{ "uniprot_canonical_ac": "P06702-1", "uniprot_ac": "P06702", "uniprot_id": "S10A9_HUMAN", "mass": { "chemical_mass": 13242.0, "monoisotopic_mass": 13242.0 }, "refseq": { "ac": "NP_002956", "name": "protein S100-A9", "summary": "The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, "gene_names": [ { "name": "S100A9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06702", "id": "P06702" }, { "name": "60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14; S100-A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956", "id": "NP_002956" }, { "name": "CAGB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06702", "id": "P06702" }, { "name": "CFAG", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06702", "id": "P06702" }, { "name": "MRP14", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P06702", "id": "P06702" }, { "name": "S100A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956", "id": "NP_002956" } ], "protein_names": [ { "name": "Protein S100-A9", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06702" }, { "name": "Calgranulin-B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "Calprotectin L1H subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "Leukocyte L1 complex heavy chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "MRP-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "Migration inhibitory factor-related protein 14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "S100 calcium-binding protein A9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "calgranulin B; MRP-14; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956", "id": "NP_002956" }, { "name": "p14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06702" }, { "name": "protein S100-A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956", "id": "NP_002956" } ], "function": [ { "annotation": "CD74 Promotes a Pro-Inflammatory Tumor Microenvironment by Inducing S100A8 and S100A9 Secretion in Pancreatic Cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "37629174", "url": "https://glygen.org/publication/PubMed/37629174" } ] }, { "annotation": "Calprotectin, an antimicrobial peptide with antibacterial activity inhibits the growth of Borrelia burgdorferi.", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "12874352", "url": "https://glygen.org/publication/PubMed/12874352" } ] }, { "annotation": "Nuclear proinflammatory cytokine S100A9 enhances expression of human papillomavirus oncogenes via transcription factor TEAD1. Erratum:[J Virol. 2023 Nov 30;97(11):e0149923. PMID: 37882517]", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "37578237", "url": "https://glygen.org/publication/PubMed/37578237" } ] }, { "annotation": "S100A8 and S100A9 in Hematologic Malignancies: From Development to Therapy. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "37686186", "url": "https://glygen.org/publication/PubMed/37686186" } ] }, { "annotation": "S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:20103766, PubMed:8423249, PubMed:16258195, PubMed:19122197, PubMed:21325622). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (PubMed:12626582, PubMed:15331440, PubMed:20103766). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (PubMed:8423249, PubMed:16258195, PubMed:19122197). The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed:15331440, PubMed:21325622). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (PubMed:15642721, PubMed:22808130). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed:8423249, PubMed:19534726). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (PubMed:15598812, PubMed:21487906). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed:19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed:19402754, PubMed:22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (PubMed:19087201). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (PubMed:19935772). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (PubMed:22363402). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (PubMed:22489132, PubMed:21912088). Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread (PubMed:16258195). Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3 (PubMed:25417112). The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (PubMed:25417112).", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702#function" }, { "database": "PubMed", "id": "15331440", "url": "https://glygen.org/publication/PubMed/15331440" }, { "database": "PubMed", "id": "15598812", "url": "https://glygen.org/publication/PubMed/15598812" }, { "database": "PubMed", "id": "15642721", "url": "https://glygen.org/publication/PubMed/15642721" }, { "database": "PubMed", "id": "22363402", "url": "https://glygen.org/publication/PubMed/22363402" }, { "database": "PubMed", "id": "22804476", "url": "https://glygen.org/publication/PubMed/22804476" }, { "database": "PubMed", "id": "20103766", "url": "https://glygen.org/publication/PubMed/20103766" }, { "database": "PubMed", "id": "21487906", "url": "https://glygen.org/publication/PubMed/21487906" }, { "database": "PubMed", "id": "19402754", "url": "https://glygen.org/publication/PubMed/19402754" }, { "database": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" }, { "database": "PubMed", "id": "22808130", "url": "https://glygen.org/publication/PubMed/22808130" }, { "database": "PubMed", "id": "8423249", "url": "https://glygen.org/publication/PubMed/8423249" }, { "database": "PubMed", "id": "12626582", "url": "https://glygen.org/publication/PubMed/12626582" }, { "database": "PubMed", "id": "19935772", "url": "https://glygen.org/publication/PubMed/19935772" }, { "database": "PubMed", "id": "21325622", "url": "https://glygen.org/publication/PubMed/21325622" }, { "database": "PubMed", "id": "19122197", "url": "https://glygen.org/publication/PubMed/19122197" }, { "database": "PubMed", "id": "19087201", "url": "https://glygen.org/publication/PubMed/19087201" }, { "database": "PubMed", "id": "16258195", "url": "https://glygen.org/publication/PubMed/16258195" }, { "database": "PubMed", "id": "21912088", "url": "https://glygen.org/publication/PubMed/21912088" }, { "database": "PubMed", "id": "22489132", "url": "https://glygen.org/publication/PubMed/22489132" }, { "database": "PubMed", "id": "19534726", "url": "https://glygen.org/publication/PubMed/19534726" } ] }, { "annotation": "The Stabilization of S100A9 Structure by Calcium Inhibits the Formation of Amyloid Fibrils. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "37686007", "url": "https://glygen.org/publication/PubMed/37686007" } ] }, { "annotation": "The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ] }, { "annotation": "Transcriptomic Analysis of Retinal Gene in Experimental Retinal Detachment Rats and Exploration of S100A9 and TLR4 in Human Vitreous.", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" }, { "database": "PubMed", "id": "37846082", "url": "https://glygen.org/publication/PubMed/37846082" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 36, "end_pos": 36, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of resistance to bacterial invasion; when associated with Q-78.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "19122197", "url": "https://glygen.org/publication/PubMed/19122197" } ] }, { "start_pos": 3, "end_pos": 3, "sequence_org": "C", "sequence_mut": "A", "comment": "Disrupts interaction with NOS2 and inhibits LDL(ox)-induced GAPDHS-nitrosylation; no effect on interaction with S100A8.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "M", "sequence_mut": "A", "comment": "Loss of antifungal activity.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "19087201", "url": "https://glygen.org/publication/PubMed/19087201" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "E", "sequence_mut": "Q", "comment": "Loss of resistance to bacterial invasion; when associated with Q-36.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "19122197", "url": "https://glygen.org/publication/PubMed/19122197" } ] }, { "start_pos": 81, "end_pos": 81, "sequence_org": "M", "sequence_mut": "A", "comment": "No effect on antifungal activity.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "19087201", "url": "https://glygen.org/publication/PubMed/19087201" } ] }, { "start_pos": 83, "end_pos": 83, "sequence_org": "M", "sequence_mut": "A", "comment": "Loss of antifungal activity.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "19087201", "url": "https://glygen.org/publication/PubMed/19087201" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "78.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "83.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "62.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "52.02", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "83.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "90.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "90.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06702", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06702" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "common_name": "Human" } ], "gene": [ { "name": "S100A9", "url": "https://www.uniprot.org/uniprot/P06702", "locus": { "chromosome": "1", "start_pos": 153361023, "end_pos": 153357854, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000163220", "url": "https://www.ensembl.org/id/ENSG00000163220" } ] } } ], "crossref": [ { "id": "ENSG00000163220", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000163220", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05030", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05030", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4296265", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4296265", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "S100A9", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=S100A9", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6280", "url": "https://www.ncbi.nlm.nih.gov/gene/6280", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10499", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10499", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P06702", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06702*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001751", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001751", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013787", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013787", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6280", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6280", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "123886", "url": "http://www.omim.org/entry/123886", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06702", "url": "https://www.nextprot.org/entry/NX_P06702", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P06702", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06702", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "HEEMHKT", "url": "https://omabrowser.org/oma/group/HEEMHKT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4607525at2759", "url": "http://www.orthodb.org/?query=4607525at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639:SF79", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639:SF79", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1IRJ", "url": "https://www.rcsb.org/structure/1IRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XK4", "url": "https://www.rcsb.org/structure/1XK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GGF", "url": "https://www.rcsb.org/structure/4GGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XJK", "url": "https://www.rcsb.org/structure/4XJK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5I8N", "url": "https://www.rcsb.org/structure/5I8N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W1F", "url": "https://www.rcsb.org/structure/5W1F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DS2", "url": "https://www.rcsb.org/structure/6DS2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QUV", "url": "https://www.rcsb.org/structure/7QUV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7UI5", "url": "https://www.rcsb.org/structure/7UI5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01023", "url": "http://pfam.xfam.org/family/PF01023", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06702", "url": "https://pharos.nih.gov/targets/P06702", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P06702", "url": "http://purl.obolibrary.org/obo/PR_P06702", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06702-1", "url": "https://www.uniprot.org/uniprot/P06702-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP", "length": 114, "header": "sp|P06702-1|S10A9_HUMAN Isoform 1 of Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1 CANONICAL=P06702-1" }, "isoforms": [ { "isoform_ac": "P06702-1", "url": "", "sequence": { "sequence": "MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP", "length": 114, "header": "sp|P06702-1|S10A9_HUMAN Isoform 1 of Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1 CANONICAL=P06702-1" }, "locus": { "chromosome": "1", "start_pos": 153360835, "end_pos": 153358284, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000368738.4", "url": "https://www.ensembl.org/id/ENST00000368738.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000357727.3", "url": "https://www.ensembl.org/id/ENSP00000357727.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P06702", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06702" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" } ] } ], "phosphorylation": [ { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "Q16539-1", "kinase_gene_name": "MAPK14", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" }, { "database": "PubMed", "id": "15905572", "url": "https://glygen.org/publication/PubMed/15905572" } ], "site_lbl": "Thr113" }, { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK14", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "2478889", "url": "https://glygen.org/publication/PubMed/2478889" }, { "database": "phospho.ELM", "id": "P06702", "url": "http://phospho.elm.eu.org/byAccession/P06702.html" }, { "database": "PubMed", "id": "15905572", "url": "https://glygen.org/publication/PubMed/15905572" }, { "database": "PubMed", "id": "22230807", "url": "https://glygen.org/publication/PubMed/22230807" }, { "database": "PubMed", "id": "29204146", "url": "https://glygen.org/publication/PubMed/29204146" }, { "database": "PubMed", "id": "18318008", "url": "https://glygen.org/publication/PubMed/18318008" }, { "database": "PubMed", "id": "19367720", "url": "https://glygen.org/publication/PubMed/19367720" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "15331440", "url": "https://glygen.org/publication/PubMed/15331440" } ], "site_lbl": "Thr113" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.", "journal": "Biochemistry", "date": "1999", "authors": "Brodersen DE, Nyborg J, Kjeldgaard M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "10026247", "url": "https://glygen.org/publication/PubMed/10026247" } ] }, { "title": "Deficiency of the hematopoietic cell-specific Rho family GTPase Rac2 is characterized by abnormalities in neutrophil function and host defense.", "journal": "Immunity", "date": "1999", "authors": "Roberts AW, Kim C, Zhen L, Lowe JB, Kapur R, Petryniak B, Spaetti A, Pollock JD, Borneo JB, Bradford GB, Atkinson SJ, Dinauer MC, Williams DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "10072071", "url": "https://glygen.org/publication/PubMed/10072071" } ] }, { "title": "Priming of human neutrophil respiratory burst by granulocyte/macrophage colony-stimulating factor (GM-CSF) involves partial phosphorylation of p47(phox).", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Dang PM, Dewas C, Gaudry M, Fay M, Pedruzzi E, Gougerot-Pocidalo MA, El Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "10400704", "url": "https://glygen.org/publication/PubMed/10400704" } ] }, { "title": "Tetratricopeptide repeat (TPR) motifs of p67(phox) participate in interaction with the small GTPase Rac and activation of the phagocyte NADPH oxidase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Koga H, Terasawa H, Nunoi H, Takeshige K, Inagaki F, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "10455184", "url": "https://glygen.org/publication/PubMed/10455184" } ] }, { "title": "ECSIT is an evolutionarily conserved intermediate in the Toll/IL-1 signal transduction pathway.", "journal": "Genes & development", "date": "1999", "authors": "Kopp E, Medzhitov R, Carothers J, Xiao C, Douglas I, Janeway CA, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "10465784", "url": "https://glygen.org/publication/PubMed/10465784" } ] }, { "title": "Structure of the TPR domain of p67phox in complex with Rac.GTP.", "journal": "Molecular cell", "date": "2000", "authors": "Lapouge K, Smith SJ, Walker PA, Gamblin SJ, Smerdon SJ, Rittinger K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "11090627", "url": "https://glygen.org/publication/PubMed/11090627" } ] }, { "title": "Rac2 is an essential regulator of neutrophil nicotinamide adenine dinucleotide phosphate oxidase activation in response to specific signaling pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Kim C, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "11145705", "url": "https://glygen.org/publication/PubMed/11145705" } ] }, { "title": "Fibrinogen stimulates macrophage chemokine secretion through toll-like receptor 4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Smiley ST, King JA, Hancock WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11509636", "url": "https://glygen.org/publication/PubMed/11509636" } ] }, { "title": "Mal (MyD88-adapter-like) is required for Toll-like receptor-4 signal transduction.", "journal": "Nature", "date": "2001", "authors": "Fitzgerald KA, Palsson-McDermott EM, Bowie AG, Jefferies CA, Mansell AS, Brady G, Brint E, Dunne A, Gray P, Harte MT, McMurray D, Smith DE, Sims JE, Bird TA, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11544529", "url": "https://glygen.org/publication/PubMed/11544529" } ] }, { "title": "The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2001", "authors": "Streichert T, Ebrahimnejad A, Ganzer S, Flayeh R, Wagener C, Brummer J", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "11708798", "url": "https://glygen.org/publication/PubMed/11708798" } ] }, { "title": "Surfactant protein A inhibits peptidoglycan-induced tumor necrosis factor-alpha secretion in U937 cells and alveolar macrophages by direct interaction with toll-like receptor 2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Murakami S, Iwaki D, Mitsuzawa H, Sano H, Takahashi H, Voelker DR, Akino T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11724772", "url": "https://glygen.org/publication/PubMed/11724772" } ] }, { "title": "The crystal structure of human MRP14 (S100A9), a Ca(2+)-dependent regulator protein in inflammatory process.", "journal": "J. Mol. Biol.", "date": "2002", "authors": "Itou H, Yao M, Fujita I, Watanabe N, Suzuki M, Nishihira J, Tanaka I", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "11851337", "url": "https://glygen.org/publication/PubMed/11851337" } ] }, { "title": "IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Li S, Strelow A, Fontana EJ, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "11960013", "url": "https://glygen.org/publication/PubMed/11960013" } ] }, { "title": "Phosphorylation of p47phox sites by PKC alpha, beta II, delta, and zeta: effect on binding to p22phox and on NADPH oxidase activation.", "journal": "Biochemistry", "date": "2002", "authors": "Fontayne A, Dang PM, Gougerot-Pocidalo MA, El-Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "12056906", "url": "https://glygen.org/publication/PubMed/12056906" } ] }, { "title": "Release of chromatin protein HMGB1 by necrotic cells triggers inflammation.", "journal": "Nature", "date": "2002", "authors": "Scaffidi P, Misteli T, Bianchi ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12110890", "url": "https://glygen.org/publication/PubMed/12110890" } ] }, { "title": "Identification of threonine 66 as a functionally critical residue of the interleukin-1 receptor-associated kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ross K, Yang L, Dower S, Volpe F, Guesdon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12138165", "url": "https://glygen.org/publication/PubMed/12138165" } ] }, { "title": "Distinct molecular mechanism for initiating TRAF6 signalling.", "journal": "Nature", "date": "2002", "authors": "Ye H, Arron JR, Lamothe B, Cirilli M, Kobayashi T, Shevde NK, Segal D, Dzivenu OK, Vologodskaia M, Yim M, Du K, Singh S, Pike JW, Darnay BG, Choi Y, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12140561", "url": "https://glygen.org/publication/PubMed/12140561" } ] }, { "title": "Protective role of phospholipid oxidation products in endotoxin-induced tissue damage.", "journal": "Nature", "date": "2002", "authors": "Bochkov VN, Kadl A, Huber J, Gruber F, Binder BR, Leitinger N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12214235", "url": "https://glygen.org/publication/PubMed/12214235" } ] }, { "title": "IRAK-4 as the central TIR signaling mediator in innate immunity.", "journal": "Trends in immunology", "date": "2002", "authors": "Suzuki N, Suzuki S, Yeh WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12297423", "url": "https://glygen.org/publication/PubMed/12297423" } ] }, { "title": "Essential role for TIRAP in activation of the signalling cascade shared by TLR2 and TLR4.", "journal": "Nature", "date": "2002", "authors": "Yamamoto M, Sato S, Hemmi H, Sanjo H, Uematsu S, Kaisho T, Hoshino K, Takeuchi O, Kobayashi M, Fujita T, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447441", "url": "https://glygen.org/publication/PubMed/12447441" } ] }, { "title": "The adaptor molecule TIRAP provides signalling specificity for Toll-like receptors.", "journal": "Nature", "date": "2002", "authors": "Horng T, Barton GM, Flavell RA, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12447442", "url": "https://glygen.org/publication/PubMed/12447442" } ] }, { "title": "Proinflammatory activities of S100: proteins S100A8, S100A9, and S100A8/A9 induce neutrophil chemotaxis and adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Ryckman C, Vandal K, Rouleau P, Talbot M, Tessier PA", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "12626582", "url": "https://glygen.org/publication/PubMed/12626582" } ] }, { "title": "Pyogenic bacterial infections in humans with IRAK-4 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Picard C, Puel A, Bonnet M, Ku CL, Bustamante J, Yang K, Soudais C, Dupuis S, Feinberg J, Fieschi C, Elbim C, Hitchcock R, Lammas D, Davies G, Al-Ghonaium A, Al-Rayes H, Al-Jumaah S, Al-Hajjar S, Al-Mohsen IZ, Frayha HH, Rucker R, Hawn TR, Aderem A, Tufenkeji H, Haraguchi S, Day NK, Good RA, Gougerot-Pocidalo MA, Ozinsky A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "12637671", "url": "https://glygen.org/publication/PubMed/12637671" } ] }, { "title": "Novel human homologues of p47phox and p67phox participate in activation of superoxide-producing NADPH oxidases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Takeya R, Ueno N, Kami K, Taura M, Kohjima M, Izaki T, Nunoi H, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "12716910", "url": "https://glygen.org/publication/PubMed/12716910" } ] }, { "title": "Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jefferies CA, Doyle S, Brunner C, Dunne A, Brint E, Wietek C, Walch E, Wirth T, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "12724322", "url": "https://glygen.org/publication/PubMed/12724322" } ] }, { "title": "Direct binding of Toll-like receptor 2 to zymosan, and zymosan-induced NF-kappa B activation and TNF-alpha secretion are down-regulated by lung collectin surfactant protein A.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Sato M, Sano H, Iwaki D, Kudo K, Konishi M, Takahashi H, Takahashi T, Imaizumi H, Asai Y, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12817025", "url": "https://glygen.org/publication/PubMed/12817025" } ] }, { "title": "Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.", "journal": "Electrophoresis", "date": "1992", "authors": "Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "1286667", "url": "https://glygen.org/publication/PubMed/1286667" } ] }, { "title": "Calprotectin, an abundant cytosolic protein from human polymorphonuclear leukocytes, inhibits the growth of Borrelia burgdorferi.", "journal": "Infection and immunity", "date": "2003", "authors": "Lusitani D, Malawista SE, Montgomery RR", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "12874352", "url": "https://glygen.org/publication/PubMed/12874352" } ] }, { "title": "TNF-alpha induces phosphorylation of p47(phox) in human neutrophils: partial phosphorylation of p47phox is a common event of priming of human neutrophils by TNF-alpha and granulocyte-macrophage colony-stimulating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Dewas C, Dang PM, Gougerot-Pocidalo MA, El-Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "14530365", "url": "https://glygen.org/publication/PubMed/14530365" } ] }, { "title": "Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kollewe C, Mackensen AC, Neumann D, Knop J, Cao P, Li S, Wesche H, Martin MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "14625308", "url": "https://glygen.org/publication/PubMed/14625308" } ] }, { "title": "Structure of human diferric lactoferrin refined at 2.2 A resolution.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1995", "authors": "Haridas M, Anderson BF, Baker EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "15299793", "url": "https://glygen.org/publication/PubMed/15299793" } ] }, { "title": "MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes.", "journal": "Blood", "date": "2004", "authors": "Vogl T, Ludwig S, Goebeler M, Strey A, Thorey IS, Reichelt R, Foell D, Gerke V, Manitz MP, Nacken W, Werner S, Sorg C, Roth J", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "15331440", "url": "https://glygen.org/publication/PubMed/15331440" } ] }, { "title": "Toll-like receptors in innate immunity.", "journal": "International immunology", "date": "2005", "authors": "Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15585605", "url": "https://glygen.org/publication/PubMed/15585605" } ] }, { "title": "Protein kinase Cdelta regulates p67phox phosphorylation in human monocytes.", "journal": "Journal of leukocyte biology", "date": "2005", "authors": "Zhao X, Xu B, Bhattacharjee A, Oldfield CM, Wientjes FB, Feldman GM, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "15591124", "url": "https://glygen.org/publication/PubMed/15591124" } ] }, { "title": "Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells.", "journal": "Blood", "date": "2005-04-01", "authors": "Viemann Dorothee, Strey Anke, Janning Annette, Jurk Kerstin, Klimmek Kerstin, Vogl Thomas, Hirono Keiichi, Ichida Fukiko, Foell Dirk, Kehrel Beate, Gerke Volker, Sorg Clemens, Roth Johannes", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "15598812", "url": "https://glygen.org/publication/PubMed/15598812" } ] }, { "title": "The arachidonic acid-binding protein S100A8/A9 promotes NADPH oxidase activation by interaction with p67phox and Rac-2.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2005-03", "authors": "Kerkhoff Claus, Nacken Wolfgang, Benedyk Malgorzata, Dagher Marie Claire, Sopalla Claudia, Doussiere Jacques", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "15642721", "url": "https://glygen.org/publication/PubMed/15642721" } ] }, { "title": "The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox-dependent manner: its regulation by oxidase organizers and activators.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ueno N, Takeya R, Miyano K, Kikuchi H, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "15824103", "url": "https://glygen.org/publication/PubMed/15824103" } ] }, { "title": "Myeloid-related protein-14 is a p38 MAPK substrate in human neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Lominadze G, Rane MJ, Merchant M, Cai J, Ward RA, McLeish KR", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "15905572", "url": "https://glygen.org/publication/PubMed/15905572" } ] }, { "title": "Bruton's Tyrosine Kinase is involved in innate and adaptive immunity.", "journal": "Histology and histopathology", "date": "2005", "authors": "Brunner C, Muller B, Wirth T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "15944945", "url": "https://glygen.org/publication/PubMed/15944945" } ] }, { "title": "A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Rao N, Nguyen S, Ngo K, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16024789", "url": "https://glygen.org/publication/PubMed/16024789" } ] }, { "title": "Surfactant proteins SP-A and SP-D: structure, function and receptors.", "journal": "Molecular immunology", "date": "2006", "authors": "Kishore U, Greenhough TJ, Waters P, Shrive AK, Ghai R, Kamran MF, Bernal AL, Reid KB, Madan T, Chakraborty T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16213021", "url": "https://glygen.org/publication/PubMed/16213021" } ] }, { "title": "Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity.", "journal": "Mediators of inflammation", "date": "2005-10-24", "authors": "Nakatani Yuichi, Yamazaki Masatoshi, Chazin Walter J, Yui Satoru", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "16258195", "url": "https://glygen.org/publication/PubMed/16258195" } ] }, { "title": "Molecular interaction of NADPH oxidase 1 with betaPix and Nox Organizer 1.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Park HS, Park D, Bae YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "16329988", "url": "https://glygen.org/publication/PubMed/16329988" } ] }, { "title": "MyD88 adapter-like (Mal) is phosphorylated by Bruton's tyrosine kinase during TLR2 and TLR4 signal transduction.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gray P, Dunne A, Brikos C, Jefferies CA, Doyle SL, O'Neill LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16439361", "url": "https://glygen.org/publication/PubMed/16439361" } ] }, { "title": "Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ueyama T, Geiszt M, Leto TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "16507994", "url": "https://glygen.org/publication/PubMed/16507994" } ] }, { "title": "Regulation of phagocyte oxygen radical production by the GTP-binding protein Rac 2.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Knaus UG, Heyworth PG, Evans T, Curnutte JT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "1660188", "url": "https://glygen.org/publication/PubMed/1660188" } ] }, { "title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "16636067", "url": "https://glygen.org/publication/PubMed/16636067" } ] }, { "title": "Phosphoinositide-mediated adaptor recruitment controls Toll-like receptor signaling.", "journal": "Cell", "date": "2006", "authors": "Kagan JC, Medzhitov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "16751103", "url": "https://glygen.org/publication/PubMed/16751103" } ] }, { "title": "Surfactant protein A directly interacts with TLR4 and MD-2 and regulates inflammatory cellular response. Importance of supratrimeric oligomerization.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yamada C, Sano H, Shimizu T, Mitsuzawa H, Nishitani C, Himi T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16754682", "url": "https://glygen.org/publication/PubMed/16754682" } ] }, { "title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Miyano K, Ueno N, Takeya R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "16762923", "url": "https://glygen.org/publication/PubMed/16762923" } ] }, { "title": "A specific p47phox -serine phosphorylated by convergent MAPKs mediates neutrophil NADPH oxidase priming at inflammatory sites.", "journal": "The Journal of clinical investigation", "date": "2006", "authors": "Dang PM, Stensballe A, Boussetta T, Raad H, Dewas C, Kroviarski Y, Hayem G, Jensen ON, Gougerot-Pocidalo MA, El-Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "16778989", "url": "https://glygen.org/publication/PubMed/16778989" } ] }, { "title": "Human pulmonary surfactant protein D binds the extracellular domains of Toll-like receptors 2 and 4 through the carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.", "journal": "Biochemistry", "date": "2006", "authors": "Ohya M, Nishitani C, Sano H, Yamada C, Mitsuzawa H, Shimizu T, Saito T, Smith K, Crouch E, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16834340", "url": "https://glygen.org/publication/PubMed/16834340" } ] }, { "title": "The extracellular release of HMGB1 during apoptotic cell death.", "journal": "American journal of physiology. Cell physiology", "date": "2006", "authors": "Bell CW, Jiang W, Reich CF 3rd, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16855214", "url": "https://glygen.org/publication/PubMed/16855214" } ] }, { "title": "HMGB1 signals through toll-like receptor (TLR) 4 and TLR2.", "journal": "Shock (Augusta, Ga.)", "date": "2006", "authors": "Yu M, Wang H, Ding A, Golenbock DT, Latz E, Czura CJ, Fenton MJ, Tracey KJ, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16878026", "url": "https://glygen.org/publication/PubMed/16878026" } ] }, { "title": "Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Cheng H, Addona T, Keshishian H, Dahlstrand E, Lu C, Dorsch M, Li Z, Wang A, Ocain TD, Li P, Parsons TF, Jaffee B, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17141195", "url": "https://glygen.org/publication/PubMed/17141195" } ] }, { "title": "Essential role of IRAK-4 protein and its kinase activity in Toll-like receptor-mediated immune responses but not in TCR signaling.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Kawagoe T, Sato S, Jung A, Yamamoto M, Matsui K, Kato H, Uematsu S, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17485511", "url": "https://glygen.org/publication/PubMed/17485511" } ] }, { "title": "The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Korndorfer IP, Brueckner F, Skerra A", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "17553524", "url": "https://glygen.org/publication/PubMed/17553524" } ] }, { "title": "Role of the small GTPase Rac in p22phox-dependent NADPH oxidases.", "journal": "Biochimie", "date": "2007", "authors": "Miyano K, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "17583407", "url": "https://glygen.org/publication/PubMed/17583407" } ] }, { "title": "A dimer of the Toll-like receptor 4 cytoplasmic domain provides a specific scaffold for the recruitment of signalling adaptor proteins.", "journal": "PloS one", "date": "2007", "authors": "Nunez Miguel R, Wong J, Westoll JF, Brooks HJ, O'Neill LA, Gay NJ, Bryant CE, Monie TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17726518", "url": "https://glygen.org/publication/PubMed/17726518" } ] }, { "title": "Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.", "journal": "Nature medicine", "date": "2007", "authors": "Vogl T, Tenbrock K, Ludwig S, Leukert N, Ehrhardt C, van Zoelen MA, Nacken W, Foell D, van der Poll T, Sorg C, Roth J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "17767165", "url": "https://glygen.org/publication/PubMed/17767165" } ] }, { "title": "IRAK-2 participates in multiple toll-like receptor signaling pathways to NFkappaB via activation of TRAF6 ubiquitination.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Keating SE, Maloney GM, Moran EM, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17878161", "url": "https://glygen.org/publication/PubMed/17878161" } ] }, { "title": "TLR9 activation induces normal neutrophil responses in a child with IRAK-4 deficiency: involvement of the direct PI3K pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Hoarau C, Gerard B, Lescanne E, Henry D, Francois S, Lacapere JJ, El Benna J, Dang PM, Grandchamp B, Lebranchu Y, Gougerot-Pocidalo MA, Elbim C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17878374", "url": "https://glygen.org/publication/PubMed/17878374" } ] }, { "title": "IRAK1: a critical signaling mediator of innate immunity.", "journal": "Cellular signalling", "date": "2008", "authors": "Gottipati S, Rao NL, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "17890055", "url": "https://glygen.org/publication/PubMed/17890055" } ] }, { "title": "Selective predisposition to bacterial infections in IRAK-4-deficient children: IRAK-4-dependent TLRs are otherwise redundant in protective immunity.", "journal": "The Journal of experimental medicine", "date": "2007", "authors": "Ku CL, von Bernuth H, Picard C, Zhang SY, Chang HH, Yang K, Chrabieh M, Issekutz AC, Cunningham CK, Gallin J, Holland SM, Roifman C, Ehl S, Smart J, Tang M, Barrat FJ, Levy O, McDonald D, Day-Good NK, Miller R, Takada H, Hara T, Al-Hajjar S, Al-Ghonaium A, Speert D, Sanlaville D, Li X, Geissmann F, Vivier E, Marodi L, Garty BZ, Chapel H, Rodriguez-Gallego C, Bossuyt X, Abel L, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "17893200", "url": "https://glygen.org/publication/PubMed/17893200" } ] }, { "title": "Tyrosine phosphorylation of MyD88 adapter-like (Mal) is critical for signal transduction and blocked in endotoxin tolerance.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Piao W, Song C, Chen H, Wahl LM, Fitzgerald KA, O'Neill LA, Medvedev AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070880", "url": "https://glygen.org/publication/PubMed/18070880" } ] }, { "title": "TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Muroi M, Tanamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18070982", "url": "https://glygen.org/publication/PubMed/18070982" } ] }, { "title": "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.", "journal": "Proteomics", "date": "2008", "authors": "Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "18318008", "url": "https://glygen.org/publication/PubMed/18318008" } ] }, { "title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "18347018", "url": "https://glygen.org/publication/PubMed/18347018" } ] }, { "title": "High mobility group box 1 protein binding to lipopolysaccharide facilitates transfer of lipopolysaccharide to CD14 and enhances lipopolysaccharide-mediated TNF-alpha production in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Youn JH, Oh YJ, Kim ES, Choi JE, Shin JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18354232", "url": "https://glygen.org/publication/PubMed/18354232" } ] }, { "title": "Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.", "journal": "Nature immunology", "date": "2008", "authors": "Kawagoe T, Sato S, Matsushita K, Kato H, Matsui K, Kumagai Y, Saitoh T, Kawai T, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18438411", "url": "https://glygen.org/publication/PubMed/18438411" } ] }, { "title": "Oxidized phospholipid inhibition of toll-like receptor (TLR) signaling is restricted to TLR2 and TLR4: roles for CD14, LPS-binding protein, and MD2 as targets for specificity of inhibition.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Erridge C, Kennedy S, Spickett CM, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18559343", "url": "https://glygen.org/publication/PubMed/18559343" } ] }, { "title": "Pyogenic bacterial infections in humans with MyD88 deficiency.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "von Bernuth H, Picard C, Jin Z, Pankla R, Xiao H, Ku CL, Chrabieh M, Mustapha IB, Ghandil P, Camcioglu Y, Vasconcelos J, Sirvent N, Guedes M, Vitor AB, Herrero-Mata MJ, Arostegui JI, Rodrigo C, Alsina L, Ruiz-Ortiz E, Juan M, Fortuny C, Yague J, Anton J, Pascal M, Chang HH, Janniere L, Rose Y, Garty BZ, Chapel H, Issekutz A, Marodi L, Rodriguez-Gallego C, Banchereau J, Abel L, Li X, Chaussabel D, Puel A, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "18669862", "url": "https://glygen.org/publication/PubMed/18669862" } ] }, { "title": "Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.", "journal": "Cell", "date": "2008", "authors": "Suzuki K, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "18692471", "url": "https://glygen.org/publication/PubMed/18692471" } ] }, { "title": "Interaction between S100A8/A9 and annexin A6 is involved in the calcium-induced cell surface exposition of S100A8/A9.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Bode G\u00fcnther, L\u00fcken Aloys, Kerkhoff Claus, Roth Johannes, Ludwig Stephan, Nacken Wolfgang", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "18786929", "url": "https://glygen.org/publication/PubMed/18786929" } ] }, { "title": "Assembly of oligomeric death domain complexes during Toll receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Moncrieffe MC, Grossmann JG, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "18829464", "url": "https://glygen.org/publication/PubMed/18829464" } ] }, { "title": "Pulmonary surfactant protein D inhibits lipopolysaccharide (LPS)-induced inflammatory cell responses by altering LPS binding to its receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yamazoe M, Nishitani C, Takahashi M, Katoh T, Ariki S, Shimizu T, Mitsuzawa H, Sawada K, Voelker DR, Takahashi H, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18990700", "url": "https://glygen.org/publication/PubMed/18990700" } ] }, { "title": "Substitution of methionine 63 or 83 in S100A9 and cysteine 42 in S100A8 abrogate the antifungal activities of S100A8/A9: potential role for oxidative regulation.", "journal": "FEMS immunology and medical microbiology", "date": "2009", "authors": "Sroussi HY, Kohler GA, Agabian N, Villines D, Palefsky JM", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19087201", "url": "https://glygen.org/publication/PubMed/19087201" } ] }, { "title": "Multi-hit inhibition of circulating and cell-associated components of the toll-like receptor 4 pathway by oxidized phospholipids.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "von Schlieffen E, Oskolkova OV, Schabbauer G, Gruber F, Bluml S, Genest M, Kadl A, Marsik C, Knapp S, Chow J, Leitinger N, Binder BR, Bochkov VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "19112167", "url": "https://glygen.org/publication/PubMed/19112167" } ] }, { "title": "Calprotectin S100A9 calcium-binding loops I and II are essential for keratinocyte resistance to bacterial invasion.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Champaiboon C, Sappington KJ, Guenther BD, Ross KF, Herzberg MC", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19122197", "url": "https://glygen.org/publication/PubMed/19122197" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "Interleukin-1 receptor-associated kinase 2 is critical for lipopolysaccharide-mediated post-transcriptional control.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wan Y, Xiao H, Affolter J, Kim TW, Bulek K, Chaudhuri S, Carlson D, Hamilton T, Mazumder B, Stark GR, Thomas J, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19224918", "url": "https://glygen.org/publication/PubMed/19224918" } ] }, { "title": "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "19367720", "url": "https://glygen.org/publication/PubMed/19367720" } ] }, { "title": "p47phox, the phagocyte NADPH oxidase/NOX2 organizer: structure, phosphorylation and implication in diseases.", "journal": "Experimental & molecular medicine", "date": "2009", "authors": "El-Benna J, Dang PM, Gougerot-Pocidalo MA, Marie JC, Braut-Boucher F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "19372727", "url": "https://glygen.org/publication/PubMed/19372727" } ] }, { "title": "Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides.", "journal": "PLoS biology", "date": "2009-04-28", "authors": "Bj\u00f6rk Per, Bj\u00f6rk Anders, Vogl Thomas, Stenstr\u00f6m Martin, Liberg David, Olsson Anders, Roth Johannes, Ivars Fredrik, Leanderson Tomas", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19402754", "url": "https://glygen.org/publication/PubMed/19402754" } ] }, { "title": "The endogenous Toll-like receptor 4 agonist S100A8/S100A9 (calprotectin) as innate amplifier of infection, autoimmunity, and cancer.", "journal": "J. Leukoc. Biol.", "date": "2009", "authors": "Ehrchen Jan M, Sunderk\u00f6tter Cord, Foell Dirk, Vogl Thomas, Roth Johannes", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19451397", "url": "https://glygen.org/publication/PubMed/19451397" } ] }, { "title": "Tube Is an IRAK-4 homolog in a Toll pathway adapted for development and immunity.", "journal": "Journal of innate immunity", "date": "2009", "authors": "Towb P, Sun H, Wasserman SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19498957", "url": "https://glygen.org/publication/PubMed/19498957" } ] }, { "title": "Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ohnishi H, Tochio H, Kato Z, Orii KE, Li A, Kimura T, Hiroaki H, Kondo N, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "19506249", "url": "https://glygen.org/publication/PubMed/19506249" } ] }, { "title": "A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nagpal K, Plantinga TS, Wong J, Monks BG, Gay NJ, Netea MG, Fitzgerald KA, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19509286", "url": "https://glygen.org/publication/PubMed/19509286" } ] }, { "title": "A novel p53 target gene, S100A9, induces p53-dependent cellular apoptosis and mediates the p53 apoptosis pathway.", "journal": "The Biochemical journal", "date": "2009-08-13", "authors": "Li Chunsun, Chen Hongyan, Ding Fang, Zhang Yu, Luo Aiping, Wang Mingrong, Liu Zhihua", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19534726", "url": "https://glygen.org/publication/PubMed/19534726" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "An oligomeric signaling platform formed by the Toll-like receptor signal transducers MyD88 and IRAK-4.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Motshwene PG, Moncrieffe MC, Grossmann JG, Kao C, Ayaluru M, Sandercock AM, Robinson CV, Latz E, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592493", "url": "https://glygen.org/publication/PubMed/19592493" } ] }, { "title": "MyD88 adapter-like (Mal)/TIRAP interaction with TRAF6 is critical for TLR2- and TLR4-mediated NF-kappaB proinflammatory responses.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Verstak B, Nagpal K, Bottomley SP, Golenbock DT, Hertzog PJ, Mansell A", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "19592497", "url": "https://glygen.org/publication/PubMed/19592497" } ] }, { "title": "Identification and characterization of binding sites on S100A7, a participant in cancer and inflammation pathways.", "journal": "Biochemistry", "date": "2009", "authors": "Leon R, Murray JI, Cragg G, Farnell B, West NR, Pace TC, Watson PH, Bohne C, Boulanger MJ, Hof F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "19810752", "url": "https://glygen.org/publication/PubMed/19810752" } ] }, { "title": "S100A8/A9: a Janus-faced molecule in cancer therapy and tumorgenesis.", "journal": "Eur. J. Pharmacol.", "date": "2009", "authors": "Ghavami Saeid, Chitayat Seth, Hashemi Mohammad, Eshraghi Mehdi, Chazin Walter J, Halayko Andrew J, Kerkhoff Claus", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19835859", "url": "https://glygen.org/publication/PubMed/19835859" } ] }, { "title": "S100 Calgranulins in inflammatory arthritis.", "journal": "Immunol. Cell Biol.", "date": "2010", "authors": "Perera Chandima, McNeil H Patrick, Geczy Carolyn L", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19935766", "url": "https://glygen.org/publication/PubMed/19935766" } ] }, { "title": "S100A8/A9 induces autophagy and apoptosis via ROS-mediated cross-talk between mitochondria and lysosomes that involves BNIP3.", "journal": "Cell research", "date": "2010-03", "authors": "Ghavami Saeid, Eshragi Mehdi, Ande Sudharsana R, Chazin Walter J, Klonisch Thomas, Halayko Andrew J, McNeill Karol D, Hashemi Mohammad, Kerkhoff Claus, Los Marek", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "19935772", "url": "https://glygen.org/publication/PubMed/19935772" } ] }, { "title": "CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.", "journal": "Nature immunology", "date": "2010", "authors": "Stewart CR, Stuart LM, Wilkinson K, van Gils JM, Deng J, Halle A, Rayner KJ, Boyer L, Zhong R, Frazier WA, Lacy-Hulbert A, El Khoury J, Golenbock DT, Moore KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20037584", "url": "https://glygen.org/publication/PubMed/20037584" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Induction of neutrophil degranulation by S100A9 via a MAPK-dependent mechanism.", "journal": "Journal of leukocyte biology", "date": "2010-05", "authors": "Simard Jean-Christophe, Girard Denis, Tessier Philippe A", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "20103766", "url": "https://glygen.org/publication/PubMed/20103766" } ] }, { "title": "Inflammation-associated S100 proteins: new mechanisms that regulate function.", "journal": "Amino Acids", "date": "2011", "authors": "Goyette Jesse, Geczy Carolyn L", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "20213444", "url": "https://glygen.org/publication/PubMed/20213444" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06702", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06702" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "The Toll-like receptor 4 ligands Mrp8 and Mrp14 are crucial in the development of autoreactive CD8+ T cells.", "journal": "Nature medicine", "date": "2010", "authors": "Loser K, Vogl T, Voskort M, Lueken A, Kupas V, Nacken W, Klenner L, Kuhn A, Foell D, Sorokin L, Luger TA, Roth J, Beissert S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20473308", "url": "https://glygen.org/publication/PubMed/20473308" } ] }, { "title": "Helical assembly in the MyD88-IRAK4-IRAK2 complex in TLR/IL-1R signalling.", "journal": "Nature", "date": "2010", "authors": "Lin SC, Lo YC, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "20485341", "url": "https://glygen.org/publication/PubMed/20485341" } ] }, { "title": "Anti-infective protective properties of S100 calgranulins.", "journal": "Antiinflamm. Antiallergy Agents Med. Chem.", "date": "2009", "authors": "Hsu Kenneth, Champaiboon Chantrakorn, Guenther Brian D, Sorenson Brent S, Khammanivong Ali, Ross Karen F, Geczy Carolyn L, Herzberg Mark C", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "20523765", "url": "https://glygen.org/publication/PubMed/20523765" } ] }, { "title": "PtdIns3P and Rac direct the assembly of the NADPH oxidase on a novel, pre-phagosomal compartment during FcR-mediated phagocytosis in primary mouse neutrophils.", "journal": "Blood", "date": "2010", "authors": "Anderson KE, Chessa TA, Davidson K, Henderson RB, Walker S, Tolmachova T, Grys K, Rausch O, Seabra MC, Tybulewicz VL, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "20813901", "url": "https://glygen.org/publication/PubMed/20813901" } ] }, { "title": "The prolyl isomerase Pin1 acts as a novel molecular switch for TNF-alpha-induced priming of the NADPH oxidase in human neutrophils.", "journal": "Blood", "date": "2010", "authors": "Boussetta T, Gougerot-Pocidalo MA, Hayem G, Ciappelloni S, Raad H, Arabi Derkawi R, Bournier O, Kroviarski Y, Zhou XZ, Malter JS, Lu PK, Bartegi A, Dang PM, El-Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "20956805", "url": "https://glygen.org/publication/PubMed/20956805" } ] }, { "title": "Two human MYD88 variants, S34Y and R98C, interfere with MyD88-IRAK4-myddosome assembly.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "George J, Motshwene PG, Wang H, Kubarenko AV, Rautanen A, Mills TC, Hill AV, Gay NJ, Weber AN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602498", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498" } ], "reference": [ { "type": "PubMed", "id": "20966070", "url": "https://glygen.org/publication/PubMed/20966070" } ] }, { "title": "An essential role of STIM1, Orai1, and S100A8-A9 proteins for Ca2+ signaling and FcgammaR-mediated phagosomal oxidative activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Steinckwich N, Schenten V, Melchior C, Brechard S, Tschirhart EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "21239714", "url": "https://glygen.org/publication/PubMed/21239714" } ] }, { "title": "Damage-associated molecular pattern S100A9 increases bactericidal activity of human neutrophils by enhancing phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011-03-15", "authors": "Simard Jean-Christophe, Simon Marie-Michelle, Tessier Philippe A, Girard Denis", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "21325622", "url": "https://glygen.org/publication/PubMed/21325622" } ] }, { "title": "Dynamic mobility of immunological cells expressing S100A8 and S100A9 in vivo: a variety of functional roles of the two proteins as regulators in acute inflammatory reaction.", "journal": "Inflammation", "date": "2012-04", "authors": "Koike Akiko, Arai Satoshi, Yamada Sachiko, Nagae Akiko, Saita Naoko, Itoh Hiroshi, Uemoto Shinji, Totani Masayuki, Ikemoto Masaki", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "21487906", "url": "https://glygen.org/publication/PubMed/21487906" } ] }, { "title": "Human interleukin-1 receptor-associated kinase-2 is essential for Toll-like receptor-mediated transcriptional and post-transcriptional regulation of tumor necrosis factor alpha.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Flannery SM, Keating SE, Szymak J, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "21606490", "url": "https://glygen.org/publication/PubMed/21606490" } ] }, { "title": "High mobility group box protein 1 in complex with lipopolysaccharide or IL-1 promotes an increased inflammatory phenotype in synovial fibroblasts.", "journal": "Arthritis research & therapy", "date": "2011", "authors": "Wahamaa H, Schierbeck H, Hreggvidsdottir HS, Palmblad K, Aveberger AC, Andersson U, Harris HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "21871094", "url": "https://glygen.org/publication/PubMed/21871094" } ] }, { "title": "S100A8 and S100A9: new insights into their roles in malignancy.", "journal": "Journal of innate immunity", "date": "2012", "authors": "Srikrishna Geetha", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "21912088", "url": "https://glygen.org/publication/PubMed/21912088" } ] }, { "title": "S100A8 and S100A9 in cardiovascular biology and disease.", "journal": "Arterioscler. Thromb. Vasc. Biol.", "date": "2012", "authors": "Averill Michelle M, Kerkhoff Claus, Bornfeldt Karin E", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "22095980", "url": "https://glygen.org/publication/PubMed/22095980" } ] }, { "title": "Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.", "journal": "Cell", "date": "2011", "authors": "Cebrian I, Visentin G, Blanchard N, Jouve M, Bobard A, Moita C, Enninga J, Moita LF, Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "22153078", "url": "https://glygen.org/publication/PubMed/22153078" } ] }, { "title": "Increased expression and phosphorylation of the two S100A9 isoforms in mononuclear cells from patients with systemic lupus erythematosus: a proteomic signature for circulating low-density granulocytes.", "journal": "Journal of proteomics", "date": "2012", "authors": "Pavon EJ, Garcia-Rodriguez S, Zumaquero E, Perandres-Lopez R, Rosal-Vela A, Lario A, Longobardo V, Carrascal M, Abian J, Callejas-Rubio JL, Ortego-Centeno N, Zubiaur M, Sancho J", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "22230807", "url": "https://glygen.org/publication/PubMed/22230807" } ] }, { "title": "The extracellular release of DNA and HMGB1 from Jurkat T cells during in vitro necrotic cell death.", "journal": "Innate immunity", "date": "2012", "authors": "Beyer C, Stearns NA, Giessl A, Distler JH, Schett G, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22344226", "url": "https://glygen.org/publication/PubMed/22344226" } ] }, { "title": "Constitutive neutrophil apoptosis: regulation by cell concentration via S100 A8/9 and the MEK-ERK pathway.", "journal": "PloS one", "date": "2012", "authors": "Atallah Mizhir, Krispin Alon, Trahtemberg Uriel, Ben-Hamron Sandrine, Grau Amir, Verbovetski Inna, Mevorach Dror", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "22363402", "url": "https://glygen.org/publication/PubMed/22363402" } ] }, { "title": "Bruton's tyrosine kinase phosphorylates Toll-like receptor 3 to initiate antiviral response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Lee KG, Xu S, Kang ZH, Huo J, Huang M, Liu D, Takeuchi O, Akira S, Lam KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "22454496", "url": "https://glygen.org/publication/PubMed/22454496" } ] }, { "title": "MRP14 (S100A9) protein interacts with Alzheimer beta-amyloid peptide and induces its fibrillization.", "journal": "PLoS ONE", "date": "2012", "authors": "Zhang Ce, Liu Yonggang, Gilthorpe Jonathan, van der Maarel Johan R C", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "22457725", "url": "https://glygen.org/publication/PubMed/22457725" } ] }, { "title": "Pro-inflammatory S100A8 and S100A9 proteins: self-assembly into multifunctional native and amyloid complexes.", "journal": "International journal of molecular sciences", "date": "2012", "authors": "Vogl T, Gharibyan AL, Morozova-Roche LA", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22489132", "url": "https://glygen.org/publication/PubMed/22489132" } ] }, { "title": "Structural characterization of S100A15 reveals a novel zinc coordination site among S100 proteins and altered surface chemistry with functional implications for receptor binding.", "journal": "BMC structural biology", "date": "2012", "authors": "Murray JI, Tonkin ML, Whiting AL, Peng F, Farnell B, Cullen JT, Hof F, Boulanger MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "22747601", "url": "https://glygen.org/publication/PubMed/22747601" } ] }, { "title": "Induction of nuclear factor-\u03baB responses by the S100A9 protein is Toll-like receptor-4-dependent.", "journal": "Immunology", "date": "2012-10", "authors": "Riva Matteo, K\u00e4llberg Eva, Bj\u00f6rk Per, Hancz Dora, Vogl Thomas, Roth Johannes, Ivars Fredrik, Leanderson Tomas", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "22804476", "url": "https://glygen.org/publication/PubMed/22804476" } ] }, { "title": "Molecular interface of S100A8 with cytochrome b558 and NADPH oxidase activation.", "journal": "PloS one", "date": "2012", "authors": "Berthier S, Nguyen MV, Baillet A, Hograindleur MA, Paclet MH, Polack B, Morel F", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "22808130", "url": "https://glygen.org/publication/PubMed/22808130" } ] }, { "title": "High-affinity manganese coordination by human calprotectin is calcium-dependent and requires the histidine-rich site formed at the dimer interface.", "journal": "Journal of the American Chemical Society", "date": "2013", "authors": "Hayden JA, Brophy MB, Cunden LS, Nolan EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "23276281", "url": "https://glygen.org/publication/PubMed/23276281" } ] }, { "title": "Class III phosphatidylinositol 3-kinase and its catalytic product PtdIns3P in regulation of endocytic membrane traffic.", "journal": "The FEBS journal", "date": "2013", "authors": "Raiborg C, Schink KO, Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "23289851", "url": "https://glygen.org/publication/PubMed/23289851" } ] }, { "title": "Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Damo SM, Kehl-Fie TE, Sugitani N, Holt ME, Rathi S, Murphy WJ, Zhang Y, Betz C, Hench L, Fritz G, Skaar EP, Chazin WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "23431180", "url": "https://glygen.org/publication/PubMed/23431180" } ] }, { "title": "The many faces of HMGB1: molecular structure-functional activity in inflammation, apoptosis, and chemotaxis.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Yang H, Antoine DJ, Andersson U, Tracey KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "23446148", "url": "https://glygen.org/publication/PubMed/23446148" } ] }, { "title": "IkappaB kinase phosphorylation of SNAP-23 controls platelet secretion.", "journal": "Blood", "date": "2013", "authors": "Karim ZA, Zhang J, Banerjee M, Chicka MC, Al Hawas R, Hamilton TR, Roche PA, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "23613522", "url": "https://glygen.org/publication/PubMed/23613522" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Interaction of inducible nitric oxide synthase with rac2 regulates reactive oxygen and nitrogen species generation in the human neutrophil phagosomes: implication in microbial killing.", "journal": "Antioxidants & redox signaling", "date": "2014", "authors": "Jyoti A, Singh AK, Dubey M, Kumar S, Saluja R, Keshari RS, Verma A, Chandra T, Kumar A, Bajpai VK, Barthwal MK, Dikshit M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "23875749", "url": "https://glygen.org/publication/PubMed/23875749" } ] }, { "title": "Regulation of the NADPH oxidase and associated ion fluxes during phagocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2013", "authors": "Nunes P, Demaurex N, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "23980663", "url": "https://glygen.org/publication/PubMed/23980663" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Functional assessment of the mutational effects of human IRAK4 and MyD88 genes.", "journal": "Molecular immunology", "date": "2014", "authors": "Yamamoto T, Tsutsumi N, Tochio H, Ohnishi H, Kubota K, Kato Z, Shirakawa M, Kondo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5603041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041" } ], "reference": [ { "type": "PubMed", "id": "24316379", "url": "https://glygen.org/publication/PubMed/24316379" } ] }, { "title": "Ionomycin-regulated phosphorylation of the myeloid calcium-binding protein p14.", "journal": "Nature", "date": "1989", "authors": "Edgeworth J, Freemont P, Hogg N", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "2478889", "url": "https://glygen.org/publication/PubMed/2478889" } ] }, { "title": "S100A1 is released from ischemic cardiomyocytes and signals myocardial damage via Toll-like receptor 4.", "journal": "EMBO molecular medicine", "date": "2014", "authors": "Rohde D, Schon C, Boerries M, Didrihsone I, Ritterhoff J, Kubatzky KF, Volkers M, Herzog N, Mahler M, Tsoporis JN, Parker TG, Linke B, Giannitsis E, Gao E, Peppel K, Katus HA, Most P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "24833748", "url": "https://glygen.org/publication/PubMed/24833748" } ] }, { "title": "TLR signals induce phagosomal MHC-I delivery from the endosomal recycling compartment to allow cross-presentation.", "journal": "Cell", "date": "2014", "authors": "Nair-Gupta P, Baccarini A, Tung N, Seyffer F, Florey O, Huang Y, Banerjee M, Overholtzer M, Roche PA, Tampe R, Brown BD, Amsen D, Whiteheart SW, Blander JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "25083866", "url": "https://glygen.org/publication/PubMed/25083866" } ] }, { "title": "Target-selective protein S-nitrosylation by sequence motif recognition.", "journal": "Cell", "date": "2014", "authors": "Jia J, Arif A, Terenzi F, Willard B, Plow EF, Hazen SL, Fox PL", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" } ] }, { "title": "Manganese binding properties of human calprotectin under conditions of high and low calcium: X-ray crystallographic and advanced electron paramagnetic resonance spectroscopic analysis.", "journal": "Journal of the American Chemical Society", "date": "2015", "authors": "Gagnon DM, Brophy MB, Bowman SE, Stich TA, Drennan CL, Britt RD, Nolan EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990" } ], "reference": [ { "type": "PubMed", "id": "25597447", "url": "https://glygen.org/publication/PubMed/25597447" } ] }, { "title": "Proteins S100A8 and S100A9 are potential biomarkers for renal cell carcinoma in the early stages: results from a proteomic study integrated with bioinformatics analysis.", "journal": "Molecular medicine reports", "date": "2015", "authors": "Zhang L, Jiang H, Xu G, Wen H, Gu B, Liu J, Mao S, Na R, Jing Y, Ding Q, Zhang Y", "evidence": [ { "database": "GlyGen", "id": "A0134", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "25673070", "url": "https://glygen.org/publication/PubMed/25673070" } ] }, { "title": "TLR8, but not TLR7, induces the priming of the NADPH oxidase activation in human neutrophils.", "journal": "Journal of leukocyte biology", "date": "2015", "authors": "Makni-Maalej K, Marzaioli V, Boussetta T, Belambri SA, Gougerot-Pocidalo MA, Hurtado-Nedelec M, Dang PM, El-Benna J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "25877926", "url": "https://glygen.org/publication/PubMed/25877926" } ] }, { "title": "Role of S100A1 in hypoxia-induced inflammatory response in cardiomyocytes via TLR4/ROS/NF-kappaB pathway.", "journal": "The Journal of pharmacy and pharmacology", "date": "2015", "authors": "Yu J, Lu Y, Li Y, Xiao L, Xing Y, Li Y, Wu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "25880347", "url": "https://glygen.org/publication/PubMed/25880347" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06702", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06702" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "A protein containing the cystic fibrosis antigen is an inhibitor of protein kinases.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Murao S, Collart F R, Huberman E", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "2656677", "url": "https://glygen.org/publication/PubMed/2656677" } ] }, { "title": "Priming of the neutrophil respiratory burst: role in host defense and inflammation.", "journal": "Immunological reviews", "date": "2016", "authors": "El-Benna J, Hurtado-Nedelec M, Marzaioli V, Marie JC, Gougerot-Pocidalo MA, Dang PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "27558335", "url": "https://glygen.org/publication/PubMed/27558335" } ] }, { "title": "Amino acid sequences of 60B8 antigens induced in HL-60 cells by 1,25-dihydroxyvitamin D3. The antigens are identical with macrophage-related protein-14 and -8.", "journal": "Chem. Pharm. Bull.", "date": "1989", "authors": "Tobe T, Murakami K, Tomita M, Nozawa R", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "2776242", "url": "https://glygen.org/publication/PubMed/2776242" } ] }, { "title": "Intracellular S100A9 Promotes Myeloid-Derived Suppressor Cells during Late Sepsis.", "journal": "Frontiers in immunology", "date": "2017", "authors": "Dai J, Kumbhare A, Youssef D, McCall CE, El Gazzar M", "evidence": [ { "database": "iPTMnet", "id": "P06702", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06702" } ], "reference": [ { "type": "PubMed", "id": "29204146", "url": "https://glygen.org/publication/PubMed/29204146" } ] }, { "title": "Galectin-3 and S100A9: Novel Diabetogenic Factors Mediating Pancreatic Cancer-Associated Diabetes.", "journal": "Diabetes care", "date": "2019", "authors": "Liao WC, Huang BS, Yu YH, Yang HH, Chen PR, Huang CC, Huang HY, Wu MS, Chow LP", "evidence": [ { "database": "GlyGen", "id": "A0134", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31262951", "url": "https://glygen.org/publication/PubMed/31262951" } ] }, { "title": "COVID-19 Patients Upregulate Toll-like Receptor 4-mediated Inflammatory Signaling That Mimics Bacterial Sepsis.", "journal": "Journal of Korean medical science", "date": "2020", "authors": "Sohn KM, Lee SG, Kim HJ, Cheon S, Jeong H, Lee J, Kim IS, Silwal P, Kim YJ, Paik S, Chung C, Park C, Kim YS, Jo EK", "evidence": [ { "database": "GlyGen", "id": "A0134", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "32989935", "url": "https://glygen.org/publication/PubMed/32989935" } ] }, { "title": "Two calcium-binding proteins in infiltrate macrophages of rheumatoid arthritis.", "journal": "Nature", "date": "1987", "authors": "Odink K, Cerletti N, Br\u00fcggen J, Clerc R G, Tarcsay L, Zwadlo G, Gerhards G, Schlegel R, Sorg C", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "3313057", "url": "https://glygen.org/publication/PubMed/3313057" } ] }, { "title": "Cloning and expression of two human genes encoding calcium-binding proteins that are regulated during myeloid differentiation.", "journal": "Mol. Cell. Biol.", "date": "1988", "authors": "Lagasse E, Clerc R G", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "3405210", "url": "https://glygen.org/publication/PubMed/3405210" } ] }, { "title": "Nuclear proinflammatory cytokine S100A9 enhances expression of human papillomavirus oncogenes via transcription factor TEAD1.", "journal": "Journal of virology", "date": "2023-08-31", "authors": "Mori Seiichiro, Ishii Yoshiyuki, Takeuchi Takamasa, Kukimoto Iwao", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "37578237", "url": "https://glygen.org/publication/PubMed/37578237" } ] }, { "title": "CD74 Promotes a Pro-Inflammatory Tumor Microenvironment by Inducing S100A8 and S100A9 Secretion in Pancreatic Cancer.", "journal": "International journal of molecular sciences", "date": "2023-08-20", "authors": "Hong Woosol Chris, Lee Da Eun, Kang Hyeon Woong, Kim Myeong Jin, Kim Minsoo, Kim Ju Hyun, Fang Sungsoon, Kim Hyo Jung, Park Joon Seong", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "37629174", "url": "https://glygen.org/publication/PubMed/37629174" } ] }, { "title": "The Stabilization of S100A9 Structure by Calcium Inhibits the Formation of Amyloid Fibrils.", "journal": "International journal of molecular sciences", "date": "2023-08-25", "authors": "Sanders Ella, Csondor Rebecca, \u0160ulskis Darius, Baronait\u0117 Ieva, Smirnovas Vytautas, Maheswaran Luckshi, Horrocks Jack, Munro Rory, Georgiadou Christina, Horvath Istvan, Morozova-Roche Ludmilla A, Williamson Philip T F", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "37686007", "url": "https://glygen.org/publication/PubMed/37686007" } ] }, { "title": "S100A8 and S100A9 in Hematologic Malignancies: From Development to Therapy.", "journal": "International journal of molecular sciences", "date": "2023-08-29", "authors": "Razmkhah Farnaz, Kim Sena, Lim Sora, Dania Abdul-Jalil, Choi Jaebok", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "37686186", "url": "https://glygen.org/publication/PubMed/37686186" } ] }, { "title": "Transcriptomic Analysis of Retinal Gene in Experimental Retinal Detachment Rats and Exploration of S100A9 and TLR4 in Human Vitreous.", "journal": "Current eye research", "date": "2023-12", "authors": "Wang Jing, Lu Li, Zou Gaocheng, Ye Ziyang, Jin Feiyu, Wang Lin, Ke Genjie, Dong Kai, Tao Liming", "evidence": [ { "database": "RefSeq", "id": "NP_002956", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002956" } ], "reference": [ { "type": "PubMed", "id": "37846082", "url": "https://glygen.org/publication/PubMed/37846082" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "el Benna J, Faust LP, Babior BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "8089108", "url": "https://glygen.org/publication/PubMed/8089108" } ] }, { "title": "In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena.", "journal": "Journal of dental research", "date": "1993-02", "authors": "Miyasaki K T, Bodeau A L, Murthy A R, Lehrer R I", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "8423249", "url": "https://glygen.org/publication/PubMed/8423249" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "TRAF6 is a signal transducer for interleukin-1.", "journal": "Nature", "date": "1996", "authors": "Cao Z, Xiong J, Takeuchi M, Kurama T, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "8837778", "url": "https://glygen.org/publication/PubMed/8837778" } ] }, { "title": "Activation of the IkappaB alpha kinase complex by MEKK1, a kinase of the JNK pathway.", "journal": "Cell", "date": "1997", "authors": "Lee FS, Hagler J, Chen ZJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9008162", "url": "https://glygen.org/publication/PubMed/9008162" } ] }, { "title": "Myeloid-related protein (MRP) 8 and MRP14, calcium-binding proteins of the S100 family, are secreted by activated monocytes via a novel, tubulin-dependent pathway.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Rammes A, Roth J, Goebeler M, Klempt M, Hartmann M, Sorg C", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "reference": [ { "type": "PubMed", "id": "9083090", "url": "https://glygen.org/publication/PubMed/9083090" } ] }, { "title": "MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.", "journal": "Immunity", "date": "1997", "authors": "Wesche H, Henzel WJ, Shillinglaw W, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-166058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058" } ], "reference": [ { "type": "PubMed", "id": "9430229", "url": "https://glygen.org/publication/PubMed/9430229" } ] }, { "title": "p40(phox) is phosphorylated on threonine 154 and serine 315 during activation of the phagocyte NADPH oxidase. Implication of a protein kinase c-type kinase in the phosphorylation process.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Bouin AP, Grandvaux N, Vignais PV, Fuchs A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599" } ], "reference": [ { "type": "PubMed", "id": "9804763", "url": "https://glygen.org/publication/PubMed/9804763" } ] } ], "pathway": [ { "id": "hsa:6280", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6280", "resource": "KEGG Pathway" }, { "id": "R-HSA-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-HSA-166058", "name": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166058", "resource": "Reactome", "description": "MyD88:MAL(TIRAP) cascade initiated on plasma membrane" }, { "id": "R-HSA-5602498", "name": "MyD88 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602498", "resource": "Reactome", "description": "MyD88 deficiency (TLR2/4)" }, { "id": "R-HSA-5603041", "name": "IRAK4 deficiency (TLR2/4)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603041", "resource": "Reactome", "description": "IRAK4 deficiency (TLR2/4)" }, { "id": "R-HSA-5668599", "name": "RHO GTPases Activate NADPH Oxidases", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668599", "resource": "Reactome", "description": "RHO GTPases Activate NADPH Oxidases" }, { "id": "R-HSA-5686938", "name": "Regulation of TLR by endogenous ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "resource": "Reactome", "description": "Regulation of TLR by endogenous ligand" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-6799990", "name": "Metal sequestration by antimicrobial proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799990", "resource": "Reactome", "description": "Metal sequestration by antimicrobial proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "P31725-1", "protein_name": "Protein S100-A9", "gene_name": "S100a9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK", "length": 113 }, "evidence": [ { "id": "45936091", "url": "http://www.informatics.jax.org/homology/45936091", "database": "MGI" }, { "id": "P06702", "url": "https://omabrowser.org/oma/group/P06702/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P50116-1", "protein_name": "Protein S100-A9", "gene_name": "S100a9", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK", "length": 113 }, "evidence": [ { "id": "45936091", "url": "http://www.informatics.jax.org/homology/45936091", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "RAGE receptor binding", "id": "GO:0050786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050786", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "antioxidant activity", "id": "GO:0016209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016209", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "arachidonic acid binding", "id": "GO:0050544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050544", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "Toll-like receptor 4 binding", "id": "GO:0035662", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035662", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 27, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "positive regulation of cell growth", "id": "GO:0030307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030307", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "leukocyte migration involved in inflammatory response", "id": "GO:0002523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002523", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "endothelial cell migration", "id": "GO:0043542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043542", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "positive regulation of intrinsic apoptotic signaling pathway", "id": "GO:2001244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001244", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "regulation of cytoskeleton organization", "id": "GO:0051493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051493", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "chronic inflammatory response", "id": "GO:0002544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002544", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "modulation of process of another organism", "id": "GO:0035821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035821", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "defense response to fungus", "id": "GO:0050832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050832", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "astrocyte development", "id": "GO:0014002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014002", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "peptidyl-cysteine S-trans-nitrosylation", "id": "GO:0035606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035606", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "sequestering of zinc ion", "id": "GO:0032119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032119", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "neutrophil aggregation", "id": "GO:0070488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070488", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "neutrophil chemotaxis", "id": "GO:0030593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030593", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "regulation of integrin biosynthetic process", "id": "GO:0045113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045113", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" }, { "name": "autocrine signaling", "id": "GO:0035425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035425", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "15905572", "url": "https://glygen.org/publication/PubMed/15905572" }, { "database": "PubMed", "id": "15331440", "url": "https://glygen.org/publication/PubMed/15331440" }, { "database": "PubMed", "id": "2478889", "url": "https://glygen.org/publication/PubMed/2478889" } ] }, { "annotation": "S-nitrosylation of Cys-3 is implicated in LDL(ox)-induced S-nitrosylation of GAPDH at 'Cys-247' through a transnitrosylase mechanism involving a iNOS-S100A8/9 complex (PubMed:25417112).", "evidence": [ { "database": "UniProtKB", "id": "P06702", "url": "https://www.uniprot.org/uniprot/P06702" }, { "database": "PubMed", "id": "25417112", "url": "https://glygen.org/publication/PubMed/25417112" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Protein S100A9 (S100A9)", "biomarker_id": "A0134", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32989935", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32989935" }, { "id": "25673070", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25673070" }, { "id": "31262951", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31262951" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased S100A9 level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "32989935", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32989935" } ] }, { "best_biomarker_type": "predictive", "status": "increased S100A9 level", "disease": { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "25673070", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25673070" } ] }, { "best_biomarker_type": "monitoring", "status": "Increased S100A9 level", "disease": { "disease_id": "DOID:9351", "recommended_name": { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes mellitus", "description": "A glucose metabolism disease that is characterized by chronic hyperglycaemia with disturbances of carbohydrate, fat and protein metabolism resulting from defects in insulin secretion, insulin action, or both." }, "synonyms": [ { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31262951", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31262951" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 113 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 166 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }