubMed/26096821" } ] }, { "title": "M. tuberculosis Secretory Protein ESAT-6 Induces Metabolic Flux Perturbations to Drive Foamy Macrophage Differentiation.", "journal": "Scientific reports", "date": "2015", "authors": "Singh V, Kaur C, Chaudhary VK, Rao KV, Chatterjee S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9636667", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636667" } ], "reference": [ { "type": "PubMed", "id": "26250836", "url": "https://glygen.org/publication/PubMed/26250836" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "Identification of a mammalian glycerol-3-phosphate phosphatase: Role in metabolism and signaling in pancreatic beta-cells and hepatocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Mugabo Y, Zhao S, Seifried A, Gezzar S, Al-Mass A, Zhang D, Lamontagne J, Attane C, Poursharifi P, Iglesias J, Joly E, Peyot ML, Gohla A, Madiraju SR, Prentki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "26755581", "url": "https://glygen.org/publication/PubMed/26755581" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "Refined crystal structure of cytoplasmic malate dehydrogenase at 2.5-A resolution.", "journal": "Biochemistry", "date": "1989", "authors": "Birktoft JJ, Rhodes G, Banaszak LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "2775751", "url": "https://glygen.org/publication/PubMed/2775751" } ] }, { "title": "Members of the human glyceraldehyde-3-phosphate dehydrogenase-related gene family map to dispersed chromosomal locations.", "journal": "Genomics", "date": "1989", "authors": "Benham FJ, Povey S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "2793178", "url": "https://glygen.org/publication/PubMed/2793178" } ] }, { "title": "Sequence of the human erythrocyte phosphoglycerate mutase by microsequencer and mass spectrometry.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Blouquit Y, Calvin MC, Rosa R, Prome D, Prome JC, Pratbernou F, Cohen-Solal M, Rosa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "2846554", "url": "https://glygen.org/publication/PubMed/2846554" } ] }, { "title": "CMTM6 maintains the expression of PD-L1 and regulates anti-tumour immunity.", "journal": "Nature", "date": "2017", "authors": "Burr ML, Sparbier CE, Chan YC, Williamson JC, Woods K, Beavis PA, Lam EYN, Henderson MA, Bell CC, Stolzenburg S, Gilan O, Bloor S, Noori T, Morgens DW, Bassik MC, Neeson PJ, Behren A, Darcy PK, Dawson SJ, Voskoboinik I, Trapani JA, Cebon J, Lehner PJ, Dawson MA", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "28813417", "url": "https://glygen.org/publication/PubMed/28813417" } ] }, { "title": "SLC25A10 biallelic mutations in intractable epileptic encephalopathy with complex I deficiency.", "journal": "Human molecular genetics", "date": "2018", "authors": "Punzi G, Porcelli V, Ruggiu M, Hossain MF, Menga A, Scarcia P, Castegna A, Gorgoglione R, Pierri CL, Laera L, Lasorsa FM, Paradies E, Pisano I, Marobbio CMT, Lamantea E, Ghezzi D, Tiranti V, Giannattasio S, Donati MA, Guerrini R, Palmieri L, Palmieri F, De Grassi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "29211846", "url": "https://glygen.org/publication/PubMed/29211846" } ] }, { "title": "Characterization of the enzymatic defect in late-onset muscle phosphofructokinase deficiency. New subtype of glycogen storage disease type VII.", "journal": "The Journal of clinical investigation", "date": "1987", "authors": "Vora S, DiMauro S, Spear D, Harker D, Danon MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "2960695", "url": "https://glygen.org/publication/PubMed/2960695" } ] }, { "title": "p300-Mediated Lysine 2-Hydroxyisobutyrylation Regulates Glycolysis.", "journal": "Molecular cell", "date": "2018", "authors": "Huang H, Tang S, Ji M, Tang Z, Shimada M, Liu X, Qi S, Locasale JW, Roeder RG, Zhao Y, Li X", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "29775581", "url": "https://glygen.org/publication/PubMed/29775581" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P06733", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Hepatic HKDC1 Expression Contributes to Liver Metabolism.", "journal": "Endocrinology", "date": "2019", "authors": "Pusec CM, De Jesus A, Khan MW, Terry AR, Ludvik AE, Xu K, Giancola N, Pervaiz H, Daviau Smith E, Ding X, Harrison S, Chandel NS, Becker TC, Hay N, Ardehali H, Cordoba-Chacon J, Layden BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "30517626", "url": "https://glygen.org/publication/PubMed/30517626" } ] }, { "title": "Biochemical and genetic identity of alpha-keto acid reductase and cytoplasmic malate dehydrogenase from human erythrocytes.", "journal": "Annals of human genetics", "date": "1988", "authors": "Friedrich CA, Ferrell RE, Siciliano MJ, Kitto GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "3052244", "url": "https://glygen.org/publication/PubMed/3052244" } ] }, { "title": "Bi-allelic GOT2 Mutations Cause a Treatable Malate-Aspartate Shuttle-Related Encephalopathy.", "journal": "American journal of human genetics", "date": "2019", "authors": "van Karnebeek CDM, Ramos RJ, Wen XY, Tarailo-Graovac M, Gleeson JG, Skrypnyk C, Brand-Arzamendi K, Karbassi F, Issa MY, van der Lee R, Drogemoller BI, Koster J, Rousseau J, Campeau PM, Wang Y, Cao F, Li M, Ruiter J, Ciapaite J, Kluijtmans LAJ, Willemsen MAAP, Jans JJ, Ross CJ, Wintjes LT, Rodenburg RJ, Huigen MCDG, Jia Z, Waterham HR, Wasserman WW, Wanders RJA, Verhoeven-Duif NM, Zaki MS, Wevers RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "31422819", "url": "https://glygen.org/publication/PubMed/31422819" } ] }, { "title": "Isolation and complete sequence of a functional human glyceraldehyde-3-phosphate dehydrogenase gene.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ercolani L, Florence B, Denaro M, Alexander M", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "3170585", "url": "https://glygen.org/publication/PubMed/3170585" } ] }, { "title": "Complete amino acid sequence of the neurone-specific gamma isozyme of enolase (NSE) from human brain and comparison with the non-neuronal alpha form (NNE).", "journal": "European journal of biochemistry", "date": "1988", "authors": "McAleese SM, Dunbar B, Fothergill JE, Hinks LJ, Day IN", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "3208766", "url": "https://glygen.org/publication/PubMed/3208766" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "The complete amino acid sequence of human skeletal-muscle fructose-bisphosphate aldolase.", "journal": "The Biochemical journal", "date": "1988", "authors": "Freemont PS, Dunbar B, Fothergill-Gilmore LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "3355497", "url": "https://glygen.org/publication/PubMed/3355497" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Phosphoenolpyruvate carboxykinase in cell metabolism: Roles and mechanisms beyond gluconeogenesis.", "journal": "Molecular metabolism", "date": "2021", "authors": "Yu S, Meng S, Xiang M, Ma H", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "34020084", "url": "https://glygen.org/publication/PubMed/34020084" } ] }, { "title": "PCK2 opposes mitochondrial respiration and maintains the redox balance in starved lung cancer cells.", "journal": "Free radical biology & medicine", "date": "2021", "authors": "Bluemel G, Planque M, Madreiter-Sokolowski CT, Haitzmann T, Hrzenjak A, Graier WF, Fendt SM, Olschewski H, Leithner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "34520823", "url": "https://glygen.org/publication/PubMed/34520823" } ] }, { "title": "Human testis-specific PGK gene lacks introns and possesses characteristics of a processed gene.", "journal": "Nature", "date": "1987", "authors": "McCarrey JR, Thomas K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "3453121", "url": "https://glygen.org/publication/PubMed/3453121" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Hexokinase domain-containing protein-1 in metabolic diseases and beyond.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "2022-01", "authors": "Zapater Joseph L, Lednovich Kristen R, Khan Md Wasim, Pusec Carolina M, Layden Brian T", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "34782236", "url": "https://glygen.org/publication/PubMed/34782236" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Molecular cloning and nucleotide sequence of a full-length cDNA for human alpha enolase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Giallongo A, Feo S, Moore R, Croce CM, Showe LC", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "3529090", "url": "https://glygen.org/publication/PubMed/3529090" } ] }, { "title": "Metabolic cycles and signals for insulin secretion.", "journal": "Cell metabolism", "date": "2022", "authors": "Merrins MJ, Corkey BE, Kibbey RG, Prentki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "35728586", "url": "https://glygen.org/publication/PubMed/35728586" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06733", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06733" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "Unrevealed roles of extracellular enolase\u20111 (ENO1) in promoting glycolysis and pro\u2011cancer activities in multiple myeloma via hypoxia\u2011inducible factor 1\u03b1.", "journal": "Oncology reports", "date": "2023-11", "authors": "Chung I-Che, Huang Wei-Ching, Huang Yung-Tsang, Chen Mao-Lin, Tsai An-Wei, Wu Pei-Yu, Yuan Ta-Tung", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" } ], "reference": [ { "type": "PubMed", "id": "37800625", "url": "https://glygen.org/publication/PubMed/37800625" } ] }, { "title": "N6-methyladenosine methyltransferase KIAA1429 promoted ovarian cancer aerobic glycolysis and progression through enhancing ENO1 expression.", "journal": "Biology direct", "date": "2023-10-09", "authors": "Gan Lijuan, Zhao Shengchao, Gao Yang, Qi Yuwen, Su Min, Wang Anjin, Cai Hongbing", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" } ], "reference": [ { "type": "PubMed", "id": "37807062", "url": "https://glygen.org/publication/PubMed/37807062" } ] }, { "title": "Long non-coding RNA NMRAL2P promotes glycolysis and reduces ROS in head and neck tumors by interacting with the ENO1 protein and promoting GPX2 transcription.", "journal": "PeerJ", "date": "2023", "authors": "Nie Qian, Cao Huan, Yang JianWang, Liu Tao, Wang BaoShan", "evidence": [ { "database": "RefSeq", "id": "NP_001188412", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001188412" } ], "reference": [ { "type": "PubMed", "id": "37810778", "url": "https://glygen.org/publication/PubMed/37810778" } ] }, { "title": "The primary structure of mitochondrial aspartate aminotransferase from human heart.", "journal": "Biochimica et biophysica acta", "date": "1985", "authors": "Martini F, Angelaccio S, Barra D, Pascarella S, Maras B, Doonan S, Bossa F", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4052435", "url": "https://glygen.org/publication/PubMed/4052435" } ] }, { "title": "Enolase isoenzymes in rat tissues. Electrophoretic, chromatographic, immunological and kinetic properties.", "journal": "Biochimica et biophysica acta", "date": "1974", "authors": "Rider CC, Taylor CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "4413246", "url": "https://glygen.org/publication/PubMed/4413246" } ] }, { "title": "X-ray diffraction study of binding of 2,3-diphosphoglycerate to human deoxyhaemoglobin.", "journal": "Nature", "date": "1972", "authors": "Arnone A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "4555506", "url": "https://glygen.org/publication/PubMed/4555506" } ] }, { "title": "Mechanism of the exchanges catalysed by the oxoglutarate translocator of rat-heart mitochondria. Kinetics of the external-product inhibition.", "journal": "European journal of biochemistry", "date": "1973", "authors": "Sluse FE, Goffart G, Liebecq C", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4687397", "url": "https://glygen.org/publication/PubMed/4687397" } ] }, { "title": "Inhibition of phosphoenolpyruvate transport via the tricarboxylate and adenine nucleotide carrier systems of rat liver mitochondria.", "journal": "Biochemical and biophysical research communications", "date": "1973", "authors": "Shug AL, Shrago E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4716993", "url": "https://glygen.org/publication/PubMed/4716993" } ] }, { "title": "On the specificity of the tricarboxylate carrier system in rat liver mitochondria.", "journal": "FEBS letters", "date": "1973", "authors": "Kleineke J, Sauer H, Soling HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4719206", "url": "https://glygen.org/publication/PubMed/4719206" } ] }, { "title": "Relationship between intracellular distribution of phosphoenolpyruvate carboxykinase, regulation of gluconeogenesis, and energy cost of glucose formation.", "journal": "European journal of biochemistry", "date": "1973", "authors": "Soling HD, Kleineke J, Willms B, Janson G, Kuhn A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4745729", "url": "https://glygen.org/publication/PubMed/4745729" } ] }, { "title": "Phosphoglycerate mutase isozyme marker for tissue differentiation in man.", "journal": "American journal of human genetics", "date": "1974", "authors": "Omenn GS, Cheung SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "4827367", "url": "https://glygen.org/publication/PubMed/4827367" } ] }, { "title": "Human phosphoglycerate kinase. I. Crystallization and characterization of normal enzyme.", "journal": "The Journal of biological chemistry", "date": "1972", "authors": "Yoshida A, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "5009693", "url": "https://glygen.org/publication/PubMed/5009693" } ] }, { "title": "The purification and properties of diphosphoglycerate mutase from human erythrocytes.", "journal": "The Journal of biological chemistry", "date": "1968", "authors": "Rose ZB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "5687724", "url": "https://glygen.org/publication/PubMed/5687724" } ] }, { "title": "Primary structure of human triosephosphate isomerase.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Lu HS, Yuan PM, Gracy RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "6434534", "url": "https://glygen.org/publication/PubMed/6434534" } ] }, { "title": "Isozymes of human phosphofructokinase: identification and subunit structural characterization of a new system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1980", "authors": "Vora S, Seaman C, Durham S, Piomelli S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "6444721", "url": "https://glygen.org/publication/PubMed/6444721" } ] }, { "title": "Isozymes of human phosphofructokinase in blood cells and cultured cell lines: molecular and genetic evidence for a trigenic system.", "journal": "Blood", "date": "1981", "authors": "Vora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "6451249", "url": "https://glygen.org/publication/PubMed/6451249" } ] }, { "title": "Human skeletal-muscle aldolase: N-terminal sequence analysis of CNBr- and o-iodosobenzoic acid-cleavage fragments.", "journal": "Archives of biochemistry and biophysics", "date": "1984", "authors": "Freemont PS, Dunbar B, Fothergill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "6696436", "url": "https://glygen.org/publication/PubMed/6696436" } ] }, { "title": "Complete amino acid sequence of human phosphoglycerate kinase. Isolation and amino acid sequence of tryptic peptides.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Huang IY, Rubinfien E, Yoshida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "6771269", "url": "https://glygen.org/publication/PubMed/6771269" } ] }, { "title": "Glyceraldehyde-3-phosphate dehydrogenase from human tissues.", "journal": "Methods in enzymology", "date": "1982", "authors": "Heinz F, Freimuller B", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "7144574", "url": "https://glygen.org/publication/PubMed/7144574" } ] }, { "title": "Compartmentation of hexokinase in human blood cells. Characterization of soluble and particulate enzymes.", "journal": "Biochimica et biophysica acta", "date": "1982", "authors": "Rijksen G, Staal GE, Beks PJ, Streefkerk M, Akkerman JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "7150652", "url": "https://glygen.org/publication/PubMed/7150652" } ] }, { "title": "Complete amino acid sequence of human phosphoglycerate kinase. Cyanogen bromide peptides and complete amino acid sequence.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Huang IY, Welch CD, Yoshida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "7391027", "url": "https://glygen.org/publication/PubMed/7391027" } ] }, { "title": "Citrate transport in liposomes reconstituted with triton extracts from mitochondria.", "journal": "Biochemical and biophysical research communications", "date": "1980", "authors": "Stipani I, Kramer R, Palmieri F, Klingenberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "7470147", "url": "https://glygen.org/publication/PubMed/7470147" } ] }, { "title": "Genetic basis of glycogen storage disease type 1a: prevalent mutations at the glucose-6-phosphatase locus.", "journal": "American journal of human genetics", "date": "1995", "authors": "Lei KJ, Chen YT, Chen H, Wong LJ, Liu JL, McConkie-Rosell A, Van Hove JL, Ou HC, Yeh NJ, Pan LY, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "7573034", "url": "https://glygen.org/publication/PubMed/7573034" } ] }, { "title": "Chicken alpha-enolase but not beta-enolase has a Src-dependent tyrosine-phosphorylation site: cDNA cloning and nucleotide sequence analysis.", "journal": "Journal of biochemistry", "date": "1995", "authors": "Tanaka M, Maeda K, Nakashima K", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "7629021", "url": "https://glygen.org/publication/PubMed/7629021" } ] }, { "title": "Diverse mutations in the aldolase B gene that underlie the prevalence of hereditary fructose intolerance.", "journal": "American journal of human genetics", "date": "1995", "authors": "Ali M, Cox TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "7717389", "url": "https://glygen.org/publication/PubMed/7717389" } ] }, { "title": "Induced expression of alpha-enolase in differentiated diffuse large cell lymphoma.", "journal": "Enzyme Protein", "date": "1994", "authors": "Mohammad R M, Hamdan M Y, al-Katib A", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "7787969", "url": "https://glygen.org/publication/PubMed/7787969" } ] }, { "title": "Functional expression of human mutant phosphofructokinase in yeast: genetic defects in French Canadian and Swiss patients with phosphofructokinase deficiency.", "journal": "American journal of human genetics", "date": "1995", "authors": "Raben N, Exelbert R, Spiegel R, Sherman JB, Nakajima H, Plotz P, Heinisch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "7825568", "url": "https://glygen.org/publication/PubMed/7825568" } ] }, { "title": "The characterization of gene mutations for human glucose phosphate isomerase deficiency associated with chronic hemolytic anemia.", "journal": "The Journal of clinical investigation", "date": "1994", "authors": "Xu W, Beutler E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "7989588", "url": "https://glygen.org/publication/PubMed/7989588" } ] }, { "title": "Cloning of a complete protein-coding sequence of human platelet-type phosphofructokinase isozyme from pancreatic islet.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Eto K, Sakura H, Yasuda K, Hayakawa T, Kawasaki E, Moriuchi R, Nagataki S, Yazaki Y, Kadowaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "8117307", "url": "https://glygen.org/publication/PubMed/8117307" } ] }, { "title": "Mutations in the glucose-6-phosphatase gene that cause glycogen storage disease type 1a.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Lei KJ, Shelly LL, Pan CJ, Sidbury JB, Chou JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "8211187", "url": "https://glygen.org/publication/PubMed/8211187" } ] }, { "title": "Structure/function studies of human beta-cell glucokinase. Enzymatic properties of a sequence polymorphism, mutations associated with diabetes, and other site-directed mutants.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Takeda J, Gidh-Jain M, Xu LZ, Froguel P, Velho G, Vaxillaire M, Cohen D, Shimada F, Makino H, Nishi S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "8325892", "url": "https://glygen.org/publication/PubMed/8325892" } ] }, { "title": "The molecular genetic basis of muscle phosphoglycerate mutase (PGAM) deficiency.", "journal": "American journal of human genetics", "date": "1993", "authors": "Tsujino S, Shanske S, Sakoda S, Fenichel G, DiMauro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "8447317", "url": "https://glygen.org/publication/PubMed/8447317" } ] }, { "title": "Molecular analysis of a series of alleles in humans with reduced activity at the triosephosphate isomerase locus.", "journal": "American journal of human genetics", "date": "1996", "authors": "Watanabe M, Zingg BC, Mohrenweiser HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "8571957", "url": "https://glygen.org/publication/PubMed/8571957" } ] }, { "title": "Recognition and specificity in protein tyrosine kinase-mediated signalling.", "journal": "Trends in biochemical sciences", "date": "1995", "authors": "Songyang Z, Cantley LC", "evidence": [ { "database": "iPTMnet", "id": "P06733", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06733" } ], "reference": [ { "type": "PubMed", "id": "8578591", "url": "https://glygen.org/publication/PubMed/8578591" } ] }, { "title": "The formation of a disulfide cross-link between the two subunits demonstrates the dimeric structure of the mitochondrial oxoglutarate carrier.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bisaccia F, Zara V, Capobianco L, Iacobazzi V, Mazzeo M, Palmieri F", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "8597574", "url": "https://glygen.org/publication/PubMed/8597574" } ] }, { "title": "Molecular cloning, sequencing and expression of the cDNA of the mitochondrial form of phosphoenolpyruvate carboxykinase from human liver.", "journal": "The Biochemical journal", "date": "1996", "authors": "Modaressi S, Christ B, Bratke J, Zahn S, Heise T, Jungermann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "8645161", "url": "https://glygen.org/publication/PubMed/8645161" } ] }, { "title": "Human hexokinase II gene: exon-intron organization, mutation screening in NIDDM, and its relationship to muscle hexokinase activity.", "journal": "Diabetologia", "date": "1995", "authors": "Lehto M, Huang X, Davis EM, Le Beau MM, Laurila E, Eriksson KF, Bell GI, Groop L", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "8786021", "url": "https://glygen.org/publication/PubMed/8786021" } ] }, { "title": "Autoreactive epitopes within the human alpha-enolase and their recognition by sera from patients with endometriosis.", "journal": "J. Autoimmun.", "date": "1995", "authors": "Walter M, Berg H, Leidenberger F A, Schweppe K W, Northemann W", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "8824716", "url": "https://glygen.org/publication/PubMed/8824716" } ] }, { "title": "A two-dimensional gel database of human colon carcinoma proteins.", "journal": "Electrophoresis", "date": "1997", "authors": "Ji H, Reid GE, Moritz RL, Eddes JS, Burgess AW, Simpson RJ", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "9150948", "url": "https://glygen.org/publication/PubMed/9150948" } ] }, { "title": "Identification of an epitope of alpha-enolase (a candidate plasminogen receptor) by phage display.", "journal": "Thromb. Haemost.", "date": "1997", "authors": "Arza B, F\u00e9lez J, Lopez-Alemany R, Miles L A, Mu\u00f1oz-C\u00e1noves P", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "9308760", "url": "https://glygen.org/publication/PubMed/9308760" } ] }, { "title": "Identification of genetic mutations in Japanese patients with fructose-1,6-bisphosphatase deficiency.", "journal": "American journal of human genetics", "date": "1997", "authors": "Kikawa Y, Inuzuka M, Jin BY, Kaji S, Koga J, Yamamoto Y, Fujisawa K, Hata I, Nakai A, Shigematsu Y, Mizunuma H, Taketo A, Mayumi M, Sudo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9382095", "url": "https://glygen.org/publication/PubMed/9382095" } ] }, { "title": "Sequence of a putative glucose 6-phosphate translocase, mutated in glycogen storage disease type Ib.", "journal": "FEBS letters", "date": "1997", "authors": "Gerin I, Veiga-da-Cunha M, Achouri Y, Collet JF, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9428641", "url": "https://glygen.org/publication/PubMed/9428641" } ] }, { "title": "Molecularly cloned mammalian glucosamine-6-phosphate deaminase localizes to transporting epithelium and lacks oscillin activity.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1998", "authors": "Wolosker H, Kline D, Bian Y, Blackshaw S, Cameron AM, Fralich TJ, Schnaar RL, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "9438414", "url": "https://glygen.org/publication/PubMed/9438414" } ] }, { "title": "The mechanism of regulation of hexokinase: new insights from the crystal structure of recombinant human brain hexokinase complexed with glucose and glucose-6-phosphate.", "journal": "Structure (London, England : 1993)", "date": "1998", "authors": "Aleshin AE, Zeng C, Bourenkov GP, Bartunik HD, Fromm HJ, Honzatko RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-70171", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171" } ], "reference": [ { "type": "PubMed", "id": "9493266", "url": "https://glygen.org/publication/PubMed/9493266" } ] }, { "title": "Molecular cloning and expression analysis of five novel genes in chromosome 1p36.", "journal": "Genomics", "date": "1998", "authors": "Onyango P, Lubyova B, Gardellin P, Kurzbauer R, Weith A", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "9653645", "url": "https://glygen.org/publication/PubMed/9653645" } ] }, { "title": "Human mitochondrial phosphoenolpyruvate carboxykinase 2 gene. Structure, chromosomal localization and tissue-specific expression.", "journal": "The Biochemical journal", "date": "1998", "authors": "Modaressi S, Brechtel K, Christ B, Jungermann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9657976", "url": "https://glygen.org/publication/PubMed/9657976" } ] }, { "title": "Isolation and characterization of an allelic cDNA for human muscle fructose-1,6-bisphosphatase.", "journal": "Gene", "date": "1998", "authors": "Tillmann H, Eschrich K", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9678974", "url": "https://glygen.org/publication/PubMed/9678974" } ] }, { "title": "A gene on chromosome 11q23 coding for a putative glucose- 6-phosphate translocase is mutated in glycogen-storage disease types Ib and Ic.", "journal": "American journal of human genetics", "date": "1998", "authors": "Veiga-da-Cunha M, Gerin I, Chen YT, de Barsy T, de Lonlay P, Dionisi-Vici C, Fenske CD, Lee PJ, Leonard JV, Maire I, McConkie-Rosell A, Schweitzer S, Vikkula M, Van Schaftingen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9758626", "url": "https://glygen.org/publication/PubMed/9758626" } ] }, { "title": "Aggregation states of mitochondrial malate dehydrogenase.", "journal": "Protein science : a publication of the Protein Society", "date": "1998", "authors": "Sanchez SA, Hazlett TL, Brunet JE, Jameson DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-70263", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263" } ], "reference": [ { "type": "PubMed", "id": "9792106", "url": "https://glygen.org/publication/PubMed/9792106" } ] }, { "title": "Anti-enolase-alpha autoantibodies in cancer-associated retinopathy: epitope mapping and cytotoxicity on retinal cells.", "journal": "J. Autoimmun.", "date": "1998", "authors": "Adamus G, Amundson D, Seigel G M, Machnicki M", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "reference": [ { "type": "PubMed", "id": "9878089", "url": "https://glygen.org/publication/PubMed/9878089" } ] } ], "pathway": [ { "id": "hsa:2023", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2023", "resource": "KEGG Pathway" }, { "id": "R-HSA-70171", "name": "Glycolysis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70171", "resource": "Reactome", "description": "Glycolysis" }, { "id": "R-HSA-70263", "name": "Gluconeogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70263", "resource": "Reactome", "description": "Gluconeogenesis" }, { "id": "R-HSA-9636667", "name": "Manipulation of host energy metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636667", "resource": "Reactome", "description": "Manipulation of host energy metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "M0R5J4-1", "protein_name": "Alpha-enolase", "gene_name": "Eno1-ps1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKSAIAKAGYTDQVVIGMDVAASEFYRAGKYDLDFKSPDDASRYITPDQLADLYKSFIKDYPVVSIEDPFDQDDWDAWQKFTATAGIQVVGDDLTVTNPKRIAKAAGEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSECLAKYNQILRIEEELGSKAKFAGRSFRNPLAK", "length": 434 }, "evidence": [ { "id": "P06733", "url": "https://omabrowser.org/oma/group/P06733/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P00924-1", "protein_name": "Enolase 1", "gene_name": "ENO1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MAVSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDGDKSKWMGKGVLHAVKNVNDVIAPAFVKANIDVKDQKAVDDFLISLDGTANKSKLGANAILGVSLAASRAAAAEKNVPLYKHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAPTGAKTFAEALRIGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPNIQTAEEALDLIVDAIKAAGHDGKIKIGLDCASSEFFKDGKYDLDFKNPNSDKSKWLTGPQLADLYHSLMKRYPIVSIEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPKRIATAIEKKAADALLLKVNQIGTLSESIKAAQDSFAAGWGVMVSHRSGETEDTFIADLVVGLRTGQIKTGAPARSERLAKLNQLLRIEEELGDNAVFAGENFHHGDKL", "length": 437 }, "evidence": [ { "id": "P06733", "url": "https://omabrowser.org/oma/group/P06733/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P04764-1", "protein_name": "Alpha-enolase", "gene_name": "Eno1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKSAIAKAGYTDQVVIGMDVAASEFYRAGKYDLDFKSPDDASRYITPDQLADLYKSFIKDYPVVSIEDPFDQDDWDAWQKFTATAGIQVVGDDLTVTNPKRIAKAAGEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK", "length": 434 }, "evidence": [ { "id": "45929293", "url": "http://www.informatics.jax.org/homology/45929293", "database": "MGI" }, { "id": "45929294", "url": "http://www.informatics.jax.org/homology/45929294", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P15007-1", "protein_name": "Enolase", "gene_name": "Eno", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSWTASVFLRTSTTSMKFLRLRWPLPRIPQNKSANVAPRFRSKSAVSQLSSGFKFVQIRKSTCDSNEMTIKAIKARQIYDSRGNPTVEVDLTTELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKAVGHVNDTLGPELIKANLDVVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLYKHIADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILPTGATSFTEAMKMGSEVYHHLKNVIKAKFGLDATAVGDEGGFAPNIQSNKEALNLISDAIAKAGYTGKIEIGMDVAASEFYKDGQYDLDFKNEKSDKSQWLPADKLANLYQEFIKDFPIVSIEDPFDQDHWEAWSNLTGCTDIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHRSGETEDSFIGDLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKPQ", "length": 500 }, "evidence": [ { "id": "P06733", "url": "https://omabrowser.org/oma/group/P06733/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P17182-1", "protein_name": "Alpha-enolase", "gene_name": "Eno1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK", "length": 434 }, "evidence": [ { "id": "45929293", "url": "http://www.informatics.jax.org/homology/45929293", "database": "MGI" }, { "id": "45929294", "url": "http://www.informatics.jax.org/homology/45929294", "database": "MGI" }, { "id": "P06733", "url": "https://omabrowser.org/oma/group/P06733/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "phosphopyruvate hydratase activity", "id": "GO:0004634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004634", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "GTPase binding", "id": "GO:0051020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051020", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity, RNA polymerase II-specific", "id": "GO:0001227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001227", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "transcription corepressor binding", "id": "GO:0001222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001222", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "glycolytic process", "id": "GO:0006096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006096", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "positive regulation of plasminogen activation", "id": "GO:0010756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010756", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "positive regulation of muscle contraction", "id": "GO:0045933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045933", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "positive regulation of ATP biosynthetic process", "id": "GO:2001171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001171", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "gluconeogenesis", "id": "GO:0006094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006094", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "negative regulation of cell growth", "id": "GO:0030308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "canonical glycolysis", "id": "GO:0061621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061621", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway", "id": "GO:1903298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903298", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "phosphopyruvate hydratase complex", "id": "GO:0000015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000015", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "M band", "id": "GO:0031430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031430", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" }, { "name": "nuclear outer membrane", "id": "GO:0005640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005640", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "alpha-enolase O-glycosylated 1 (human)", "definition": "An alpha-enolase (human) that has been O-glycosylated at the residue equivalent to Thr-308 of the amino acid sequence represented by UniProtKB:P06733-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P06733-1, Thr-308, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053592", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053592" } ] } ], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "ISGylated.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" }, { "database": "PubMed", "id": "16815975", "url": "https://glygen.org/publication/PubMed/16815975" } ] }, { "annotation": "Lysine 2-hydroxyisobutyrylation (Khib) by p300/EP300 activates the phosphopyruvate hydratase activity.", "evidence": [ { "database": "UniProtKB", "id": "P06733", "url": "https://www.uniprot.org/uniprot/P06733" }, { "database": "PubMed", "id": "29775581", "url": "https://glygen.org/publication/PubMed/29775581" } ] } ], "interactions": [], "reactions": [ { "id": "10164", "name": "", "equation": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04764-1", "P15429-1", "P07323-1", "P09104-1", "P06733-1", "A6NNW6-3", "P13929-1", "P17183-1", "P21550-1", "P17182-1", "Q8C042-1", "P00924-1", "P00925-1", "P0CX10-1", "P0CX11-1", "P42222-1", "Q54RK5-1", "Q55F83-1", "P15007-1" ], "evidence": [ { "id": "10164", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10164" } ] }, { "id": "R-HSA-70494", "name": "Enolase dimers (ENO1,2,3) convert PEP to 2PG", "equation": "", "summary": "Cytosolic enolase dimers catalyze the reversible reaction of phosphoenolpyruvate (PEP) and water to form 2-phosphoglycerate (2PG). Three enolase isozymes have been purified and biochemically characterized. The alpha isoform (ENO1) is widely expressed (Giallongo et al. 1986). The beta isoform (ENO3) is expressed in muscle. Evidence for its function in vivo in humans comes from studies of a patient in whom a point mutation in the gene encoding the enzyme was associated specifically with reduced enolase activity in muscle extracts, and with other symptoms consistent with a defect in glycolysis (Comi et al. 2001). The gamma isoform of human enolase (ENO2) is normally expressed in neural tissue. It is not known to have distinctive biochemical functions, but is of possible clinical interest as a marker of some types of neuroendocrine and lung tumors (McAleese et al. 1988). A fourth candidate isozyme, ENO4, has been identified in the human and mouse genomes. The mouse form of the gene encodes a protein with enolase activity that is expressed in sperm and whose disruption is associated with abnormal sperm morphology (Nakamura et al. 2013).", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-29492" ], "output_participant_list": [ "R-ALL-30485" ], "enzyme_list": [ "A6NNW6-3", "P06733-1", "P09104-1", "P13929-1" ], "evidence": [ { "id": "R-HSA-70494", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-70494" } ] }, { "id": "R-HSA-71660", "name": "2-Phospho-D-glycerate <=> Phosphoenolpyruvate + H2O", "equation": "", "summary": "Cytosolic enolase catalyzes the reversible reaction of 2 phosphoglycerate to form phosphoenolpyruvate and water, elevating the transfer potential of the phosphoryl group.

Enolase is a homodimer and requires Mg++ for activity. Three isozymes have been purified and biochemically characterized. The alpha isoform is expressed in many normal human tissues (Giallongo et al. 1986). The beta isoform is expressed in muscle. Evidence for its function in vivo in humans comes from studies of a patient in whom a point mutation in the gene encoding the enzyme was associated specifically with reduced enolase activity in muscle extracts and with other symptoms consistent with a defect in glycolysis (Comi et al. 2001). The gamma isoform of human enolase is normally expressed in neural tissue and is of possible clinical interest as a marker of some types of neuroendocrine and lung tumors (McAleese et al. 1988). Biochemical studies of the homologous rat proteins indicate that both homo- and heterodimers of enolase form and are enzymatically active (Rider and Taylor 1974).

A fourth candidate isozyme, ENO4, has been identified in the human and mouse genomes. The mouse form of the gene encodes a protein with enolase activity that is expressed in sperm and whose disruption is associated with abnormal sperm morphology (Nakamura et al. 2013).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A6NNW6-3", "P06733-1", "P09104-1", "P13929-1" ], "evidence": [ { "id": "R-HSA-71660", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71660" } ] }, { "id": "R-HSA-9636669", "name": "esxA binds ENO1", "equation": "", "summary": "Mtb secreted 6 kDa early secretory antigenic target (esxA) binds to human enolase-1 protein (ENO1) (Singh et al. 2015).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P06733-1" ], "evidence": [ { "id": "R-HSA-9636669", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9636669" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29492", "participant_name": "PEP [cytosol]", "crossref": [ { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" }, { "id": "58702", "database": "ChEBI", "url": "" }, { "id": "3674425", "database": "PubChem Compound", "url": "" }, { "id": "PHOSPHO-ENOL-PYRUVATE", "database": "AraCyc", "url": "" }, { "id": "C00074", "database": "KEGG Gene", "url": "" }, { "id": "73-89-2", "database": "CAS", "url": "" }, { "id": "000003870145", "database": "ZINC", "url": "" }, { "id": "138-08-9", "database": "CAS", "url": "" }, { "id": "c00074", "database": "KEGG Gene", "url": "" } ] }, { "participant_id": "R-ALL-30485", "participant_name": "2PG [cytosol]", "crossref": [ { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" }, { "id": "58289", "database": "ChEBI", "url": "" }, { "id": "000003869232", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A6NNW6", "gene_name": "ENO4", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "A6NNW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NNW6" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "A6NNW6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NNW6" } ] } ] }, { "uniprot_ac": "P00924", "gene_name": "ENO1", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P00924", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00924" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P00924", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00924" } ] } ] }, { "uniprot_ac": "P00925", "gene_name": "ENO2", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P00925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00925" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P00925", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00925" } ] } ] }, { "uniprot_ac": "P04764", "gene_name": "Eno1", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P04764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04764" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P04764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04764" } ] } ] }, { "uniprot_ac": "P06733", "gene_name": "ENO1", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P06733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06733" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P06733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06733" } ] } ] }, { "uniprot_ac": "P07323", "gene_name": "Eno2", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P07323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07323" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P07323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07323" } ] } ] }, { "uniprot_ac": "P09104", "gene_name": "ENO2", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P09104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09104" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P09104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09104" } ] } ] }, { "uniprot_ac": "P0CX10", "gene_name": "ERR1", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P0CX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX10" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P0CX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX10" } ] } ] }, { "uniprot_ac": "P0CX11", "gene_name": "ERR2", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P0CX11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX11" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P0CX11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX11" } ] } ] }, { "uniprot_ac": "P13929", "gene_name": "ENO3", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P13929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13929" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P13929", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13929" } ] } ] }, { "uniprot_ac": "P15007", "gene_name": "Eno", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P15007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15007" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P15007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15007" } ] } ] }, { "uniprot_ac": "P15429", "gene_name": "Eno3", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P15429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15429" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P15429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15429" } ] } ] }, { "uniprot_ac": "P17182", "gene_name": "Eno1", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P17182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17182" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P17182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17182" } ] } ] }, { "uniprot_ac": "P17183", "gene_name": "Eno2", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P17183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17183" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P17183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17183" } ] } ] }, { "uniprot_ac": "P21550", "gene_name": "Eno3", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P21550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21550" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P21550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21550" } ] } ] }, { "uniprot_ac": "P42222", "gene_name": "ERR3", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "P42222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42222" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "P42222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42222" } ] } ] }, { "uniprot_ac": "Q54RK5", "gene_name": "enoA", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "Q54RK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RK5" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "Q54RK5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RK5" } ] } ] }, { "uniprot_ac": "Q55F83", "gene_name": "enoB", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "Q55F83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F83" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "Q55F83", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55F83" } ] } ] }, { "uniprot_ac": "Q8C042", "gene_name": "Eno4", "activity": [ { "ec_number": "4.2.1.11", "activity": "(2R)-2-phosphoglycerate = H2O + phosphoenolpyruvate.", "evidence": [ { "id": "Q8C042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C042" } ] }, { "ec_number": "4.2.1.11", "activity": "", "evidence": [ { "id": "Q8C042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C042" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 272, 308 ], "snv_sites": [ 18, 153, 156, 272, 308, 319, 347 ], "glycation_sites": [], "phosphorylation_sites": [ 27, 44, 57, 63, 72, 100, 254, 263, 272, 287, 291, 419 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 70, "end_pos": 72 }, { "start_pos": 83, "end_pos": 85 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 170 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }