{ "uniprot_canonical_ac": "P06396-1", "uniprot_ac": "P06396", "uniprot_id": "GELS_HUMAN", "mass": { "chemical_mass": 85698.0, "monoisotopic_mass": 85698.0 }, "refseq": { "ac": "NP_000168", "name": "gelsolin isoform a precursor", "summary": "The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, "gene_names": [ { "name": "GSN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P06396", "id": "P06396" }, { "name": "ADF; AGEL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168", "id": "NP_000168" }, { "name": "GSN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168", "id": "NP_000168" } ], "protein_names": [ { "name": "Gelsolin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P06396" }, { "name": "ADF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06396" }, { "name": "AGEL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06396" }, { "name": "Actin-depolymerizing factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06396" }, { "name": "Brevin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P06396" }, { "name": "brevin; actin-depolymerizing factor; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168", "id": "NP_000168" }, { "name": "gelsolin isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168", "id": "NP_000168" } ], "function": [ { "annotation": "Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed. Plays a role in ciliogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q5T0I0", "url": "https://www.uniprot.org/uniprot/Q5T0I0#function" }, { "database": "UniProtKB", "id": "RU367130", "url": "https://www.uniprot.org/uniprot/RU367130#function" }, { "database": "UniProtKB", "id": "A0A0U1RQL8", "url": "https://www.uniprot.org/uniprot/A0A0U1RQL8#function" }, { "database": "UniProtKB", "id": "A0A0A0MS51", "url": "https://www.uniprot.org/uniprot/A0A0A0MS51#function" }, { "database": "UniProtKB", "id": "A0A8V8TND7", "url": "https://www.uniprot.org/uniprot/A0A8V8TND7#function" }, { "database": "UniProtKB", "id": "A0A0A0MT01", "url": "https://www.uniprot.org/uniprot/A0A0A0MT01#function" }, { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396#function" }, { "database": "PubMed", "id": "20393563", "url": "https://glygen.org/publication/PubMed/20393563" }, { "database": "PubMed", "id": "19666512", "url": "https://glygen.org/publication/PubMed/19666512" } ] }, { "annotation": "Fusion of the High-mobility Group AT-Hook 2 (HMGA2) and the Gelsolin (GSN) Genes in Lipomas With t(9;12)(q33;q14) Chromosomal Translocation.", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, { "database": "PubMed", "id": "36881074", "url": "https://glygen.org/publication/PubMed/36881074" } ] }, { "annotation": "Gelsolin, an Actin-Binding Protein: Bioinformatic Analysis and Functional Significance in Urothelial Bladder Carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, { "database": "PubMed", "id": "37958747", "url": "https://glygen.org/publication/PubMed/37958747" } ] }, { "annotation": "MTORC2 interactome and localization determine aggressiveness of high-grade glioma cells through association with gelsolin. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, { "database": "PubMed", "id": "37120454", "url": "https://glygen.org/publication/PubMed/37120454" } ] }, { "annotation": "Role and therapeutic potential of gelsolin in atherosclerosis. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, { "database": "PubMed", "id": "36967105", "url": "https://glygen.org/publication/PubMed/36967105" } ] }, { "annotation": "The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ] }, { "annotation": "The regulation of plasma gelsolin by DNA methylation in ovarian cancer chemo-resistance. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" }, { "database": "PubMed", "id": "38216951", "url": "https://glygen.org/publication/PubMed/38216951" } ] } ], "disease": [ { "disease_id": "DOID:0050637", "recommended_name": { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Finnish type amyloidosis", "description": "An amyloidosis that is characterized by abnormal deposits of amyloid protein that mainly affect the eyes, nerves and skin and has_material_basis_in mutations in the gelsolin gene (GSN), and has_symptom corneal lattice dystrophy, has_symptom bilateral facial paralysis, has_symptom cutis laxa." }, "synonyms": [ { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Lattice corneal dystrophy type II", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AGel amyloidosis", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AMYLOIDOSIS, MERETOJA TYPE", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "Finnish type amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, MERETOJA type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloid polyneuropathy type IV", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja syndrome", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "AGel amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloid cranial neuropathy with lattice corneal dystrophy", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis 5", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis V", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis due to mutant gelsolin", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Meretoja type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "cerebral amyloid angiopathy, Gsn-related", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "corneal dystrophy, lattice type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy type II Finnish", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy, type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja type amyloidosis", "description": "" }, { "id": "MIM:105120", "resource": "MIM", "url": "https://www.omim.org/entry/105120", "name": "Amyloidosis 5", "description": "Amyloidosis 5" } ], "evidence": [ { "id": "105120", "database": "MIM", "url": "https://www.omim.org/entry/105120" } ] } ], "snv": [ { "evidence": [ { "id": "rs1358284064", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1358284064" }, { "id": "rs1358284064", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1358284064" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 107, "end_pos": 107, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGN->NGS).", "chr_id": "9", "chr_pos": "121302138", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N107", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1355688870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1355688870" }, { "id": "rs1355688870", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1355688870#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 213, "end_pos": 213, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNG->NNS).", "chr_id": "9", "chr_pos": "121310816", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G213", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761334580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761334580" }, { "id": "rs761334580", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761334580" }, { "id": "rs761334580", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761334580#frequency_tab" }, { "id": "rs761334580", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761334580" }, { "id": "rs1418309924", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1418309924" }, { "id": "rs1418309924", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1418309924" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGT).", "chr_id": "9", "chr_pos": "121317143", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1203309936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1203309936" }, { "id": "rs1203309936", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1203309936#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "9", "chr_pos": "121299965", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S35", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1589133789", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589133789" }, { "id": "rs1589133789", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589133789" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 402, "end_pos": 402, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "9", "chr_pos": "121318821", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T402", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781768258", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781768258" }, { "id": "rs781768258", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781768258" }, { "id": "rs781768258", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781768258#frequency_tab" }, { "id": "rs781768258", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781768258" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 402, "end_pos": 402, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "9", "chr_pos": "121318741", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T402", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1589132580", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589132580" }, { "id": "rs1589132580", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589132580" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 408, "end_pos": 408, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "9", "chr_pos": "121318758", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S408", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1589132623", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589132623" }, { "id": "rs1589132623", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589132623" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 408, "end_pos": 408, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "9", "chr_pos": "121318759", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S408", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs75508371", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75508371" }, { "id": "rs75508371", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75508371" }, { "id": "rs75508371", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs75508371" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 411, "end_pos": 411, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "9", "chr_pos": "121318767", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S411", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs370764119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370764119" }, { "id": "rs370764119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370764119#frequency_tab" }, { "id": "rs370764119", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370764119" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 412, "end_pos": 412, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "9", "chr_pos": "121318771", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S412", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1589133701", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1589133701" }, { "id": "rs1589133701", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1589133701" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 426, "end_pos": 426, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "9", "chr_pos": "121318812", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T426", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1234250509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234250509" }, { "id": "rs1234250509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234250509" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 430, "end_pos": 430, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "9", "chr_pos": "121318825", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S430", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs142034230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142034230" }, { "id": "rs142034230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142034230" }, { "id": "rs142034230", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142034230#frequency_tab" }, { "id": "rs142034230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142034230" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 442, "end_pos": 442, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGT->NGT).", "chr_id": "9", "chr_pos": "121318860", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D442", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0050637", "recommended_name": { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Finnish type amyloidosis", "description": "An amyloidosis that is characterized by abnormal deposits of amyloid protein that mainly affect the eyes, nerves and skin and has_material_basis_in mutations in the gelsolin gene (GSN), and has_symptom corneal lattice dystrophy, has_symptom bilateral facial paralysis, has_symptom cutis laxa." }, "synonyms": [ { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Lattice corneal dystrophy type II", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AGel amyloidosis", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AMYLOIDOSIS, MERETOJA TYPE", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "Finnish type amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, MERETOJA type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloid polyneuropathy type IV", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja syndrome", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "AGel amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloid cranial neuropathy with lattice corneal dystrophy", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis 5", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis V", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis due to mutant gelsolin", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Meretoja type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "cerebral amyloid angiopathy, Gsn-related", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "corneal dystrophy, lattice type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy type II Finnish", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy, type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja type amyloidosis", "description": "" }, { "id": "MIM:105120", "resource": "MIM", "url": "https://www.omim.org/entry/105120", "name": "Amyloidosis 5", "description": "Amyloidosis 5" } ] } ] }, { "evidence": [ { "id": "rs116185403", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs116185403" }, { "id": "rs116185403", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs116185403" }, { "id": "rs116185403", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs116185403" }, { "id": "rs116185403", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs116185403#frequency_tab" }, { "id": "rs116185403", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs116185403" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 481, "end_pos": 481, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYR->NYS).", "chr_id": "9", "chr_pos": "121321364", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.001597", "site_lbl": "R481", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777717306", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777717306" }, { "id": "rs777717306", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777717306" }, { "id": "rs777717306", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777717306" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 51, "end_pos": 51, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "9", "chr_pos": "121301970", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S51", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1314373375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1314373375" }, { "id": "rs1314373375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1314373375" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 51, "end_pos": 51, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "9", "chr_pos": "121301971", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S51", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1387577221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387577221" }, { "id": "rs1387577221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387577221#frequency_tab" }, { "id": "rs1387577221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387577221" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 573, "end_pos": 573, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NSS).", "chr_id": "9", "chr_pos": "121326659", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A573", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1387577221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387577221" }, { "id": "rs1387577221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387577221#frequency_tab" }, { "id": "rs1387577221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387577221" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 573, "end_pos": 573, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "9", "chr_pos": "121326659", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A573", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776392493", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776392493" }, { "id": "rs776392493", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776392493" }, { "id": "rs776392493", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776392493" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 591, "end_pos": 591, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSN->NSS).", "chr_id": "9", "chr_pos": "121327339", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N591", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1337468572", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1337468572" }, { "id": "rs1337468572", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1337468572" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 593, "end_pos": 593, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "9", "chr_pos": "121327446", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A593", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P06396", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06396" }, { "id": "rs777767455", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777767455" }, { "id": "rs777767455", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777767455" }, { "id": "rs777767455", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs777767455#frequency_tab" }, { "id": "rs777767455", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777767455" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 676, "end_pos": 676, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NKI->NKT).", "chr_id": "9", "chr_pos": "121329002", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "I676", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:0050637", "recommended_name": { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Finnish type amyloidosis", "description": "An amyloidosis that is characterized by abnormal deposits of amyloid protein that mainly affect the eyes, nerves and skin and has_material_basis_in mutations in the gelsolin gene (GSN), and has_symptom corneal lattice dystrophy, has_symptom bilateral facial paralysis, has_symptom cutis laxa." }, "synonyms": [ { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "Lattice corneal dystrophy type II", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AGel amyloidosis", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "AMYLOIDOSIS, MERETOJA TYPE", "description": "" }, { "id": "DOID:0050637", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050637", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "Finnish type amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, MERETOJA type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloid polyneuropathy type IV", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "familial amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja syndrome", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "AGel amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloid cranial neuropathy with lattice corneal dystrophy", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis 5", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis V", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis due to mutant gelsolin", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Finnish type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "amyloidosis, Meretoja type", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "cerebral amyloid angiopathy, Gsn-related", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "corneal dystrophy, lattice type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "hereditary gelsolin amyloidosis", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy type II Finnish", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "lattice corneal dystrophy, type 2", "description": "" }, { "id": "MONDO:0007097", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007097", "name": "meretoja type amyloidosis", "description": "" }, { "id": "MIM:105120", "resource": "MIM", "url": "https://www.omim.org/entry/105120", "name": "Amyloidosis 5", "description": "Amyloidosis 5" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 236, "end_pos": 236, "sequence_org": "E", "sequence_mut": "Q", "comment": "Does not result in actin depolymerization activity in absence of calcium. Has actin depolymerization activity in absence of calcium; when associated with N-214 and N-697 or N-214, N-697 and Q-719.", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "PubMed", "id": "19666512", "url": "https://glygen.org/publication/PubMed/19666512" } ] }, { "start_pos": 697, "end_pos": 697, "sequence_org": "D", "sequence_mut": "N", "comment": "Does not result in actin depolymerization activity in absence of calcium. Has actin depolymerization activity in absence of calcium; when associated with N-214 and Q-236, N-214 and Q-719 or N-214, Q-236 and Q-719.", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "PubMed", "id": "19666512", "url": "https://glygen.org/publication/PubMed/19666512" } ] }, { "start_pos": 719, "end_pos": 719, "sequence_org": "E", "sequence_mut": "Q", "comment": "Does not result in actin depolymerization activity in absence of calcium. Has actin depolymerization activity in absence of calcium; when associated with N-214 and N-697 or N-214, Q-236 and N-697.", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "PubMed", "id": "19666512", "url": "https://glygen.org/publication/PubMed/19666512" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "97.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "98.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "92.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P06396" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "common_name": "Human" } ], "gene": [ { "name": "GSN", "url": "https://www.uniprot.org/uniprot/P06396", "locus": { "chromosome": "9", "start_pos": 121332843, "end_pos": 121207794, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000148180", "url": "https://www.ensembl.org/id/ENSG00000148180" } ] } } ], "crossref": [ { "id": "ENSG00000148180", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000148180", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P06396", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P06396", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd11288", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11288", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11289", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11289", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11290", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11290", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11291", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11291", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11292", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11292", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11293", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11293", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295700", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295700", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GSN", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSN", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2934", "url": "https://www.ncbi.nlm.nih.gov/gene/2934", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4620", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4620", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A0A0U1RQL8", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A0U1RQL8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P06396", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06396*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2934", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2934", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "105120", "url": "http://www.omim.org/entry/105120", "database": "MIM", "categories": [ "Other" ] }, { "id": "137350", "url": "http://www.omim.org/entry/137350", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P06396", "url": "https://www.nextprot.org/entry/NX_P06396", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "25995at2759", "url": "http://www.orthodb.org/?query=25995at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11977", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11977", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11977:SF29", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11977:SF29", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1C0F", "url": "https://www.rcsb.org/structure/1C0F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1C0G", "url": "https://www.rcsb.org/structure/1C0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1D4X", "url": "https://www.rcsb.org/structure/1D4X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1DEJ", "url": "https://www.rcsb.org/structure/1DEJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EQY", "url": "https://www.rcsb.org/structure/1EQY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ESV", "url": "https://www.rcsb.org/structure/1ESV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H1V", "url": "https://www.rcsb.org/structure/1H1V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KCQ", "url": "https://www.rcsb.org/structure/1KCQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MDU", "url": "https://www.rcsb.org/structure/1MDU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NLV", "url": "https://www.rcsb.org/structure/1NLV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NM1", "url": "https://www.rcsb.org/structure/1NM1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NMD", "url": "https://www.rcsb.org/structure/1NMD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1P8X", "url": "https://www.rcsb.org/structure/1P8X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1P8Z", "url": "https://www.rcsb.org/structure/1P8Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SOL", "url": "https://www.rcsb.org/structure/1SOL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1T44", "url": "https://www.rcsb.org/structure/1T44", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YAG", "url": "https://www.rcsb.org/structure/1YAG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YVN", "url": "https://www.rcsb.org/structure/1YVN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FF3", "url": "https://www.rcsb.org/structure/2FF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FF6", "url": "https://www.rcsb.org/structure/2FF6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FH1", "url": "https://www.rcsb.org/structure/2FH1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FH2", "url": "https://www.rcsb.org/structure/2FH2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FH3", "url": "https://www.rcsb.org/structure/2FH3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FH4", "url": "https://www.rcsb.org/structure/2FH4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A5L", "url": "https://www.rcsb.org/structure/3A5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A5M", "url": "https://www.rcsb.org/structure/3A5M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A5N", "url": "https://www.rcsb.org/structure/3A5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A5O", "url": "https://www.rcsb.org/structure/3A5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CI5", "url": "https://www.rcsb.org/structure/3CI5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CIP", "url": "https://www.rcsb.org/structure/3CIP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CJB", "url": "https://www.rcsb.org/structure/3CJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CJC", "url": "https://www.rcsb.org/structure/3CJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FFK", "url": "https://www.rcsb.org/structure/3FFK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FFN", "url": "https://www.rcsb.org/structure/3FFN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TU5", "url": "https://www.rcsb.org/structure/3TU5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PKG", "url": "https://www.rcsb.org/structure/4PKG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PKH", "url": "https://www.rcsb.org/structure/4PKH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PKI", "url": "https://www.rcsb.org/structure/4PKI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4S10", "url": "https://www.rcsb.org/structure/4S10", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z94", "url": "https://www.rcsb.org/structure/4Z94", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FAE", "url": "https://www.rcsb.org/structure/5FAE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FAF", "url": "https://www.rcsb.org/structure/5FAF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H3M", "url": "https://www.rcsb.org/structure/5H3M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H3N", "url": "https://www.rcsb.org/structure/5H3N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5O2Z", "url": "https://www.rcsb.org/structure/5O2Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UBO", "url": "https://www.rcsb.org/structure/5UBO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ZZ0", "url": "https://www.rcsb.org/structure/5ZZ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6H1F", "url": "https://www.rcsb.org/structure/6H1F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JCO", "url": "https://www.rcsb.org/structure/6JCO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JEG", "url": "https://www.rcsb.org/structure/6JEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JEH", "url": "https://www.rcsb.org/structure/6JEH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LJE", "url": "https://www.rcsb.org/structure/6LJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LJF", "url": "https://www.rcsb.org/structure/6LJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9R", "url": "https://www.rcsb.org/structure/6Q9R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q9Z", "url": "https://www.rcsb.org/structure/6Q9Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QBF", "url": "https://www.rcsb.org/structure/6QBF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QW3", "url": "https://www.rcsb.org/structure/6QW3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P2B", "url": "https://www.rcsb.org/structure/7P2B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00626", "url": "http://pfam.xfam.org/family/PF00626", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P06396", "url": "https://pharos.nih.gov/targets/P06396", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053578", "url": "https://proconsortium.org/app/entry/PR:000053578", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053579", "url": "https://proconsortium.org/app/entry/PR:000053579", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053580", "url": "https://proconsortium.org/app/entry/PR:000053580", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053581", "url": "https://proconsortium.org/app/entry/PR:000053581", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053582", "url": "https://proconsortium.org/app/entry/PR:000053582", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053583", "url": "https://proconsortium.org/app/entry/PR:000053583", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053584", "url": "https://proconsortium.org/app/entry/PR:000053584", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053585", "url": "https://proconsortium.org/app/entry/PR:000053585", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053586", "url": "https://proconsortium.org/app/entry/PR:000053586", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053587", "url": "https://proconsortium.org/app/entry/PR:000053587", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053588", "url": "https://proconsortium.org/app/entry/PR:000053588", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053589", "url": "https://proconsortium.org/app/entry/PR:000053589", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P06396", "url": "http://purl.obolibrary.org/obo/PR_P06396", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9662361", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9662361", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P06396", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0A0MS51", "url": "https://www.uniprot.org/uniprot/A0A0A0MS51", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MS51-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MS51-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MT01", "url": "https://www.uniprot.org/uniprot/A0A0A0MT01", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MT01-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MT01-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RQL8", "url": "https://www.uniprot.org/uniprot/A0A0U1RQL8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RQL8-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RQL8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TND7", "url": "https://www.uniprot.org/uniprot/A0A8V8TND7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TND7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TND7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06396-1", "url": "https://www.uniprot.org/uniprot/P06396-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06396-2", "url": "https://www.uniprot.org/uniprot/P06396-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06396-3", "url": "https://www.uniprot.org/uniprot/P06396-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P06396-4", "url": "https://www.uniprot.org/uniprot/P06396-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0H8", "url": "https://www.uniprot.org/uniprot/Q5T0H8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0H8-1", "url": "https://www.uniprot.org/uniprot/Q5T0H8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0I0", "url": "https://www.uniprot.org/uniprot/Q5T0I0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T0I0-1", "url": "https://www.uniprot.org/uniprot/Q5T0I0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 782, "header": "sp|P06396-1|GELS_HUMAN Isoform 1 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MS51-1", "url": "", "sequence": { "sequence": "MAEEEALRGNSDPWPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 748, "header": "tr|A0A0A0MS51-1|GELS_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121286144, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394353.7", "url": "https://www.ensembl.org/id/ENST00000394353.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377882.3", "url": "https://www.ensembl.org/id/ENSP00000377882.3" } ] } }, { "isoform_ac": "A0A0A0MT01-1", "url": "", "sequence": { "sequence": "MNTGLTRLLWPSWLPDGDMSHPQPELFLFPKAQPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 767, "header": "tr|A0A0A0MT01-1|A0A0A0MT01_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121282452, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000449733.7", "url": "https://www.ensembl.org/id/ENST00000449733.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000409358.2", "url": "https://www.ensembl.org/id/ENSP00000409358.2" } ] } }, { "isoform_ac": "A0A0U1RQL8-1", "url": "", "sequence": { "sequence": "MEKLFCCFPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQ", "length": 232, "header": "tr|A0A0U1RQL8-1|GELS_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121312488, "end_pos": 121300103, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000477104.2", "url": "https://www.ensembl.org/id/ENST00000477104.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000489067.1", "url": "https://www.ensembl.org/id/ENSP00000489067.1" } ] } }, { "isoform_ac": "A0A8V8TND7-1", "url": "", "sequence": { "sequence": "MEKLFCCFDPAPLRLCPVSSQPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 755, "header": "tr|A0A8V8TND7-1|GELS_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121300103, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699558.1", "url": "https://www.ensembl.org/id/ENST00000699558.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514432.1", "url": "https://www.ensembl.org/id/ENSP00000514432.1" } ] } }, { "isoform_ac": "P06396-1", "url": "", "sequence": { "sequence": "MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 782, "header": "sp|P06396-1|GELS_HUMAN Isoform 1 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121299862, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373818.8", "url": "https://www.ensembl.org/id/ENST00000373818.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000362924.4", "url": "https://www.ensembl.org/id/ENSP00000362924.4" } ] } }, { "isoform_ac": "P06396-2", "url": "", "sequence": { "sequence": "MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 731, "header": "sp|P06396-2|GELS_HUMAN Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121301972, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373823.7", "url": "https://www.ensembl.org/id/ENST00000373823.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000362929.2", "url": "https://www.ensembl.org/id/ENSP00000362929.2" } ] } }, { "isoform_ac": "P06396-3", "url": "", "sequence": { "sequence": "MEKLFCCFPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 742, "header": "sp|P06396-3|GELS_HUMAN Isoform 3 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121300103, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373808.8", "url": "https://www.ensembl.org/id/ENST00000373808.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000362914.3", "url": "https://www.ensembl.org/id/ENSP00000362914.3" } ] } }, { "isoform_ac": "P06396-4", "url": "", "sequence": { "sequence": "MPLCTPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA", "length": 739, "header": "sp|P06396-4|GELS_HUMAN Isoform 4 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121286747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545652.6", "url": "https://www.ensembl.org/id/ENST00000545652.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000445823.1", "url": "https://www.ensembl.org/id/ENSP00000445823.1" } ] } }, { "isoform_ac": "Q5T0H8-1", "url": "", "sequence": { "sequence": "XKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVISRSWNTEGIGLPETSQLNDQISRHRNGGRGW", "length": 67, "header": "tr|Q5T0H8-1|GELS_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=2 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121326782, "end_pos": 121326582, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373806.1", "url": "https://www.ensembl.org/id/ENST00000373806.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000362912.2", "url": "https://www.ensembl.org/id/ENSP00000362912.2" } ] } }, { "isoform_ac": "Q5T0I0-1", "url": "", "sequence": { "sequence": "MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMS", "length": 260, "header": "tr|Q5T0I0-1|GELS_HUMAN Computationally mapped isoform of Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1 CANONICAL=P06396-1" }, "locus": { "chromosome": "9", "start_pos": 121332600, "end_pos": 121301972, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000432226", "url": "https://www.ensembl.org/id/ENST00000432226" }, { "database": "Ensembl Peptide", "id": "ENSP00000404226", "url": "https://www.ensembl.org/id/ENSP00000404226" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 309, "start_aa": "Thr", "end_pos": 309, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr309", "evidence": [ { "id": "P06396", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 31, "start_aa": "Ser", "end_pos": 31, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser31", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 35, "start_aa": "Ser", "end_pos": 35, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser35", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Thr", "end_pos": 402, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr402", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 408, "start_aa": "Ser", "end_pos": 408, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser408", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 408, "start_aa": "Ser", "end_pos": 408, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser408", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 411, "start_aa": "Ser", "end_pos": 411, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser411", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 411, "start_aa": "Ser", "end_pos": 411, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser411", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 411, "start_aa": "Ser", "end_pos": 411, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser411", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 412, "start_aa": "Ser", "end_pos": 412, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser412", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 412, "start_aa": "Ser", "end_pos": 412, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser412", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 426, "start_aa": "Thr", "end_pos": 426, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr426", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 430, "start_aa": "Ser", "end_pos": 430, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser430", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 431, "start_aa": "Thr", "end_pos": 431, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr431", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 431, "start_aa": "Thr", "end_pos": 431, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr431", "evidence": [ { "id": "P06396", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 51, "start_aa": "Ser", "end_pos": 51, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser51", "evidence": [ { "id": "P06396", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" } ] } ], "phosphorylation": [ { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser261" }, { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr361" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr409" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P06396", "url": "http://phospho.elm.eu.org/byAccession/P06396.html" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr465" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr465" }, { "start_pos": 603, "end_pos": 603, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr603" }, { "start_pos": 651, "end_pos": 651, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr651" }, { "start_pos": 742, "end_pos": 742, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" } ], "site_lbl": "Thr742" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by SRC; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ], "site_lbl": "Tyr86" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P06396", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "Identification of Tyr438 as the major in vitro c-Src phosphorylation site in human gelsolin: a mass spectrometric approach.", "journal": "Protein science : a publication of the Protein Society", "date": "1999", "authors": "De Corte V, Demol H, Goethals M, Van Damme J, Gettemans J, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" } ], "reference": [ { "type": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999", "authors": "Morishima N", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10469173", "url": "https://glygen.org/publication/PubMed/10469173" } ] }, { "title": "Caspase-3 and caspase-7 but not caspase-6 cleave Gas2 in vitro: implications for microfilament reorganization during apoptosis.", "journal": "Journal of cell science", "date": "1999", "authors": "Sgorbissa A, Benetti R, Marzinotto S, Schneider C, Brancolini C", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10564664", "url": "https://glygen.org/publication/PubMed/10564664" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "Prestin is the motor protein of cochlear outer hair cells.", "journal": "Nature", "date": "2000", "authors": "Zheng J, Shen W, He DZ, Long KB, Madison LD, Dallos P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9662361", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9662361" } ], "reference": [ { "type": "PubMed", "id": "10821263", "url": "https://glygen.org/publication/PubMed/10821263" } ] }, { "title": "Cleavage of the actin-capping protein alpha -adducin at Asp-Asp-Ser-Asp633-Ala by caspase-3 is preceded by its phosphorylation on serine 726 in cisplatin-induced apoptosis of renal epithelial cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "van de Water B, Tijdens IB, Verbrugge A, Huigsloot M, Dihal AA, Stevens JL, Jaken S, Mulder GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10823823", "url": "https://glygen.org/publication/PubMed/10823823" } ] }, { "title": "Identification of the cytolinker plectin as a major early in vivo substrate for caspase 8 during CD95- and tumor necrosis factor receptor-mediated apoptosis.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Stegh AH, Herrmann H, Lampel S, Weisenberger D, Andra K, Seper M, Wiche G, Krammer PH, Peter ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10891503", "url": "https://glygen.org/publication/PubMed/10891503" } ] }, { "title": "The neuronal microtubule-associated protein tau is a substrate for caspase-3 and an effector of apoptosis.", "journal": "Journal of neurochemistry", "date": "2000", "authors": "Fasulo L, Ugolini G, Visintin M, Bradbury A, Brancolini C, Verzillo V, Novak M, Cattaneo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "10899937", "url": "https://glygen.org/publication/PubMed/10899937" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.", "journal": "Cell death and differentiation", "date": "2001", "authors": "Byun Y, Chen F, Chang R, Trivedi M, Green KJ, Cryns VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "11423904", "url": "https://glygen.org/publication/PubMed/11423904" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Caspase-mediated cleavage of actin-binding and SH3-domain-containing proteins cortactin, HS1, and HIP-55 during apoptosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Chen YR, Kori R, John B, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "11689006", "url": "https://glygen.org/publication/PubMed/11689006" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "The calcium activation of gelsolin: insights from the 3A structure of the G4-G6/actin complex.", "journal": "J. Mol. Biol.", "date": "2002", "authors": "Choe Han, Burtnick Leslie D, Mejillano Marisan, Yin Helen L, Robinson Robert C, Choe Senyon", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "12460571", "url": "https://glygen.org/publication/PubMed/12460571" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Gelsolin-derived familial amyloidosis caused by asparagine or tyrosine substitution for aspartic acid at residue 187.", "journal": "Nature genetics", "date": "1992", "authors": "de la Chapelle A, Tolvanen R, Boysen G, Santavy J, Bleeker-Wagemakers L, Maury CP, Kere J", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "1338910", "url": "https://glygen.org/publication/PubMed/1338910" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "Calcium ion exchange in crystalline gelsolin.", "journal": "J. Mol. Biol.", "date": "2006", "authors": "Chumnarnsilpa Sakesit, Loonchanta Anantasak, Xue Bo, Choe Han, Urosev Dunja, Wang Hui, Lindberg Uno, Burtnick Leslie D, Robinson Robert C", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "16466744", "url": "https://glygen.org/publication/PubMed/16466744" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Ca2+ binding by domain 2 plays a critical role in the activation and stabilization of gelsolin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Nag S, Ma Q, Wang H, Chumnarnsilpa S, Lee WL, Larsson M, Kannan B, Hernandez-Valladares M, Burtnick LD, Robinson RC", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "19666512", "url": "https://glygen.org/publication/PubMed/19666512" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P06396-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Functional genomic screen for modulators of ciliogenesis and cilium length.", "journal": "Nature", "date": "2010", "authors": "Kim J, Lee JE, Heynen-Genel S, Suyama E, Ono K, Lee K, Ideker T, Aza-Blanc P, Gleeson JG", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "20393563", "url": "https://glygen.org/publication/PubMed/20393563" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "Finnish hereditary amyloidosis. Amino acid sequence homology between the amyloid fibril protein and human plasma gelsoline.", "journal": "FEBS Lett.", "date": "1990", "authors": "Maury C P, Alli K, Baumann M", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "2153578", "url": "https://glygen.org/publication/PubMed/2153578" } ] }, { "title": "Amyloid protein in familial amyloidosis (Finnish type) is homologous to gelsolin, an actin-binding protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1990", "authors": "Haltia M, Prelli F, Ghiso J, Kiuru S, Somer H, Palo J, Frangione B", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "2157434", "url": "https://glygen.org/publication/PubMed/2157434" } ] }, { "title": "Gelsolin variant (Asn-187) in familial amyloidosis, Finnish type.", "journal": "The Biochemical journal", "date": "1990", "authors": "Ghiso J, Haltia M, Prelli F, Novello J, Frangione B", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "2176481", "url": "https://glygen.org/publication/PubMed/2176481" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Structural states and dynamics of the D-loop in actin.", "journal": "Biophys. J.", "date": "2012", "authors": "Durer Zeynep A Oztug, Kudryashov Dmitri S, Sawaya Michael R, Altenbach Christian, Hubbell Wayne, Reisler Emil", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "23009842", "url": "https://glygen.org/publication/PubMed/23009842" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "iPTMnet", "id": "P06396", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06396" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P06396", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "Plasma and cytoplasmic gelsolins are encoded by a single gene and contain a duplicated actin-binding domain.", "journal": "Nature", "date": "1986", "authors": "Kwiatkowski DJ, Stossel TP, Orkin SH, Mole JE, Colten HR, Yin HL", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "3020431", "url": "https://glygen.org/publication/PubMed/3020431" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P06396", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Fusion of the High-mobility Group AT-Hook 2 (HMGA2) and the Gelsolin (GSN) Genes in Lipomas With t(9;12)(q33;q14) Chromosomal Translocation.", "journal": "In vivo (Athens, Greece)", "date": "2023", "authors": "Panagopoulos Ioannis, Andersen Kristin, Brunetti Marta, Gorunova Ludmila, Lund-Iversen Marius, Micci Francesca, Heim Sverre", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ], "reference": [ { "type": "PubMed", "id": "36881074", "url": "https://glygen.org/publication/PubMed/36881074" } ] }, { "title": "Role and therapeutic potential of gelsolin in atherosclerosis.", "journal": "Journal of molecular and cellular cardiology", "date": "2023-03-24", "authors": "Zhang Qiang, Xiao-HuiWen , Tang Shi-Lin, Zhao Zhen-Wang, Tang Chao-Ke", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ], "reference": [ { "type": "PubMed", "id": "36967105", "url": "https://glygen.org/publication/PubMed/36967105" } ] }, { "title": "mTORC2 interactome and localization determine aggressiveness of high-grade glioma cells through association with gelsolin.", "journal": "Scientific reports", "date": "2023-04-29", "authors": "Chantaravisoot Naphat, Wongkongkathep Piriya, Kalpongnukul Nuttiya, Pacharakullanon Narawit, Kaewsapsak Pornchai, Ariyachet Chaiyaboot, Loo Joseph A, Tamanoi Fuyuhiko, Pisitkun Trairak", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ], "reference": [ { "type": "PubMed", "id": "37120454", "url": "https://glygen.org/publication/PubMed/37120454" } ] }, { "title": "Gelsolin, an Actin-Binding Protein: Bioinformatic Analysis and Functional Significance in Urothelial Bladder Carcinoma.", "journal": "International journal of molecular sciences", "date": "2023-10-30", "authors": "Alsofyani Abeer A, Nedjadi Taoufik", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ], "reference": [ { "type": "PubMed", "id": "37958747", "url": "https://glygen.org/publication/PubMed/37958747" } ] }, { "title": "The regulation of plasma gelsolin by DNA methylation in ovarian cancer chemo-resistance.", "journal": "Journal of ovarian research", "date": "2024-01-12", "authors": "Manzoor Hafiza Bushra, Asare-Werehene Meshach, Pereira Satyajit Dey, Satyamoorthy Kapaettu, Tsang Benjamin K", "evidence": [ { "database": "RefSeq", "id": "NP_000168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000168" } ], "reference": [ { "type": "PubMed", "id": "38216951", "url": "https://glygen.org/publication/PubMed/38216951" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "P06396", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06396" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "Human plasma gelsolin binds to fibronectin.", "journal": "J. Biol. Chem.", "date": "1984", "authors": "Lind S E, Janmey P A", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "6092370", "url": "https://glygen.org/publication/PubMed/6092370" } ] }, { "title": "Microfilament reorganization during apoptosis: the role of Gas2, a possible substrate for ICE-like proteases.", "journal": "The EMBO journal", "date": "1995", "authors": "Brancolini C, Benedetti M, Schneider C", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "7489707", "url": "https://glygen.org/publication/PubMed/7489707" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Structure of gelsolin segment 1-actin complex and the mechanism of filament severing.", "journal": "Nature", "date": "1993", "authors": "McLaughlin P J, Gooch J T, Mannherz H G, Weeds A G", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "8395021", "url": "https://glygen.org/publication/PubMed/8395021" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Spectroscopic studies of a phosphoinositide-binding peptide from gelsolin: behavior in solutions of mixed solvent and anionic micelles.", "journal": "Biophys. J.", "date": "1995", "authors": "Xian W, Vegners R, Janmey P A, Braunlin W H", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "8599675", "url": "https://glygen.org/publication/PubMed/8599675" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "The plasma and cytoplasmic forms of human gelsolin differ in disulfide structure.", "journal": "Biochemistry", "date": "1996", "authors": "Wen D, Corina K, Chow EP, Miller S, Janmey PA, Pepinsky RB", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "8703941", "url": "https://glygen.org/publication/PubMed/8703941" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "Functional consequences of disulfide bond formation in gelsolin.", "journal": "FEBS letters", "date": "1997", "authors": "Allen PG", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "reference": [ { "type": "PubMed", "id": "9003812", "url": "https://glygen.org/publication/PubMed/9003812" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "Caspase-3-generated fragment of gelsolin: effector of morphological change in apoptosis.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Kothakota S, Azuma T, Reinhard C, Klippel A, Tang J, Chu K, McGarry TJ, Kirschner MW, Koths K, Kwiatkowski DJ, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9323209", "url": "https://glygen.org/publication/PubMed/9323209" } ] }, { "title": "Caspase-3 is required for alpha-fodrin cleavage but dispensable for cleavage of other death substrates in apoptosis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Janicke RU, Ng P, Sprengart ML, Porter AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9624143", "url": "https://glygen.org/publication/PubMed/9624143" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Caspase-3-induced gelsolin fragmentation contributes to actin cytoskeletal collapse, nucleolysis, and apoptosis of vascular smooth muscle cells exposed to proinflammatory cytokines.", "journal": "European journal of cell biology", "date": "1998", "authors": "Geng YJ, Azuma T, Tang JX, Hartwig JH, Muszynski M, Wu Q, Libby P, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-264870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870" } ], "reference": [ { "type": "PubMed", "id": "9930654", "url": "https://glygen.org/publication/PubMed/9930654" } ] } ], "pathway": [ { "id": "hsa:2934", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2934", "resource": "KEGG Pathway" }, { "id": "R-HSA-264870", "name": "Caspase-mediated cleavage of cytoskeletal proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264870", "resource": "Reactome", "description": "Caspase-mediated cleavage of cytoskeletal proteins" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-9662361", "name": "Sensory processing of sound by outer hair cells of the cochlea", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9662361", "resource": "Reactome", "description": "Sensory processing of sound by outer hair cells of the cochlea" }, { "id": "R-HSA-977225", "name": "Amyloid fiber formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" } ], "orthologs": [ { "uniprot_canonical_ac": "P13020-1", "protein_name": "Gelsolin", "gene_name": "Gsn", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPYRSSLLCALLLLALCALSPSHAATTSRGRAQERAPQSRVSEARPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLGYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVLRSQHVQVEEGSEPDAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELAA", "length": 780 }, "evidence": [ { "id": "45919215", "url": "http://www.informatics.jax.org/homology/45919215", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q68FP1-1", "protein_name": "Gelsolin", "gene_name": "Gsn", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAPYCSSLRSALLVLALCALSPSHAATASRGRAQERAPQSRVSETRPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFQGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGSEPEAMLQVLGPKPDLPQGTEDTAKEDAANRRLAKLYKVSNSGGSMSVSLVADENPFAQSALRSEDCFILDHGRDGKIFVWKGKQANMDERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVLVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTTPASTRLFQVRASSSGATRAVEVMPKAGALNSNDAFVLKTPSAAYLWVGTGASDAEKTGALELLKVLRAQHVQVEEGSEPDGFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDDYWSVDPLDRALAELAA", "length": 780 }, "evidence": [ { "id": "45919215", "url": "http://www.informatics.jax.org/homology/45919215", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 18, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "ficolin-1-rich granule lumen", "id": "GO:1904813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "podosome", "id": "GO:0002102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002102", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cortical actin cytoskeleton", "id": "GO:0030864", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030864", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin cap", "id": "GO:0030478", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030478", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "sarcoplasm", "id": "GO:0016528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016528", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase catalytic subunit binding", "id": "GO:0036313", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036313", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "myosin II binding", "id": "GO:0045159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045159", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "phosphatidylinositol-4,5-bisphosphate binding", "id": "GO:0005546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005546", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 31, "go_terms": [ { "name": "barbed-end actin filament capping", "id": "GO:0051016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051016", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin filament severing", "id": "GO:0051014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051014", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "positive regulation of protein processing in phagocytic vesicle", "id": "GO:1903923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903923", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cardiac muscle cell contraction", "id": "GO:0086003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0086003", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "phagocytosis, engulfment", "id": "GO:0006911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006911", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin filament polymerization", "id": "GO:0030041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "response to muscle stretch", "id": "GO:0035994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035994", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "relaxation of cardiac muscle", "id": "GO:0055119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055119", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin filament depolymerization", "id": "GO:0030042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030042", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "striated muscle atrophy", "id": "GO:0014891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014891", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "regulation of podosome assembly", "id": "GO:0071801", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071801", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "renal protein absorption", "id": "GO:0097017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097017", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "positive regulation of keratinocyte apoptotic process", "id": "GO:1902174", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902174", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "regulation of establishment of T cell polarity", "id": "GO:1903903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903903", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "regulation of plasma membrane raft polarization", "id": "GO:1903906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903906", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "regulation of receptor clustering", "id": "GO:1903909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903909", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway", "id": "GO:2001269", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001269", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "amyloid fibril formation", "id": "GO:1990000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990000", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin polymerization or depolymerization", "id": "GO:0008154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008154", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "sequestering of actin monomers", "id": "GO:0042989", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042989", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "positive regulation of actin nucleation", "id": "GO:0051127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051127", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "actin filament capping", "id": "GO:0051693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051693", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "hepatocyte apoptotic process", "id": "GO:0097284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097284", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "protein destabilization", "id": "GO:0031648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031648", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "negative regulation of viral entry into host cell", "id": "GO:0046597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046597", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" }, { "name": "cell projection assembly", "id": "GO:0030031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030031", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "gelsolin O-glycosylated 1 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-31 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Ser-31, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053578", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053578" } ] }, { "name": "gelsolin O-glycosylated 2 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-408 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P06396-1, Ser-408, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053579", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053579" } ] }, { "name": "gelsolin O-glycosylated 3 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-408 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Ser-408, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053580", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053580" } ] }, { "name": "gelsolin O-glycosylated 4 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-411 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P06396-1, Ser-411, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053581", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053581" } ] }, { "name": "gelsolin O-glycosylated 5 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-411 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Ser-411, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053582", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053582" } ] }, { "name": "gelsolin O-glycosylated 6 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-411 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P06396-1, Ser-411, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053583", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053583" } ] }, { "name": "gelsolin O-glycosylated 7 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-412 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P06396-1, Ser-412, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053584", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053584" } ] }, { "name": "gelsolin O-glycosylated 8 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-412 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Ser-412, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053585", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053585" } ] }, { "name": "gelsolin O-glycosylated 9 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Ser-430 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P06396-1, Ser-430, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053586", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053586" } ] }, { "name": "gelsolin O-glycosylated 10 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Thr-402 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Thr-402, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053587", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053587" } ] }, { "name": "gelsolin O-glycosylated 11 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Thr-426 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Thr-426, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053588", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053588" } ] }, { "name": "gelsolin O-glycosylated 12 (human)", "definition": "A gelsolin (human) that has been O-glycosylated at the residue equivalent to Thr-431 of the amino acid sequence represented by UniProtKB:P06396-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P06396-1, Thr-431, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053589", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053589" } ] } ], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylation on Tyr-86, Tyr-409, Tyr-465, Tyr-603 and Tyr-651 in vitro is induced in presence of phospholipids.", "evidence": [ { "database": "UniProtKB", "id": "P06396", "url": "https://www.uniprot.org/uniprot/P06396" }, { "database": "PubMed", "id": "10210201", "url": "https://glygen.org/publication/PubMed/10210201" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 31, 35, 51, 309, 402, 408, 411, 412, 426, 430, 431 ], "snv_sites": [ 35, 51, 107, 213, 307, 402, 408, 411, 412, 426, 430, 442, 481, 573, 591, 593, 676 ], "glycation_sites": [], "phosphorylation_sites": [ 86, 261, 361, 409, 465, 603, 651, 742 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 11 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 19 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }