{ "uniprot_canonical_ac": "P06731-1", "uniprot_ac": "P06731", "uniprot_id": "CEAM5_HUMAN", "mass": { "chemical_mass": 76796.0, "monoisotopic_mass": 76796.0 }, "refseq": { "ac": "NP_001278413", "name": "carcinoembryonic antigen-related cell adhesion molecule 5 isoform 1 preproprotein", "summary": "This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, "gene_names": [ { "name": "CEACAM5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06731", "id": "P06731" }, { "name": "CD66e; CEA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413", "id": "NP_001278413" }, { "name": "CEACAM5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413", "id": "NP_001278413" }, { "name": "CEA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06731", "id": "P06731" }, { "name": "hCG_1642477", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06731", "id": "P06731" } ], "protein_names": [ { "name": "Carcinoembryonic antigen-related cell adhesion molecule 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06731" }, { "name": "CEA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06731" }, { "name": "Carcinoembryonic antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06731" }, { "name": "Meconium antigen 100", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06731" }, { "name": "carcinoembryonic antigen-related cell adhesion molecule 5 isoform 1 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413", "id": "NP_001278413" }, { "name": "meconium antigen 100; carcinoembryonic antigen related cell adhesion molecule 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413", "id": "NP_001278413" } ], "function": [ { "annotation": "(Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731#function" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "annotation": "CEACAM5 inhibits the lymphatic metastasis of head and neck squamous cell carcinoma by regulating epithelial-mesenchymal transition via inhibiting MDM2.", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, { "database": "PubMed", "id": "36377775", "url": "https://glygen.org/publication/PubMed/36377775" } ] }, { "annotation": "Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression (PubMed:2803308, PubMed:10910050, PubMed:10864933). Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6 (PubMed:2803308). Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells (PubMed:10910050).", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731#function" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" }, { "database": "PubMed", "id": "10910050", "url": "https://glygen.org/publication/PubMed/10910050" }, { "database": "PubMed", "id": "2803308", "url": "https://glygen.org/publication/PubMed/2803308" } ] }, { "annotation": "Combination of CEACAM5, EpCAM and CK19 gene expressions in mediastinal lymph node micrometastasis is a prognostic factor for non-small cell lung cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, { "database": "PubMed", "id": "37312199", "url": "https://glygen.org/publication/PubMed/37312199" } ] }, { "annotation": "Detection and clinical significance of CEACAM5 methylation in colorectal cancer patients.", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, { "database": "PubMed", "id": "37942534", "url": "https://glygen.org/publication/PubMed/37942534" } ] }, { "annotation": "Identification of CEACAM5 as a stemness-related inhibitory immune checkpoint in pancreatic cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, { "database": "PubMed", "id": "36494785", "url": "https://glygen.org/publication/PubMed/36494785" } ] }, { "annotation": "This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ] }, { "annotation": "[Heterogeneity analysis of pancreatic cancer and identification of molecular subtypes of tumor cells based on CEACAM5, LGALS1 and CENPF gene expression].", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" }, { "database": "PubMed", "id": "37814871", "url": "https://glygen.org/publication/PubMed/37814871" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs199819373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199819373#frequency_tab" }, { "id": "rs199819373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199819373" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 199, "end_pos": 199, "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLT->NLT); n-glyco-sequon-loss (NRT->NRN).", "chr_id": "19", "chr_pos": "41717626", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T199", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs149409426", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149409426" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS); n-glyco-sequon-gain (NLN->NLS).", "chr_id": "19", "chr_pos": "41715713", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N256", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149409426", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149409426" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->TLS); n-glyco-sequon-gain (NLN->NLT).", "chr_id": "19", "chr_pos": "41715713", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N256", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs958579590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958579590" }, { "id": "rs958579590", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958579590#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 375, "end_pos": 375, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT); n-glyco-sequon-gain (NDN->NDS).", "chr_id": "19", "chr_pos": "41720095", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N375", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199819373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199819373#frequency_tab" }, { "id": "rs199819373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199819373" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 377, "end_pos": 377, "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TLT->NLT); n-glyco-sequon-loss (NRT->NRN).", "chr_id": "19", "chr_pos": "41717626", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T377", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs958579590", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs958579590" }, { "id": "rs958579590", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs958579590#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 553, "end_pos": 553, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT); n-glyco-sequon-gain (NGN->NGS).", "chr_id": "19", "chr_pos": "41720095", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N553", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs75165133", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75165133" }, { "id": "rs75165133", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75165133" }, { "id": "rs75165133", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs75165133" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 612, "end_pos": 612, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->TLS); n-glyco-sequon-gain (NLN->NLT).", "chr_id": "19", "chr_pos": "41720985", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs370822239", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370822239" }, { "id": "rs370822239", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370822239" }, { "id": "rs370822239", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370822239#frequency_tab" }, { "id": "rs370822239", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370822239" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 104, "end_pos": 104, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "19", "chr_pos": "41709926", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N104", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs150911810", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150911810" }, { "id": "rs150911810", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150911810" }, { "id": "rs150911810", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150911810#frequency_tab" }, { "id": "rs150911810", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150911810" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 106, "end_pos": 106, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->NAC).", "chr_id": "19", "chr_pos": "41709932", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S106", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs35091611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs35091611" }, { "id": "rs35091611", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs35091611" }, { "id": "rs35091611", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs35091611" }, { "id": "rs35091611", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs35091611#frequency_tab" }, { "id": "rs35091611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs35091611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 113, "end_pos": 113, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NII->NIT).", "chr_id": "19", "chr_pos": "41709953", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.1296", "site_lbl": "I113", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375689687", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375689687" }, { "id": "rs375689687", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375689687" }, { "id": "rs375689687", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375689687#frequency_tab" }, { "id": "rs375689687", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375689687" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 115, "end_pos": 115, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "19", "chr_pos": "41709959", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N115", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375689687", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375689687" }, { "id": "rs375689687", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375689687" }, { "id": "rs375689687", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375689687#frequency_tab" }, { "id": "rs375689687", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375689687" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 115, "end_pos": 115, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "19", "chr_pos": "41709959", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N115", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1480379979", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1480379979" }, { "id": "rs1480379979", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1480379979#frequency_tab" }, { "id": "rs1480379979", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1480379979" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 117, "end_pos": 117, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDK).", "chr_id": "19", "chr_pos": "41709965", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T117", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781845608", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781845608" }, { "id": "rs781845608", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781845608" }, { "id": "rs781845608", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781845608#frequency_tab" }, { "id": "rs781845608", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781845608" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 154, "end_pos": 154, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->NNA).", "chr_id": "19", "chr_pos": "41715006", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S154", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368142383", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368142383" }, { "id": "rs368142383", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368142383#frequency_tab" }, { "id": "22722201", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22722201" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 173, "end_pos": 173, "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAT->NAT).", "chr_id": "19", "chr_pos": "41715063", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D173", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1555814658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555814658" }, { "id": "rs1555814658", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555814658" }, { "id": "rs782300892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782300892" }, { "id": "rs782300892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782300892" }, { "id": "rs782300892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782300892" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 182, "end_pos": 182, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "19", "chr_pos": "41715090", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N182", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555814661", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555814661" }, { "id": "rs1555814661", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555814661" }, { "id": "rs534720244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534720244" }, { "id": "rs534720244", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534720244" }, { "id": "rs534720244", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534720244" }, { "id": "rs534720244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs534720244" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 182, "end_pos": 182, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "19", "chr_pos": "41715091", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N182", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs147510914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147510914" }, { "id": "rs147510914", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147510914#frequency_tab" }, { "id": "21499247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21499247" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 184, "end_pos": 184, "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->NQN).", "chr_id": "19", "chr_pos": "41715097", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S184", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs781785530", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781785530" }, { "id": "rs781785530", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781785530" }, { "id": "rs781785530", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781785530" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 197, "end_pos": 197, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "19", "chr_pos": "41715137", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N197", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199819373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199819373#frequency_tab" }, { "id": "rs199819373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199819373" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 199, "end_pos": 199, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRI).", "chr_id": "19", "chr_pos": "41717626", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T199", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782198510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782198510" }, { "id": "rs782198510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782198510" }, { "id": "rs782198510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782198510#frequency_tab" }, { "id": "rs782198510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782198510" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 206, "end_pos": 206, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVI).", "chr_id": "19", "chr_pos": "41715163", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T206", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1419342024", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1419342024" }, { "id": "rs1419342024", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1419342024#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 208, "end_pos": 208, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->IDT).", "chr_id": "19", "chr_pos": "41715169", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N208", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs17853315", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs17853315" }, { "id": "rs17853315", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs17853315#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 210, "end_pos": 210, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDA).", "chr_id": "19", "chr_pos": "41715174", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T210", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200945684", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200945684" }, { "id": "rs200945684", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200945684" }, { "id": "rs200945684", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200945684" }, { "id": "rs200945684", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200945684#frequency_tab" }, { "id": "rs200945684", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200945684" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 256, "end_pos": 256, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->YLS).", "chr_id": "19", "chr_pos": "41715712", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "N256", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1600462368", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600462368" }, { "id": "rs1600462368", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600462368" }, { "id": "rs1600467322", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600467322" }, { "id": "rs1600467322", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600467322" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 258, "end_pos": 258, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLP).", "chr_id": "19", "chr_pos": "41715718", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782113990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782113990" }, { "id": "rs782113990", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782113990" }, { "id": "rs782113990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782113990" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 258, "end_pos": 258, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLY).", "chr_id": "19", "chr_pos": "41718197", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782355979", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782355979" }, { "id": "rs782355979", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782355979" }, { "id": "rs782355979", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782355979" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 274, "end_pos": 274, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "19", "chr_pos": "41715767", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N274", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782242021", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782242021" }, { "id": "rs782242021", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782242021" }, { "id": "rs782242021", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782242021" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 274, "end_pos": 274, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "19", "chr_pos": "41715766", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N274", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555814932", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555814932" }, { "id": "rs1555814932", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555814932" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 276, "end_pos": 276, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGN).", "chr_id": "19", "chr_pos": "41715773", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T276", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140159293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140159293" }, { "id": "rs140159293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140159293" }, { "id": "rs140159293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140159293" }, { "id": "21499247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21499247" }, { "id": "rs201961466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201961466" }, { "id": "rs201961466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201961466" }, { "id": "rs201961466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201961466#frequency_tab" }, { "id": "rs201961466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201961466" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 288, "end_pos": 288, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "19", "chr_pos": "41718287", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N288", "keywords": [ "ebi", "somatic", "germline" ] }, { "evidence": [ { "id": "rs782648704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782648704" }, { "id": "rs782648704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782648704" }, { "id": "rs782648704", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782648704#frequency_tab" }, { "id": "rs782648704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782648704" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 290, "end_pos": 290, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "19", "chr_pos": "41718293", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782088161", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782088161" }, { "id": "rs782088161", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782088161" }, { "id": "rs782088161", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782088161#frequency_tab" }, { "id": "rs782088161", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782088161" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 290, "end_pos": 290, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIP).", "chr_id": "19", "chr_pos": "41715814", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781788150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781788150" }, { "id": "rs781788150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781788150" }, { "id": "rs781788150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781788150#frequency_tab" }, { "id": "rs781788150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781788150" }, { "id": "22895193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22895193" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "19", "chr_pos": "41715821", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N292", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs781788150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781788150" }, { "id": "rs781788150", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781788150" }, { "id": "rs781788150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781788150#frequency_tab" }, { "id": "rs781788150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781788150" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->TNS).", "chr_id": "19", "chr_pos": "41715821", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782392674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782392674" }, { "id": "rs782392674", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782392674" }, { "id": "rs782392674", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782392674#frequency_tab" }, { "id": "rs782392674", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782392674" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 309, "end_pos": 309, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->DRT).", "chr_id": "19", "chr_pos": "41715871", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N309", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782651082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782651082" }, { "id": "rs782651082", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782651082" }, { "id": "rs782651082", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782651082#frequency_tab" }, { "id": "rs782651082", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782651082" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 309, "end_pos": 309, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).", "chr_id": "19", "chr_pos": "41715873", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N309", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782392674", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782392674" }, { "id": "rs782392674", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782392674" }, { "id": "rs782392674", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782392674#frequency_tab" }, { "id": "rs782392674", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782392674" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 309, "end_pos": 309, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->YRT).", "chr_id": "19", "chr_pos": "41715871", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N309", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782380671", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782380671" }, { "id": "rs782380671", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782380671" }, { "id": "rs782380671", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782380671" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 311, "end_pos": 311, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRP).", "chr_id": "19", "chr_pos": "41718355", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T311", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149101572", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149101572" }, { "id": "rs149101572", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149101572" }, { "id": "rs149101572", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149101572" }, { "id": "rs149101572", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149101572" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 330, "end_pos": 330, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "19", "chr_pos": "41719960", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N330", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782181374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782181374" }, { "id": "rs782181374", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782181374" }, { "id": "rs782181374", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782181374" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 351, "end_pos": 351, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "19", "chr_pos": "41720022", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N351", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782545749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782545749" }, { "id": "rs782545749", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782545749" }, { "id": "rs782545749", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782545749" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 351, "end_pos": 351, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "19", "chr_pos": "41720024", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N351", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555815835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555815835" }, { "id": "rs1555815835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555815835" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 353, "end_pos": 353, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "19", "chr_pos": "41720028", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T353", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1351339974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351339974" }, { "id": "rs1351339974", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351339974#frequency_tab" }, { "id": "rs1351339974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351339974" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 353, "end_pos": 353, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTN).", "chr_id": "19", "chr_pos": "41720029", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T353", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555815255", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555815255" }, { "id": "rs1555815255", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555815255" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 353, "end_pos": 353, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTP).", "chr_id": "19", "chr_pos": "41717553", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T353", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1189230508", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1189230508" }, { "id": "rs1189230508", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1189230508#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KLT->NLT).", "chr_id": "19", "chr_pos": "41709720", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782300892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782300892" }, { "id": "rs782300892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782300892" }, { "id": "rs782300892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782300892" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->DQS).", "chr_id": "19", "chr_pos": "41717574", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs534720244", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534720244" }, { "id": "rs534720244", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534720244" }, { "id": "rs534720244", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534720244" }, { "id": "rs534720244", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs534720244" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 360, "end_pos": 360, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "19", "chr_pos": "41717575", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199819373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199819373" }, { "id": "rs199819373", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199819373#frequency_tab" }, { "id": "rs199819373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199819373" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 377, "end_pos": 377, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRI).", "chr_id": "19", "chr_pos": "41717626", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T377", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782632166", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782632166" }, { "id": "rs782632166", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782632166" }, { "id": "rs782632166", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782632166#frequency_tab" }, { "id": "rs782632166", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782632166" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 382, "end_pos": 382, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "19", "chr_pos": "41717641", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S382", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782785872", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782785872" }, { "id": "rs782785872", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782785872" }, { "id": "rs782785872", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782785872#frequency_tab" }, { "id": "rs782785872", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782785872" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 38, "end_pos": 38, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IES->NES).", "chr_id": "19", "chr_pos": "41709728", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I38", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555815400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555815400" }, { "id": "rs1555815400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555815400" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 432, "end_pos": 432, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "19", "chr_pos": "41718184", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N432", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1600467284", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1600467284" }, { "id": "rs1600467284", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1600467284" }, { "id": "rs782670029", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782670029" }, { "id": "rs782670029", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782670029" }, { "id": "rs782670029", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782670029" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 432, "end_pos": 432, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->TLS).", "chr_id": "19", "chr_pos": "41718185", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N432", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782799653", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782799653" }, { "id": "rs782799653", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782799653" }, { "id": "rs782799653", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782799653" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 433, "end_pos": 433, "sequence_org": "L", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NPS).", "chr_id": "19", "chr_pos": "41718188", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L433", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140159293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140159293" }, { "id": "rs140159293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140159293" }, { "id": "rs140159293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140159293" }, { "id": "21499247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21499247" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 466, "end_pos": 466, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "19", "chr_pos": "41718287", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N466", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs782648704", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782648704" }, { "id": "rs782648704", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782648704" }, { "id": "rs782648704", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782648704#frequency_tab" }, { "id": "rs782648704", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782648704" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 468, "end_pos": 468, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "19", "chr_pos": "41718293", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T468", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs550022667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550022667" }, { "id": "rs550022667", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs550022667" }, { "id": "rs550022667", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550022667" }, { "id": "rs550022667", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs550022667" }, { "id": "rs550022667", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs550022667#frequency_tab" }, { "id": "rs550022667", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs550022667" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 468, "end_pos": 468, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIM).", "chr_id": "19", "chr_pos": "41721087", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T468", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140477498", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140477498" }, { "id": "rs140477498", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs140477498" }, { "id": "rs140477498", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140477498" }, { "id": "rs140477498", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140477498#frequency_tab" }, { "id": "rs140477498", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140477498" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 46, "end_pos": 46, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).", "chr_id": "19", "chr_pos": "41709751", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.02236", "site_lbl": "A46", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149101572", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149101572" }, { "id": "rs149101572", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149101572" }, { "id": "rs149101572", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149101572" }, { "id": "rs149101572", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149101572" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 508, "end_pos": 508, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "19", "chr_pos": "41719960", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N508", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782181374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782181374" }, { "id": "rs782181374", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782181374" }, { "id": "rs782181374", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782181374" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 529, "end_pos": 529, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->DTT).", "chr_id": "19", "chr_pos": "41720022", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N529", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782545749", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782545749" }, { "id": "rs782545749", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782545749" }, { "id": "rs782545749", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782545749" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 529, "end_pos": 529, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "19", "chr_pos": "41720024", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N529", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555815835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555815835" }, { "id": "rs1555815835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555815835" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 531, "end_pos": 531, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "19", "chr_pos": "41720028", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T531", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1351339974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351339974" }, { "id": "rs1351339974", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1351339974#frequency_tab" }, { "id": "rs1351339974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351339974" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 531, "end_pos": 531, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTN).", "chr_id": "19", "chr_pos": "41720029", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T531", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs552514245", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs552514245" }, { "id": "rs552514245", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs552514245#frequency_tab" }, { "id": "rs552514245", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs552514245" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 560, "end_pos": 560, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "19", "chr_pos": "41720116", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N560", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138799075", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138799075" }, { "id": "rs138799075", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138799075" }, { "id": "rs138799075", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138799075" }, { "id": "rs138799075", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138799075" }, { "id": "rs138799075", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138799075#frequency_tab" }, { "id": "rs138799075", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138799075" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 566, "end_pos": 566, "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "19", "chr_pos": "41720133", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "A566", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1555816119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555816119" }, { "id": "rs1555816119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555816119" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->YLS).", "chr_id": "19", "chr_pos": "41720984", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs545208884", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs545208884" }, { "id": "rs545208884", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs545208884" }, { "id": "rs545208884", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs545208884" }, { "id": "rs545208884", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs545208884" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 613, "end_pos": 613, "sequence_org": "L", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NPS).", "chr_id": "19", "chr_pos": "41720988", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.06949", "site_lbl": "L613", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782326336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782326336" }, { "id": "rs782326336", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782326336" }, { "id": "rs782326336", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782326336" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLF).", "chr_id": "19", "chr_pos": "41720991", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S614", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201761909", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201761909" }, { "id": "rs201761909", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201761909" }, { "id": "rs201761909", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201761909" }, { "id": "rs201761909", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201761909" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLP).", "chr_id": "19", "chr_pos": "41720990", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.06949", "site_lbl": "S614", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1436868362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1436868362" }, { "id": "rs1436868362", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1436868362#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 621, "end_pos": 621, "sequence_org": "P", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NAS).", "chr_id": "19", "chr_pos": "41721011", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P621", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs565105444", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs565105444" }, { "id": "rs565105444", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs565105444" }, { "id": "rs565105444", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs565105444" }, { "id": "rs565105444", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs565105444#frequency_tab" }, { "id": "rs565105444", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs565105444" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 650, "end_pos": 650, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "19", "chr_pos": "41721100", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N650", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138328698", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138328698" }, { "id": "rs138328698", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138328698" }, { "id": "rs138328698", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138328698" }, { "id": "rs138328698", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138328698#frequency_tab" }, { "id": "rs138328698", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138328698" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 668, "end_pos": 668, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSI->NST).", "chr_id": "19", "chr_pos": "41721153", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "I668", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1172128197", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172128197" }, { "id": "rs1172128197", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1172128197#frequency_tab" }, { "id": "rs1172128197", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172128197" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 671, "end_pos": 671, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIT->NIT).", "chr_id": "19", "chr_pos": "41721162", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S671", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 125, "end_pos": 125, "sequence_org": "I", "sequence_mut": "A", "comment": "Abolishes dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 129, "end_pos": 129, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 129, "end_pos": 129, "sequence_org": "L", "sequence_mut": "C", "comment": "No effect on dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 129, "end_pos": 129, "sequence_org": "L", "sequence_mut": "S", "comment": "Abolishes dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 133, "end_pos": 133, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "F", "sequence_mut": "I", "comment": "No effect on dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "F", "sequence_mut": "R", "comment": "Abolishes dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "S", "sequence_mut": "N", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "start_pos": 68, "end_pos": 68, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "start_pos": 68, "end_pos": 68, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "start_pos": 73, "end_pos": 73, "sequence_org": "V", "sequence_mut": "A", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "D", "sequence_mut": "L", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "D", "sequence_mut": "R", "comment": "Abolishes dimerization.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "Q", "sequence_mut": "L", "comment": "Abolishes dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "Q", "sequence_mut": "R", "comment": "Abolishes dimerization. Reduced affinity for E.coli Dr adhesins.", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" }, { "database": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" }, { "database": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "57.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "71.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "52.53", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "49.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "27.57", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "52.18", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06731", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06731" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "common_name": "Human" } ], "gene": [ { "name": "CEACAM5", "url": "https://www.uniprot.org/uniprot/P06731", "locus": { "chromosome": "19", "start_pos": 41730433, "end_pos": 41708585, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000105388", "url": "https://www.ensembl.org/id/ENSG00000105388" } ] } } ], "crossref": [ { "id": "ENSG00000105388", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105388", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05740", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05740", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05774", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05774", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd20948", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20948", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3712881", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3712881", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CEACAM5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CEACAM5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1048", "url": "https://www.ncbi.nlm.nih.gov/gene/1048", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1071", "url": "https://glyconnect.expasy.org/browser/proteins/1071", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "1817", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1817", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P06731", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06731*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1048", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1048", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "114890", "url": "http://www.omim.org/entry/114890", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06731", "url": "https://www.nextprot.org/entry/NX_P06731", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "AIYECET", "url": "https://omabrowser.org/oma/group/AIYECET/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3033616at2759", "url": "http://www.orthodb.org/?query=3033616at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR44427", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44427", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR44427:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44427:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR44427:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44427:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1E07", "url": "https://www.rcsb.org/structure/1E07", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QSQ", "url": "https://www.rcsb.org/structure/2QSQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QST", "url": "https://www.rcsb.org/structure/2QST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VER", "url": "https://www.rcsb.org/structure/2VER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13927", "url": "http://pfam.xfam.org/family/PF13927", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06731", "url": "https://pharos.nih.gov/targets/P06731", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P06731", "url": "http://purl.obolibrary.org/obo/PR_P06731", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P06731", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A024R0K5", "url": "https://www.uniprot.org/uniprot/A0A024R0K5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A024R0K5-1", "url": "https://www.uniprot.org/uniprot/A0A024R0K5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WYX0", "url": "https://www.uniprot.org/uniprot/A0A087WYX0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WYX0-1", "url": "https://www.uniprot.org/uniprot/A0A087WYX0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QX98", "url": "https://www.uniprot.org/uniprot/M0QX98", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QX98-1", "url": "https://www.uniprot.org/uniprot/M0QX98-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R3J1", "url": "https://www.uniprot.org/uniprot/M0R3J1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R3J1-1", "url": "https://www.uniprot.org/uniprot/M0R3J1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06731-1", "url": "https://www.uniprot.org/uniprot/P06731-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06731-2", "url": "https://www.uniprot.org/uniprot/P06731-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 702, "header": "sp|P06731-1|CEAM5_HUMAN Isoform 1 of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4 CANONICAL=P06731-1" }, "isoforms": [ { "isoform_ac": "A0A024R0K5-1", "url": "", "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 702, "header": "tr|A0A024R0K5-1|A0A024R0K5_HUMAN Computationally mapped isoform of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41727313, "end_pos": 41708732, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000617332", "url": "https://www.ensembl.org/id/ENST00000617332" }, { "database": "Ensembl Peptide", "id": "ENSP00000482303", "url": "https://www.ensembl.org/id/ENSP00000482303" } ] } }, { "isoform_ac": "A0A087WYX0-1", "url": "", "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 524, "header": "tr|A0A087WYX0-1|CEAM5_HUMAN Computationally mapped isoform of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41727313, "end_pos": 41708732, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000615021.4", "url": "https://www.ensembl.org/id/ENST00000615021.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000482157.1", "url": "https://www.ensembl.org/id/ENSP00000482157.1" } ] } }, { "isoform_ac": "M0QX98-1", "url": "", "sequence": { "sequence": "XKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPEAQNT", "length": 141, "header": "tr|M0QX98-1|CEAM5_HUMAN Computationally mapped isoform of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41720028, "end_pos": 41709716, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595403.1", "url": "https://www.ensembl.org/id/ENST00000595403.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000468997.1", "url": "https://www.ensembl.org/id/ENSP00000468997.1" } ] } }, { "isoform_ac": "M0R3J1-1", "url": "", "sequence": { "sequence": "XIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLSEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTL", "length": 194, "header": "tr|M0R3J1-1|M0R3J1_HUMAN Computationally mapped isoform of CEA cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=1 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41717630, "end_pos": 41709914, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595113.1", "url": "https://www.ensembl.org/id/ENST00000595113.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000473252.1", "url": "https://www.ensembl.org/id/ENSP00000473252.1" } ] } }, { "isoform_ac": "P06731-1", "url": "", "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 702, "header": "sp|P06731-1|CEAM5_HUMAN Isoform 1 of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41727313, "end_pos": 41708732, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000405816.5", "url": "https://www.ensembl.org/id/ENST00000405816.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000385072.1", "url": "https://www.ensembl.org/id/ENSP00000385072.1" } ] } }, { "isoform_ac": "P06731-2", "url": "", "sequence": { "sequence": "MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI", "length": 701, "header": "sp|P06731-2|CEAM5_HUMAN Isoform 2 of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5 PE=1 SV=4 CANONICAL=P06731-1" }, "locus": { "chromosome": "19", "start_pos": 41727313, "end_pos": 41708732, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000398599.8", "url": "https://www.ensembl.org/id/ENST00000398599.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000381600.4", "url": "https://www.ensembl.org/id/ENSP00000381600.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64130AC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 115, "start_aa": "Asn", "end_pos": 115, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn115", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64130AC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G88976TU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 182, "start_aa": "Asn", "end_pos": 182, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn182", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G25379SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G25541YH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31433PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 256, "start_aa": "Asn", "end_pos": 256, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn256", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 274, "start_aa": "Asn", "end_pos": 274, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn274", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G25541YH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G42459UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 292, "start_aa": "Asn", "end_pos": 292, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn292", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 309, "start_aa": "Asn", "end_pos": 309, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn309", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64130AC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G88976TU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 360, "start_aa": "Asn", "end_pos": 360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn360", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 466, "start_aa": "Asn", "end_pos": 466, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn466", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 480, "start_aa": "Asn", "end_pos": 480, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn480", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 508, "start_aa": "Asn", "end_pos": 508, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn508", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 553, "start_aa": "Asn", "end_pos": 553, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn553", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 553, "start_aa": "Asn", "end_pos": 553, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn553", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 553, "start_aa": "Asn", "end_pos": 553, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn553", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "P06731", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 560, "start_aa": "Asn", "end_pos": 560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn560", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 580, "start_aa": "Asn", "end_pos": 580, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn580", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 612, "start_aa": "Asn", "end_pos": 612, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn612", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G29501UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G46241DR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 650, "start_aa": "Asn", "end_pos": 650, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn650", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 665, "start_aa": "Asn", "end_pos": 665, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn665", "evidence": [ { "id": "P06731", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "id": "PRU00498", "database": "PROSITE-PRORULE", "url": "https://prosite.expasy.org/rule/PRU00498" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G03595ET", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G03717EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G04791QM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06209KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G06374YY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G07392QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G08520NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G08796TW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G11535IB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G11637WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G20966TZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G21290RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23010ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23616ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G25140TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G25379SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G25541YH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G29501UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G29568VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31433PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31685JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G32072NY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G34105RF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G34730YF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G39064KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G41917DR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G42459UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G43089EG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G44331JI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G44617UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45841FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G48954CA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G50779LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G59471TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G60230HH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G63628AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64130AC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G66665YI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G68957QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G69108CV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G70961NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G71013KY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G74728JK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G74916CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G75850OP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G76613WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G79578JB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G82680EC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G84852GW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G85767HW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G89864BN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G89877QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90206GU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90348RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G90386IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G92073XL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G95898GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "1071", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206)", "journal": "Cell Mol Life Sci", "date": "2021", "authors": "Stavenhagen K., Laan L.C., Gao C., Mehta A.Y., Heimburg-Molinaro J., Glickman J.N., van Die I., Cummings R.D.", "evidence": [ { "database": "UniCarbKB", "id": "P06731", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1007/s00018-021-03863-1", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "title": "SARS-COV-2 Infection Causes Dyslipidemia and Increases Levels of Cancer Biomarkers in COVID-19 Patients", "journal": "Preprints with The Lancet", "date": "2020", "authors": "Tan W., Wei X., Su J., Lin Y., Wei J., Wan H., Cao X., Wang H.", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "DOI", "id": "10.2139/ssrn.3552854", "url": "https://glygen.org/publication/DOI/10.2139/ssrn.3552854" } ] }, { "title": "Four carcinoembryonic antigen subfamily members, CEA, NCA, BGP and CGM2, selectively expressed in the normal human colonic epithelium, are integral components of the fuzzy coat.", "journal": "Tumor Biol.", "date": "1999", "authors": "Frangsmyr L, Baranov V, Hammarstrom S", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "10436421", "url": "https://glygen.org/publication/PubMed/10436421" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "Structural models for carcinoembryonic antigen and its complex with the single-chain Fv antibody molecule MFE23.", "journal": "FEBS Lett.", "date": "2000", "authors": "Boehm M K, Perkins S J", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "10854848", "url": "https://glygen.org/publication/PubMed/10854848" } ] }, { "title": "Self recognition in the Ig superfamily. Identification of precise subdomains in carcinoembryonic antigen required for intercellular adhesion.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Taheri M, Saragovi U, Fuks A, Makkerh J, Mort J, Stanners CP", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "10864933", "url": "https://glygen.org/publication/PubMed/10864933" } ] }, { "title": "Human carcinoembryonic antigen functions as a general inhibitor of anoikis.", "journal": "Cancer research", "date": "2000-07-01", "authors": "Ordo\u00f1ez C, Screaton R A, Ilantzis C, Stanners C P", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "10910050", "url": "https://glygen.org/publication/PubMed/10910050" } ] }, { "title": "Structure and expression of the human glycosylphosphatidylinositol phospholipase D1 (GPLD1) gene.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Schofield JN, Rademacher TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "11072085", "url": "https://glygen.org/publication/PubMed/11072085" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "Serum CEA and CA 15-3 as prognostic factors in primary breast cancer.", "journal": "British journal of cancer", "date": "2002", "authors": "Ebeling FG, Stieber P, Untch M, Nagel D, Konecny GE, Schmitt UM, Fateh-Moghadam A, Seidel D", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "11953875", "url": "https://glygen.org/publication/PubMed/11953875" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "CEA, CA 19-9 and CA 72-4 improve the diagnostic accuracy in gastrointestinal cancers.", "journal": "Anticancer research", "date": "2002", "authors": "Carpelan-Holmstrom M, Louhimo J, Stenman UH, Alfthan H, Haglund C", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "12174919", "url": "https://glygen.org/publication/PubMed/12174919" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Pro-gastrin-releasing peptide (proGRP) in patients with benign and malignant diseases: comparison with CEA, SCC, CYFRA 21-1 and NSE in patients with lung cancer.", "journal": "Anticancer research", "date": "2005", "authors": "Molina R, Auge JM, Filella X, Vinolas N, Alicarte J, Domingo JM, Ballesta AM", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "16033098", "url": "https://glygen.org/publication/PubMed/16033098" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "Panel of serum biomarkers for the diagnosis of lung cancer.", "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology", "date": "2007-12-10", "authors": "Patz Edward F, Campa Michael J, Gottlin Elizabeth B, Kusmartseva Irina, Guan Xiang Rong, Herndon James E", "evidence": [ { "database": "GlyGen", "id": "A0472", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "18065730", "url": "https://glygen.org/publication/PubMed/18065730" } ] }, { "title": "Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation.", "journal": "Molecular microbiology", "date": "2008", "authors": "Korotkova N, Yang Y, Le Trong I, Cota E, Demeler B, Marchant J, Thomas WE, Stenkamp RE, Moseley SL, Matthews S", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "18086185", "url": "https://glygen.org/publication/PubMed/18086185" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731#ptm_processing" }, { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "Exome sequencing identifies GRIN2A as frequently mutated in melanoma.", "journal": "Nature genetics", "date": "2011", "authors": "Wei X, Walia V, Lin JC, Teer JK, Prickett TD, Gartner J, Davis S, Stemke-Hale K, Davies MA, Gershenwald JE, Robinson W, Robinson S, Rosenberg SA, Samuels Y", "evidence": [ { "database": "dbSNP", "id": "rs147510914", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147510914" }, { "database": "dbSNP", "id": "rs140159293", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140159293" } ], "reference": [ { "type": "PubMed", "id": "21499247", "url": "https://glygen.org/publication/PubMed/21499247" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "Prognostic significance of human epididymis protein 4 in epithelial ovarian cancer.", "journal": "European journal of obstetrics, gynecology, and reproductive biology", "date": "2011", "authors": "Paek J, Lee SH, Yim GW, Lee M, Kim YJ, Nam EJ, Kim SW, Kim YT", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "21683503", "url": "https://glygen.org/publication/PubMed/21683503" } ] }, { "title": "The landscape of cancer genes and mutational processes in breast cancer.", "journal": "Nature", "date": "2012", "authors": "Stephens PJ, Tarpey PS, Davies H, Van Loo P, Greenman C, Wedge DC, Nik-Zainal S, Martin S, Varela I, Bignell GR, Yates LR, Papaemmanuil E, Beare D, Butler A, Cheverton A, Gamble J, Hinton J, Jia M, Jayakumar A, Jones D, Latimer C, Lau KW, McLaren S, McBride DJ, Menzies A, Mudie L, Raine K, Rad R, Chapman MS, Teague J, Easton D, Langerod A, Lee MT, Shen CY, Tee BT, Huimin BW, Broeks A, Vargas AC, Turashvili G, Martens J, Fatima A, Miron P, Chin SF, Thomas G, Boyault S, Mariani O, Lakhani SR, van de Vijver M, van 't Veer L, Foekens J, Desmedt C, Sotiriou C, Tutt A, Caldas C, Reis-Filho JS, Aparicio SA, Salomon AV, Borresen-Dale AL, Richardson AL, Campbell PJ, Futreal PA, Stratton MR", "evidence": [ { "database": "dbSNP", "id": "rs368142383", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368142383" } ], "reference": [ { "type": "PubMed", "id": "22722201", "url": "https://glygen.org/publication/PubMed/22722201" } ] }, { "title": "Recurrent R-spondin fusions in colon cancer.", "journal": "Nature", "date": "2012", "authors": "Seshagiri S, Stawiski EW, Durinck S, Modrusan Z, Storm EE, Conboy CB, Chaudhuri S, Guan Y, Janakiraman V, Jaiswal BS, Guillory J, Ha C, Dijkgraaf GJ, Stinson J, Gnad F, Huntley MA, Degenhardt JD, Haverty PM, Bourgon R, Wang W, Koeppen H, Gentleman R, Starr TK, Zhang Z, Largaespada DA, Wu TD, de Sauvage FJ", "evidence": [ { "database": "dbSNP", "id": "rs781788150", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781788150" } ], "reference": [ { "type": "PubMed", "id": "22895193", "url": "https://glygen.org/publication/PubMed/22895193" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Expression of complementary DNA and genomic clones for carcinoembryonic antigen and nonspecific cross-reacting antigen in Chinese hamster ovary and mouse fibroblast cells and characterization of the membrane-expressed products.", "journal": "Cancer Res.", "date": "1990", "authors": "Hefta L J, Schrewe H, Thompson J A, Oikawa S, Nakazato H, Shively J E", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "2317824", "url": "https://glygen.org/publication/PubMed/2317824" } ] }, { "title": "Cloning of the complete gene for carcinoembryonic antigen: analysis of its promoter indicates a region conveying cell type-specific expression.", "journal": "Mol. Cell. Biol.", "date": "1990", "authors": "Schrewe H, Thompson J, Bona M, Hefta L J, Maruya A, Hassauer M, Shively J E, von Kleist S, Zimmermann W", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "2342461", "url": "https://glygen.org/publication/PubMed/2342461" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "A glycan-phosphatidylinositol-specific phospholipase D in human serum.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Davitz MA, Hereld D, Shak S, Krakow J, Englund PT, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "2443973", "url": "https://glygen.org/publication/PubMed/2443973" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Diverse oligomeric states of CEACAM IgV domains.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2015", "authors": "Bonsor DA, Gunther S, Beadenkopf R, Beckett D, Sundberg EJ", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "26483485", "url": "https://glygen.org/publication/PubMed/26483485" } ] }, { "title": "Cell adhesion activity of non-specific cross-reacting antigen (NCA) and carcinoembryonic antigen (CEA) expressed on CHO cell surface: homophilic and heterophilic adhesion.", "journal": "Biochemical and biophysical research communications", "date": "1989-10-16", "authors": "Oikawa S, Inuzuka C, Kuroki M, Matsuoka Y, Kosaki G, Nakazato H", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "2803308", "url": "https://glygen.org/publication/PubMed/2803308" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1071", "url": "https://glyconnect.expasy.org/browser/proteins/1071" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Isolation and characterization of cDNA clones encoding the human carcinoembryonic antigen reveal a highly conserved repeating structure.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Zimmermann W, Ortlieb B, Friedrich R, von Kleist S", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "3033671", "url": "https://glygen.org/publication/PubMed/3033671" } ] }, { "title": "Carcinoembryonic antigen family: characterization of cDNAs coding for NCA and CEA and suggestion of nonrandom sequence variation in their conserved loop-domains.", "journal": "Genomics", "date": "1988", "authors": "Barnett T, Goebel SJ, Nothdurft MA, Elting JJ", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "3220478", "url": "https://glygen.org/publication/PubMed/3220478" } ] }, { "title": "A case of COVID-19 lung infection first detected by [18F]FDG PET-CT.", "journal": "European journal of nuclear medicine and molecular imaging", "date": "2020", "authors": "Amini H, Divband G, Montahaei Z, Dehghani T, Kaviani H, Adinehpour Z, Akbarian Aghdam R, Rezaee A, Vali R", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32333071", "url": "https://glygen.org/publication/PubMed/32333071" } ] }, { "title": "Elevations of serum cancer biomarkers correlate with severity of COVID-19.", "journal": "Journal of medical virology", "date": "2020", "authors": "Wei X, Su J, Yang K, Wei J, Wan H, Cao X, Tan W, Wang H", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32347972", "url": "https://glygen.org/publication/PubMed/32347972" } ] }, { "title": "Tumor biomarkers predict clinical outcome of COVID-19 patients.", "journal": "The Journal of infection", "date": "2020", "authors": "He B, Zhong A, Wu Q, Liu X, Lin J, Chen C, He Y, Guo Y, Zhang M, Zhu P, Wu J, Wang C, Wang S, Xia X", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32504736", "url": "https://glygen.org/publication/PubMed/32504736" } ] }, { "title": "Prognostic value of carcinoembryonic antigen on outcome in patients with coronavirus disease 2019.", "journal": "The Journal of infection", "date": "2020", "authors": "Yu J, Yang Z, Zhou X, Wu D, Chen J, Zhang L, Tong L, Nie L", "evidence": [ { "database": "GlyGen", "id": "A0034", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32540459", "url": "https://glygen.org/publication/PubMed/32540459" } ] }, { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206).", "journal": "Cellular and molecular life sciences : CMLS", "date": "2021", "authors": "Stavenhagen K, Laan LC, Gao C, Mehta AY, Heimburg-Molinaro J, Glickman JN, van Die I, Cummings RD", "evidence": [ { "database": "UniCarbKB", "id": "P06731", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34089345", "url": "https://glygen.org/publication/PubMed/34089345" } ] }, { "title": "A phospholipase D specific for the phosphatidylinositol anchor of cell-surface proteins is abundant in plasma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Low MG, Prasad AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125" } ], "reference": [ { "type": "PubMed", "id": "3422494", "url": "https://glygen.org/publication/PubMed/3422494" } ] }, { "title": "CEACAM5 inhibits the lymphatic metastasis of head and neck squamous cell carcinoma by regulating epithelial-mesenchymal transition via inhibiting MDM2.", "journal": "Clinical science (London, England : 1979)", "date": "2022-11-30", "authors": "Wang Xudong, Li Yanshi, Pan Min, Lu Tao, Wang Min, Wang Zhihai, Liu Chuan, Hu Guohua", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ], "reference": [ { "type": "PubMed", "id": "36377775", "url": "https://glygen.org/publication/PubMed/36377775" } ] }, { "title": "Identification of CEACAM5 as a stemness-related inhibitory immune checkpoint in pancreatic cancer.", "journal": "BMC cancer", "date": "2022-12-09", "authors": "Shi Haojun, Tsang Yiusing, Yang Yisi", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ], "reference": [ { "type": "PubMed", "id": "36494785", "url": "https://glygen.org/publication/PubMed/36494785" } ] }, { "title": "Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Beauchemin N, Benchimol S, Cournoyer D, Fuks A, Stanners C P", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "3670312", "url": "https://glygen.org/publication/PubMed/3670312" } ] }, { "title": "Combination of CEACAM5, EpCAM and CK19 gene expressions in mediastinal lymph node micrometastasis is a prognostic factor for non-small cell lung cancer.", "journal": "Journal of cardiothoracic surgery", "date": "2023-06-13", "authors": "S\u00fcer Hande, Erus Suat, Cesur Ekin E, Yavuz \u00d6mer, A\u011fcao\u011flu Orhan, Bulutay P\u0131nar, \u00d6nder Tamer T, Tanju Serhan, Dilege \u015e\u00fckr\u00fc", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ], "reference": [ { "type": "PubMed", "id": "37312199", "url": "https://glygen.org/publication/PubMed/37312199" } ] }, { "title": "[Heterogeneity analysis of pancreatic cancer and identification of molecular subtypes of tumor cells based on CEACAM5, LGALS1 and CENPF gene expression].", "journal": "Nan fang yi ke da xue xue bao = Journal of Southern Medical University", "date": "2023-09-20", "authors": "Sun J, Lu P, Guan S, Liu S", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ], "reference": [ { "type": "PubMed", "id": "37814871", "url": "https://glygen.org/publication/PubMed/37814871" } ] }, { "title": "Detection and clinical significance of CEACAM5 methylation in colorectal cancer patients.", "journal": "Cancer science", "date": "2023-11-09", "authors": "Huang Sheng-Chieh, Chang Shih-Ching, Liao Tsai-Tsen, Yang Muh-Hwa", "evidence": [ { "database": "RefSeq", "id": "NP_001278413", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001278413" } ], "reference": [ { "type": "PubMed", "id": "37942534", "url": "https://glygen.org/publication/PubMed/37942534" } ] }, { "title": "Primary structure of human carcinoembryonic antigen (CEA) deduced from cDNA sequence.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1987", "authors": "Oikawa S, Nakazato H, Kosaki G", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "reference": [ { "type": "PubMed", "id": "3814146", "url": "https://glygen.org/publication/PubMed/3814146" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] } ], "pathway": [ { "id": "hsa:1048", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1048", "resource": "KEGG Pathway" }, { "id": "R-HSA-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" } ], "orthologs": [ { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP", "length": 419 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "gene_name": "CEACAM1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ", "length": 526 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P16573-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "gene_name": "Ceacam1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSPNKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK", "length": 519 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P31809-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 1", "gene_name": "Ceacam1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGGSDQRDLTEHKPSTSNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK", "length": 521 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 6", "gene_name": "CEACAM6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI", "length": 344 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSVTRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS", "length": 426 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTFTLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSLPVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSITVKVSDWILP", "length": 419 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSETASPQVTYAGPNTWFQEILLL", "length": 435 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTFTLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLWWMNGQSLPMTHSLQLSETNRTLYLFGVTNYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSLPVSPRVKRRIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNLYLSCFADSNPPAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP", "length": 419 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGPLSAPPCTQRITWKGLLLTALLLNFWNLPTTAQVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKGQMKDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLQLSKNKRTLFLFGVTKYTAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENLYLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGMESSKSMTVKVSAPSGTGHLPGLNPL", "length": 428 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q925P2-1", "protein_name": "Carcinoembryonic antigen-related cell adhesion molecule 2", "gene_name": "Ceacam2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHTLLLKSNITSNNSNPVEGDDSVSLTCDSYTDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELDSVTLTCLSKDRQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVIFDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKSRWGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK", "length": 520 }, "evidence": [ { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSYTLHIIMGGDENRGVTGHFTFTLYLETPKPSISSSKLNPREAMEAVSLTCDPETPDASYLWWMNGQSLPMSHRLQLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPFTLNLLPKLPKPYITINNLKPRENKDVLNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIPVSLAIGI", "length": 426 }, "evidence": [ { "id": "45933311", "url": "http://www.informatics.jax.org/homology/45933311", "database": "MGI" }, { "id": "45925926", "url": "http://www.informatics.jax.org/homology/45925926", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "homotypic cell-cell adhesion", "id": "GO:0034109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034109", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "homophilic cell adhesion via plasma membrane adhesion molecules", "id": "GO:0007156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007156", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules", "id": "GO:0007157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007157", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "negative regulation of myotube differentiation", "id": "GO:0010832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010832", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "negative regulation of anoikis", "id": "GO:2000811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000811", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "GPI anchor binding", "id": "GO:0034235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034235", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P06731", "url": "https://www.uniprot.org/uniprot/P06731" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 104, "end_pos": 106, "annotation": "n_glycosylation_sequon" }, { "start_pos": 115, "end_pos": 117, "annotation": "n_glycosylation_sequon" }, { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" }, { "start_pos": 182, "end_pos": 184, "annotation": "n_glycosylation_sequon" }, { "start_pos": 197, "end_pos": 199, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 208, "end_pos": 210, "annotation": "n_glycosylation_sequon" }, { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 274, "end_pos": 276, "annotation": "n_glycosylation_sequon" }, { "start_pos": 288, "end_pos": 290, "annotation": "n_glycosylation_sequon" }, { "start_pos": 292, "end_pos": 294, "annotation": "n_glycosylation_sequon" }, { "start_pos": 309, "end_pos": 311, "annotation": "n_glycosylation_sequon" }, { "start_pos": 330, "end_pos": 332, "annotation": "n_glycosylation_sequon" }, { "start_pos": 351, "end_pos": 353, "annotation": "n_glycosylation_sequon" }, { "start_pos": 360, "end_pos": 362, "annotation": "n_glycosylation_sequon" }, { "start_pos": 375, "end_pos": 377, "annotation": "n_glycosylation_sequon" }, { "start_pos": 432, "end_pos": 434, "annotation": "n_glycosylation_sequon" }, { "start_pos": 466, "end_pos": 468, "annotation": "n_glycosylation_sequon" }, { "start_pos": 480, "end_pos": 482, "annotation": "n_glycosylation_sequon" }, { "start_pos": 508, "end_pos": 510, "annotation": "n_glycosylation_sequon" }, { "start_pos": 529, "end_pos": 531, "annotation": "n_glycosylation_sequon" }, { "start_pos": 553, "end_pos": 555, "annotation": "n_glycosylation_sequon" }, { "start_pos": 560, "end_pos": 562, "annotation": "n_glycosylation_sequon" }, { "start_pos": 580, "end_pos": 582, "annotation": "n_glycosylation_sequon" }, { "start_pos": 612, "end_pos": 614, "annotation": "n_glycosylation_sequon" }, { "start_pos": 650, "end_pos": 652, "annotation": "n_glycosylation_sequon" }, { "start_pos": 665, "end_pos": 667, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Carcinoembryonic antigen (CEACAM5)", "biomarker_id": "A0034", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "11953875", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11953875" }, { "id": "12174919", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12174919" }, { "id": "21683503", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21683503" }, { "id": "32347972", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32347972" }, { "id": "32333071", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32333071" }, { "id": "32540459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32540459" }, { "id": "32504736", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32504736" }, { "id": "16033098", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16033098" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "decreased CEACAM5 level", "disease": { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "11953875", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11953875" } ] }, { "best_biomarker_type": "diagnostic", "status": "increased CEACAM5 level", "disease": { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "12174919", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12174919" } ] }, { "best_biomarker_type": "prognostic", "status": "increased CEACAM5 level", "disease": { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "21683503", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21683503" } ] }, { "best_biomarker_type": "monitoring", "status": "increased CEACAM5 level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32347972", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32347972" }, { "id": "32333071", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32333071" }, { "id": "32540459", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32540459" }, { "id": "32504736", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32504736" }, { "id": "10.2139/ssrn.3552854", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.2139/ssrn.3552854" } ] }, { "best_biomarker_type": "monitoring", "status": "increased CEACAM5 level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "16033098", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16033098" }, { "id": "32504736", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32504736" }, { "id": "32347972", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32347972" } ] } ] }, { "assessed_biomarker_entity": "Lung cancer CEACAM5, SART3, A1AT, RBP protein panel", "biomarker_id": "A0472", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "18065730", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18065730" } ], "instances": [ { "best_biomarker_type": "diagnostic", "status": "measured CEACAM5, SART3, A1AT, RBP level", "disease": { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "18065730", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18065730" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 104, 115, 152, 182, 197, 204, 208, 246, 256, 274, 288, 292, 309, 330, 351, 360, 375, 432, 466, 480, 508, 529, 553, 560, 580, 612, 650, 665 ], "o_linked_sites": [], "snv_sites": [ 35, 38, 46, 104, 106, 113, 115, 117, 154, 173, 182, 184, 197, 199, 206, 208, 210, 256, 258, 274, 276, 288, 290, 292, 309, 311, 330, 351, 353, 360, 375, 377, 382, 432, 433, 466, 468, 508, 529, 531, 553, 560, 566, 612, 613, 614, 621, 650, 668, 671 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 104, "end_pos": 106 }, { "start_pos": 115, "end_pos": 117 }, { "start_pos": 152, "end_pos": 154 }, { "start_pos": 182, "end_pos": 184 }, { "start_pos": 197, "end_pos": 199 }, { "start_pos": 204, "end_pos": 206 }, { "start_pos": 208, "end_pos": 210 }, { "start_pos": 246, "end_pos": 248 }, { "start_pos": 256, "end_pos": 258 }, { "start_pos": 274, "end_pos": 276 }, { "start_pos": 288, "end_pos": 290 }, { "start_pos": 292, "end_pos": 294 }, { "start_pos": 309, "end_pos": 311 }, { "start_pos": 330, "end_pos": 332 }, { "start_pos": 351, "end_pos": 353 }, { "start_pos": 360, "end_pos": 362 }, { "start_pos": 375, "end_pos": 377 }, { "start_pos": 432, "end_pos": 434 }, { "start_pos": 466, "end_pos": 468 }, { "start_pos": 480, "end_pos": 482 }, { "start_pos": 508, "end_pos": 510 }, { "start_pos": 529, "end_pos": 531 }, { "start_pos": 553, "end_pos": 555 }, { "start_pos": 560, "end_pos": 562 }, { "start_pos": 580, "end_pos": 582 }, { "start_pos": 612, "end_pos": 614 }, { "start_pos": 650, "end_pos": 652 }, { "start_pos": 665, "end_pos": 667 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 259 }, { "field": "total_sites", "count": 29 }, { "field": "n_linked_glycans", "count": 163 }, { "field": "n_linked_glycan_sites", "count": 47 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 28 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 28 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 231 }, { "field": "total_sites", "count": 19 }, { "field": "n_linked_glycans", "count": 163 }, { "field": "n_linked_glycan_sites", "count": 19 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 72 }, { "field": "total_sites", "count": 50 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 72 }, { "field": "total_sites", "count": 50 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }