{ "uniprot_canonical_ac": "P05817-1", "uniprot_ac": "P05817", "uniprot_id": "D11_DICDI", "mass": { "chemical_mass": 31009.0, "monoisotopic_mass": 31009.0 }, "refseq": { "ac": "XP_643441", "name": "adhesion modulation protein A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643441" }, "gene_names": [ { "name": "ampA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05817", "id": "P05817" }, { "name": "D11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05817", "id": "P05817" }, { "name": "DDB_G0275695", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05817", "id": "P05817" }, { "name": "ampA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643441", "id": "XP_643441" } ], "protein_names": [ { "name": "Prestalk D11 protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05817" }, { "name": "Adhesion modulation protein A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05817" }, { "name": "adhesion modulation protein A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643441", "id": "XP_643441" }, { "name": "prestalk D11 protein precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643441", "id": "XP_643441" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "ampA", "url": "https://www.uniprot.org/uniprot/P05817", "locus": {} } ], "crossref": [ { "id": "DDB_G0275695", "url": "http://dictybase.org/gene/DDB_G0275695", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8620026", "url": "https://www.ncbi.nlm.nih.gov/gene/8620026", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "ddi:DDB_G0275695", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0275695", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PR_P05817", "url": "http://purl.obolibrary.org/obo/PR_P05817", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_643441", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643441", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05817-1", "url": "https://www.uniprot.org/uniprot/P05817-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLNKLILLLILSSCLVLSVKSEVNVDCSLVRCAQPICKPHYRLNMTDSCCGRCEPCTDVACTLQVKYCQDGEVPTGCCPCTLPPTKPDCSLVKCARPVCKPYYRLNMTDSCCGRCEPCTGVACTLQIKYCKDGEVPTGCCPCTPQPTKKPDCSKVPCPKILKYCQEGELPTGCCPCTPQPTKKPDCSRVPCPKILKYCKEGELPTGCCPCTPQPTKKPDCSDVMCTMDIRYCKNGELPTGCCPCTPQETKVPDCSKAMCTMDIKYCKPGEKPFGCCPCRENLTQ", "length": 284, "header": "sp|P05817-1|D11_DICDI Isoform 1 of Prestalk D11 protein OS=Dictyostelium discoideum OX=44689 GN=ampA PE=2 SV=3 CANONICAL=P05817-1" }, "isoforms": [ { "isoform_ac": "P05817-1", "url": "", "sequence": { "sequence": "MLNKLILLLILSSCLVLSVKSEVNVDCSLVRCAQPICKPHYRLNMTDSCCGRCEPCTDVACTLQVKYCQDGEVPTGCCPCTLPPTKPDCSLVKCARPVCKPYYRLNMTDSCCGRCEPCTGVACTLQIKYCKDGEVPTGCCPCTPQPTKKPDCSKVPCPKILKYCQEGELPTGCCPCTPQPTKKPDCSRVPCPKILKYCKEGELPTGCCPCTPQPTKKPDCSDVMCTMDIRYCKNGELPTGCCPCTPQETKVPDCSKAMCTMDIKYCKPGEKPFGCCPCRENLTQ", "length": 284, "header": "sp|P05817-1|D11_DICDI Isoform 1 of Prestalk D11 protein OS=Dictyostelium discoideum OX=44689 GN=ampA PE=2 SV=3 CANONICAL=P05817-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Structure of the Dictyostelium discoideum prestalk D11 gene and protein.", "journal": "Mol. Cell. Biol.", "date": "1985", "authors": "Barklis E, Pontius B, Lodish H F", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "reference": [ { "type": "PubMed", "id": "4033661", "url": "https://glygen.org/publication/PubMed/4033661" } ] } ], "pathway": [ { "id": "ddi:DDB_G0275695", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0275695", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "cell periphery", "id": "GO:0071944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "cell-cell adhesion", "id": "GO:0098609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "actin filament polymerization", "id": "GO:0030041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "pattern specification process", "id": "GO:0007389", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007389", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "cell-substrate adhesion", "id": "GO:0031589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031589", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "macropinocytosis", "id": "GO:0044351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044351", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "sorocarp development", "id": "GO:0030587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030587", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "sorocarp morphogenesis", "id": "GO:0031288", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031288", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" }, { "name": "chemotaxis to folate", "id": "GO:0043326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043326", "evidence": [ { "database": "UniProtKB", "id": "P05817", "url": "https://www.uniprot.org/uniprot/P05817" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" }, { "start_pos": 281, "end_pos": 283, "annotation": "n_glycosylation_sequon" }, { "start_pos": 44, "end_pos": 46, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 106, "end_pos": 108 }, { "start_pos": 281, "end_pos": 283 }, { "start_pos": 44, "end_pos": 46 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }