{ "uniprot_canonical_ac": "P05556-1", "uniprot_ac": "P05556", "uniprot_id": "ITB1_HUMAN", "mass": { "chemical_mass": 88415.0, "monoisotopic_mass": 88415.0 }, "refseq": { "ac": "NP_002202", "name": "integrin beta-1 isoform 1A precursor", "summary": "Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" }, "gene_names": [ { "name": "ITGB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05556", "id": "P05556" }, { "name": "CD29; FNRB; GPIIA; MDF2; MSK12; VLA-BETA; VLAB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202", "id": "NP_002202" }, { "name": "FNRB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05556", "id": "P05556" }, { "name": "ITGB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202", "id": "NP_002202" }, { "name": "MDF2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05556", "id": "P05556" }, { "name": "MSK12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05556", "id": "P05556" } ], "protein_names": [ { "name": "Integrin beta-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05556" }, { "name": "Fibronectin receptor subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05556" }, { "name": "GPIIA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05556" }, { "name": "Glycoprotein IIa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05556" }, { "name": "VLA-4 subunit beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05556" }, { "name": "integrin VLA-4 beta subunit; very late activation protein, beta polypeptide; glycoprotein IIa; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); integrin beta 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202", "id": "NP_002202" }, { "name": "integrin beta-1 isoform 1A precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202", "id": "NP_002202" } ], "function": [ { "annotation": "(Microbial infection) Acts as a receptor for Cytomegalovirus/HHV-5.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "20660204", "url": "https://glygen.org/publication/PubMed/20660204" } ] }, { "annotation": "(Microbial infection) Acts as a receptor for Epstein-Barr virus/HHV-4.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "17945327", "url": "https://glygen.org/publication/PubMed/17945327" } ] }, { "annotation": "(Microbial infection) Acts as a receptor for Mammalian reovirus.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "16501085", "url": "https://glygen.org/publication/PubMed/16501085" } ] }, { "annotation": "(Microbial infection) In case of HIV-1 infection, integrin ITGA5:ITGB1 binding to extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "annotation": "(Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human echoviruses 1 and 8.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "8411387", "url": "https://glygen.org/publication/PubMed/8411387" } ] }, { "annotation": "(Microbial infection) Integrin ITGA2:ITGB1 acts as a receptor for Human rotavirus.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "12941907", "url": "https://glygen.org/publication/PubMed/12941907" } ] }, { "annotation": "(Microbial infection) Integrin ITGA5:ITGB1 acts as a receptor for Human parvovirus B19.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "12907437", "url": "https://glygen.org/publication/PubMed/12907437" } ] }, { "annotation": "(Microbial infection) Interacts with CotH proteins expressed by fungi of the order mucorales, the causative agent of mucormycosis, which plays an important role in epithelial cell invasion by the fungi (PubMed:32487760). Integrin ITGA3:ITGB1 may act as a receptor for R.delemar CotH7 in alveolar epithelial cells, which may be an early step in pulmonary mucormycosis disease progression (PubMed:32487760).", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "32487760", "url": "https://glygen.org/publication/PubMed/32487760" } ] }, { "annotation": "(Microbial infection) May serve as a receptor for adhesin A (nadA) of N.meningitidis.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "21471204", "url": "https://glygen.org/publication/PubMed/21471204" } ] }, { "annotation": "Although cytoplasmic splice variants do not change the ligand-specificity of a beta 1 integrin, this review explains how clustering of different splice variants triggers signaling pathways that lead to a different cellular response. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" }, { "database": "PubMed", "id": "11779688", "url": "https://glygen.org/publication/PubMed/11779688" } ] }, { "annotation": "DPP-4 exacerbates LPS-induced endothelial cells inflammation via integrin-alpha5beta1/FAK/AKT signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" }, { "database": "PubMed", "id": "38184221", "url": "https://glygen.org/publication/PubMed/38184221" } ] }, { "annotation": "Integrinbeta-1 in disorders and cancers: molecular mechanisms and therapeutic targets. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" }, { "database": "PubMed", "id": "38279122", "url": "https://glygen.org/publication/PubMed/38279122" } ] }, { "annotation": "Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha-4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha-11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha-4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, alpha-2/beta-1, alpha-6/beta-1 and alpha-7/beta-1 are receptors for lamimin. Integrin alpha-6/beta-1 (ITGA6:ITGB1) is present in oocytes and is involved in sperm-egg fusion (By similarity). Integrin alpha-4/beta-1 is a receptor for VCAM1. It recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. Integrin alpha-3/beta-1 is a receptor for epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Integrin alpha-V/beta-1 is a receptor for vitronectin. Beta-1 integrins recognize the sequence R-G-D in a wide array of ligands. When associated with alpha-7 integrin, regulates cell adhesion and laminin matrix deposition. Involved in promoting endothelial cell motility and angiogenesis. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process and the formation of mineralized bone nodules. May be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and RACK1, serves as a platform for SRC activation or inactivation. Plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. ITGA4:ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415, PubMed:24789099). ITGA4:ITGB1 and ITGA5:ITGB1 bind to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGA5:ITGB1 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881). ITGA5:ITGB1 acts as a receptor for fibronectin FN1 and mediates R-G-D-dependent cell adhesion to FN1 (PubMed:33962943). ITGA5:ITGB1 is a receptor for IL1B and binding is essential for IL1B signaling (PubMed:29030430). ITGA5:ITGB3 is a receptor for soluble CD40LG and is required for CD40/CD40LG signaling (PubMed:31331973). Plays an important role in myoblast differentiation and fusion during skeletal myogenesis (By similarity). ITGA9:ITGB1 may play a crucial role in SVEP1/polydom-mediated myoblast cell adhesion (By similarity). Integrins ITGA9:ITGB1 and ITGA4:ITGB1 repress PRKCA-mediated L-type voltage-gated channel Ca(2+) influx and ROCK-mediated calcium sensitivity in vascular smooth muscle cells via their interaction with SVEP1, thereby inhibit vasocontraction (PubMed:35802072).", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "21768292", "url": "https://glygen.org/publication/PubMed/21768292" }, { "database": "PubMed", "id": "24789099", "url": "https://glygen.org/publication/PubMed/24789099" }, { "database": "PubMed", "id": "10455171", "url": "https://glygen.org/publication/PubMed/10455171" }, { "database": "PubMed", "id": "7523423", "url": "https://glygen.org/publication/PubMed/7523423" }, { "database": "PubMed", "id": "18804435", "url": "https://glygen.org/publication/PubMed/18804435" }, { "database": "PubMed", "id": "19064666", "url": "https://glygen.org/publication/PubMed/19064666" }, { "database": "UniProtKB", "id": "P09055", "url": "https://www.uniprot.org/uniprot/P09055#function" }, { "database": "PubMed", "id": "16256741", "url": "https://glygen.org/publication/PubMed/16256741" }, { "database": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" }, { "database": "PubMed", "id": "12473654", "url": "https://glygen.org/publication/PubMed/12473654" }, { "database": "UniProtKB", "id": "P07228", "url": "https://www.uniprot.org/uniprot/P07228#function" }, { "database": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" }, { "database": "PubMed", "id": "17158881", "url": "https://glygen.org/publication/PubMed/17158881" }, { "database": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" }, { "database": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" }, { "database": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" }, { "database": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" }, { "database": "PubMed", "id": "33962943", "url": "https://glygen.org/publication/PubMed/33962943" }, { "database": "PubMed", "id": "35802072", "url": "https://glygen.org/publication/PubMed/35802072" } ] }, { "annotation": "Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" } ] }, { "annotation": "Interferes with isoform 1 resulting in a dominant negative effect on cell adhesion and migration (in vitro).", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "PubMed", "id": "2249781", "url": "https://glygen.org/publication/PubMed/2249781" } ] }, { "annotation": "Isoform 5 displaces isoform 1 in striated muscles.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#function" }, { "database": "UniProtKB", "id": "P09055", "url": "https://www.uniprot.org/uniprot/P09055#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1253206418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1253206418" }, { "id": "rs1253206418", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1253206418" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 214, "end_pos": 214, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCA); o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "32926017", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T214", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767684488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767684488" }, { "id": "rs767684488", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767684488" }, { "id": "rs767684488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767684488" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 596, "end_pos": 596, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TST->NST); o-glyco-site-loss (T->N).", "chr_id": "10", "chr_pos": "32911592", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T596", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1165302915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1165302915" }, { "id": "rs1165302915", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1165302915#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 94, "end_pos": 94, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT); n-glyco-sequon-gain (NKN->NKS).", "chr_id": "10", "chr_pos": "32911571", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N94", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05556", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05556" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 99, "end_pos": 99, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->NRN); o-glyco-site-loss (S->N).", "chr_id": "10", "chr_pos": "32929902", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S99", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs755190764", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755190764" }, { "id": "rs755190764", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755190764" }, { "id": "rs755190764", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755190764" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 197, "end_pos": 197, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STT->NTT).", "chr_id": "10", "chr_pos": "32926067", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S197", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1283484385", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1283484385" }, { "id": "rs1283484385", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1283484385" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 224, "end_pos": 224, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLT->NLT).", "chr_id": "10", "chr_pos": "32925986", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S224", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762480349", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762480349" }, { "id": "rs762480349", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762480349" }, { "id": "rs762480349", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762480349" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 307, "end_pos": 307, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNM->NNT).", "chr_id": "10", "chr_pos": "32923607", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M307", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199649717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199649717" }, { "id": "rs199649717", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199649717" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 33, "end_pos": 33, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAK->NAT).", "chr_id": "10", "chr_pos": "32932570", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768647991", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768647991" }, { "id": "rs768647991", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768647991" }, { "id": "rs768647991", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768647991" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 363, "end_pos": 363, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "10", "chr_pos": "32922297", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N363", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1565823559", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1565823559" }, { "id": "rs1565823559", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1565823559" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 377, "end_pos": 377, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS).", "chr_id": "10", "chr_pos": "32920385_32920386insATTGTATGCATCAATGATCAACTGAATTACATTGCTAGAATTTGCAGATAAT", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S377", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201228879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201228879" }, { "id": "rs201228879", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201228879" }, { "id": "rs201228879", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201228879" }, { "id": "rs201228879", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201228879#frequency_tab" }, { "id": "rs201228879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201228879" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 394, "end_pos": 394, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "10", "chr_pos": "32920002", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T394", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201354011", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201354011" }, { "id": "rs201354011", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs201354011" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 417, "end_pos": 417, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->HIS).", "chr_id": "10", "chr_pos": "32920265", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N417", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372397463", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372397463" }, { "id": "rs372397463", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372397463" }, { "id": "rs372397463", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372397463" }, { "id": "rs372397463", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372397463#frequency_tab" }, { "id": "rs372397463", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372397463" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 417, "end_pos": 417, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "10", "chr_pos": "32920264", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N417", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs571920234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs571920234" }, { "id": "rs571920234", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs571920234" }, { "id": "rs571920234", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs571920234" }, { "id": "rs571920234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs571920234" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 419, "end_pos": 419, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIF).", "chr_id": "10", "chr_pos": "32920267", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S419", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767041384", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767041384" }, { "id": "rs767041384", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767041384" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 522, "end_pos": 522, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSN).", "chr_id": "10", "chr_pos": "32912017", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S522", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1187434879", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1187434879" }, { "id": "rs1187434879", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1187434879" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 52, "end_pos": 52, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSI).", "chr_id": "10", "chr_pos": "32930043", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T52", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1199396834", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199396834" }, { "id": "rs1199396834", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1199396834#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 547, "end_pos": 547, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IYS->NYS).", "chr_id": "10", "chr_pos": "32911954", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I547", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753990803", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753990803" }, { "id": "rs753990803", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753990803" }, { "id": "rs753990803", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753990803#frequency_tab" }, { "id": "rs753990803", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753990803" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 584, "end_pos": 584, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "10", "chr_pos": "32911627", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N584", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1016123180", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1016123180" }, { "id": "rs1016123180", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1016123180#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 584, "end_pos": 584, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->SYT).", "chr_id": "10", "chr_pos": "32911628", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N584", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1402621179", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1402621179" }, { "id": "rs1402621179", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1402621179" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 588, "end_pos": 588, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "10", "chr_pos": "32911616", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S588", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1281690625", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1281690625" }, { "id": "rs1281690625", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1281690625" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 593, "end_pos": 593, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "10", "chr_pos": "32911601", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S593", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759345589", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759345589" }, { "id": "rs759345589", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759345589" }, { "id": "rs759345589", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759345589" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 593, "end_pos": 593, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "32911590", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S593", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759345589", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759345589" }, { "id": "rs759345589", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759345589" }, { "id": "rs759345589", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759345589" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 597, "end_pos": 597, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "32911590", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S597", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1309745209", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1309745209" }, { "id": "rs1309745209", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1309745209" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 669, "end_pos": 669, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->YIT).", "chr_id": "10", "chr_pos": "32910382", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N669", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1474589579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474589579" }, { "id": "rs1474589579", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474589579#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 774, "end_pos": 774, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAK->NAT).", "chr_id": "10", "chr_pos": "32908378", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K774", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1469203752", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469203752" }, { "id": "rs1469203752", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469203752" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 97, "end_pos": 97, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->HRS).", "chr_id": "10", "chr_pos": "32929909", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N97", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755317981", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755317981" }, { "id": "rs755317981", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755317981" }, { "id": "rs755317981", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755317981#frequency_tab" }, { "id": "rs755317981", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755317981" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 97, "end_pos": 97, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "10", "chr_pos": "32929908", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N97", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755317981", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755317981" }, { "id": "rs755317981", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755317981" }, { "id": "rs755317981", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755317981#frequency_tab" }, { "id": "rs755317981", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755317981" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 97, "end_pos": 97, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "10", "chr_pos": "32929908", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N97", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 760, "end_pos": 761, "sequence_org": "RR", "sequence_mut": "AA", "comment": "No effect on interaction with ACAP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "22645133", "url": "https://glygen.org/publication/PubMed/22645133" } ] }, { "start_pos": 762, "end_pos": 763, "sequence_org": "EF", "sequence_mut": "AA", "comment": "Slightly reduces interaction with ACAP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ] }, { "start_pos": 762, "end_pos": 767, "sequence_org": "EFAKFE", "sequence_mut": "AAAAAA", "comment": "Strongly reduces interaction with ACAP1 and ability to recycle; does not affect heterodimerization with ITGA5.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "22645133", "url": "https://glygen.org/publication/PubMed/22645133" } ] }, { "start_pos": 765, "end_pos": 765, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces interaction with ACAP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ] }, { "start_pos": 766, "end_pos": 767, "sequence_org": "FE", "sequence_mut": "AA", "comment": "Slightly reduces interaction with ACAP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ] }, { "start_pos": 768, "end_pos": 769, "sequence_org": "KE", "sequence_mut": "AA", "comment": "No effect on interaction with ACAP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "22645133", "url": "https://glygen.org/publication/PubMed/22645133" } ] }, { "start_pos": 778, "end_pos": 778, "sequence_org": "G", "sequence_mut": "Q", "comment": "Loss of beta-1A interaction with FLNA and FLNB.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "11807098", "url": "https://glygen.org/publication/PubMed/11807098" } ] }, { "start_pos": 783, "end_pos": 783, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on cell surface location but impairs interaction with TNS3 and PEAK1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] }, { "start_pos": 786, "end_pos": 786, "sequence_org": "A", "sequence_mut": "P", "comment": "Loss of beta-1A interaction with FLNA and FLNB.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "11807098", "url": "https://glygen.org/publication/PubMed/11807098" } ] }, { "start_pos": 786, "end_pos": 791, "sequence_org": "AVTTVV", "sequence_mut": "PINNFK", "comment": "Does not interact with ITGB1BP1.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "11807099", "url": "https://glygen.org/publication/PubMed/11807099" } ] }, { "start_pos": 787, "end_pos": 787, "sequence_org": "V", "sequence_mut": "T", "comment": "Reduces interaction with ITGB1BP1, but not with FERMT2 or TLN1. Inhibits fibronectin deposition and mineralized bone nodules formation.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "21768292", "url": "https://glygen.org/publication/PubMed/21768292" } ] }, { "start_pos": 788, "end_pos": 788, "sequence_org": "T", "sequence_mut": "D", "comment": "Strongly reduces ITGB1BP1 binding; when associated with D-790.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "23317506", "url": "https://glygen.org/publication/PubMed/23317506" } ] }, { "start_pos": 790, "end_pos": 790, "sequence_org": "V", "sequence_mut": "D", "comment": "Strongly reduces ITGB1BP1 binding; when associated with D-788.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "23317506", "url": "https://glygen.org/publication/PubMed/23317506" } ] }, { "start_pos": 792, "end_pos": 792, "sequence_org": "N", "sequence_mut": "A", "comment": "Strongly reduces ITGB1BP1 binding; when associated with A-795.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "23317506", "url": "https://glygen.org/publication/PubMed/23317506" } ] }, { "start_pos": 795, "end_pos": 795, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on cell surface location but impairs interaction with TNS3 and PEAK1. Strongly reduces ITGB1BP1 binding; when associated with A-792.", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "23317506", "url": "https://glygen.org/publication/PubMed/23317506" }, { "database": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "97.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05556" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "common_name": "Human" } ], "gene": [ { "name": "ITGB1", "url": "https://www.uniprot.org/uniprot/P05556", "locus": { "chromosome": "10", "start_pos": 32887273, "end_pos": 33005792, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000150093", "url": "https://www.ensembl.org/id/ENSG00000150093" } ] } } ], "crossref": [ { "id": "ENSG00000150093", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000150093", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05556", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05556", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL1905", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1905", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ITGB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ITGB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3688", "url": "https://www.ncbi.nlm.nih.gov/gene/3688", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6153", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6153", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P05556", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05556*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002369", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002369", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012896", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012896", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013111", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013111", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014836", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014836", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015439", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015439", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015812", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016201", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016201", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032695", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032695", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036349", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036349", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036465", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036465", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040622", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040622", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3688", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3688", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "135630", "url": "http://www.omim.org/entry/135630", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05556", "url": "https://www.nextprot.org/entry/NX_P05556", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P05556", "url": "https://oglcnac.org/atlas/detail/P05556", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NCVCGAC", "url": "https://omabrowser.org/oma/group/NCVCGAC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5475862at2759", "url": "http://www.orthodb.org/?query=5475862at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10082", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10082", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10082:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10082:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3G9W", "url": "https://www.rcsb.org/structure/3G9W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T9K", "url": "https://www.rcsb.org/structure/3T9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VI3", "url": "https://www.rcsb.org/structure/3VI3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VI4", "url": "https://www.rcsb.org/structure/3VI4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DX9", "url": "https://www.rcsb.org/structure/4DX9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WJK", "url": "https://www.rcsb.org/structure/4WJK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WK0", "url": "https://www.rcsb.org/structure/4WK0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WK2", "url": "https://www.rcsb.org/structure/4WK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WK4", "url": "https://www.rcsb.org/structure/4WK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CEB", "url": "https://www.rcsb.org/structure/7CEB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7CEC", "url": "https://www.rcsb.org/structure/7CEC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NWL", "url": "https://www.rcsb.org/structure/7NWL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NXD", "url": "https://www.rcsb.org/structure/7NXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00362", "url": "http://pfam.xfam.org/family/PF00362", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07965", "url": "http://pfam.xfam.org/family/PF07965", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07974", "url": "http://pfam.xfam.org/family/PF07974", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08725", "url": "http://pfam.xfam.org/family/PF08725", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17205", "url": "http://pfam.xfam.org/family/PF17205", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18372", "url": "http://pfam.xfam.org/family/PF18372", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05556", "url": "https://pharos.nih.gov/targets/P05556", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053565", "url": "https://proconsortium.org/app/entry/PR:000053565", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053566", "url": "https://proconsortium.org/app/entry/PR:000053566", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053567", "url": "https://proconsortium.org/app/entry/PR:000053567", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053568", "url": "https://proconsortium.org/app/entry/PR:000053568", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P05556", "url": "http://purl.obolibrary.org/obo/PR_P05556", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1566977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566977", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-446343", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-447041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875513", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9830674", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9830674", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P05556", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A7I2V2F9", "url": "https://www.uniprot.org/uniprot/A0A7I2V2F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2F9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2F9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2T4", "url": "https://www.uniprot.org/uniprot/A0A7I2V2T4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2T4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2T4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V348", "url": "https://www.uniprot.org/uniprot/A0A7I2V348", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V348-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V348-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T3", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5T3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5T3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5Z8", "url": "https://www.uniprot.org/uniprot/A0A7I2V5Z8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V5Z8-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V5Z8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JNE0", "url": "https://www.uniprot.org/uniprot/C9JNE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JNE0-1", "url": "https://www.uniprot.org/uniprot/C9JNE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JPK5", "url": "https://www.uniprot.org/uniprot/C9JPK5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JPK5-1", "url": "https://www.uniprot.org/uniprot/C9JPK5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQW5", "url": "https://www.uniprot.org/uniprot/E7EQW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQW5-1", "url": "https://www.uniprot.org/uniprot/E7EQW5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EUI6", "url": "https://www.uniprot.org/uniprot/E7EUI6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EUI6-1", "url": "https://www.uniprot.org/uniprot/E7EUI6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLR6", "url": "https://www.uniprot.org/uniprot/E9PLR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLR6-1", "url": "https://www.uniprot.org/uniprot/E9PLR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQJ2", "url": "https://www.uniprot.org/uniprot/E9PQJ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQJ2-1", "url": "https://www.uniprot.org/uniprot/E9PQJ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C4K3", "url": "https://www.uniprot.org/uniprot/H7C4K3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C4K3-1", "url": "https://www.uniprot.org/uniprot/H7C4K3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C4N8", "url": "https://www.uniprot.org/uniprot/H7C4N8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C4N8-1", "url": "https://www.uniprot.org/uniprot/H7C4N8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556-1", "url": "https://www.uniprot.org/uniprot/P05556-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556-2", "url": "https://www.uniprot.org/uniprot/P05556-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556-3", "url": "https://www.uniprot.org/uniprot/P05556-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556-4", "url": "https://www.uniprot.org/uniprot/P05556-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05556-5", "url": "https://www.uniprot.org/uniprot/P05556-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E4", "url": "https://www.uniprot.org/uniprot/Q5T3E4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E4-1", "url": "https://www.uniprot.org/uniprot/Q5T3E4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E5", "url": "https://www.uniprot.org/uniprot/Q5T3E5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E5-1", "url": "https://www.uniprot.org/uniprot/Q5T3E5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E6", "url": "https://www.uniprot.org/uniprot/Q5T3E6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T3E6-1", "url": "https://www.uniprot.org/uniprot/Q5T3E6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 798, "header": "sp|P05556-1|ITB1_HUMAN Isoform 1 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2F9-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 794, "header": "tr|A0A7I2V2F9-1|A0A7I2V2F9_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678591.1", "url": "https://www.ensembl.org/id/ENST00000678591.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502883.1", "url": "https://www.ensembl.org/id/ENSP00000502883.1" } ] } }, { "isoform_ac": "A0A7I2V2T4-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSVNIFTGRNAYFCTM", "length": 65, "header": "tr|A0A7I2V2T4-1|A0A7I2V2T4_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32930007, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678479.1", "url": "https://www.ensembl.org/id/ENST00000678479.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503110.1", "url": "https://www.ensembl.org/id/ENSP00000503110.1" } ] } }, { "isoform_ac": "A0A7I2V348-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTRKPCSELWTFIPGCLI", "length": 793, "header": "tr|A0A7I2V348-1|A0A7I2V348_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32888955, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000609742.3", "url": "https://www.ensembl.org/id/ENST00000609742.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000503306.1", "url": "https://www.ensembl.org/id/ENSP00000503306.1" } ] } }, { "isoform_ac": "A0A7I2V5T3-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNMGGS", "length": 380, "header": "tr|A0A7I2V5T3-1|A0A7I2V5T3_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32921691, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676895.1", "url": "https://www.ensembl.org/id/ENST00000676895.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504454.1", "url": "https://www.ensembl.org/id/ENSP00000504454.1" } ] } }, { "isoform_ac": "A0A7I2V5Z8-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNAFF", "length": 379, "header": "tr|A0A7I2V5Z8-1|A0A7I2V5Z8_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32920389, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678120.1", "url": "https://www.ensembl.org/id/ENST00000678120.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504784.1", "url": "https://www.ensembl.org/id/ENSP00000504784.1" } ] } }, { "isoform_ac": "C9JNE0-1", "url": "", "sequence": { "sequence": "MPTSARCDDLEALK", "length": 14, "header": "tr|C9JNE0-1|C9JNE0_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=4 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32930026, "end_pos": 32929985, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000472147.1", "url": "https://www.ensembl.org/id/ENST00000472147.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000420416.1", "url": "https://www.ensembl.org/id/ENSP00000420416.1" } ] } }, { "isoform_ac": "C9JPK5-1", "url": "", "sequence": { "sequence": "MYCIVIVILIFHYFLSDTSHKMFCSFFFLTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNYGRKAGL", "length": 809, "header": "tr|C9JPK5-1|C9JPK5_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32932691, "end_pos": 32907072, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000474568.6", "url": "https://www.ensembl.org/id/ENST00000474568.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000420282.2", "url": "https://www.ensembl.org/id/ENSP00000420282.2" } ] } }, { "isoform_ac": "E7EQW5-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVK", "length": 163, "header": "tr|E7EQW5-1|E7EQW5_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32928152, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000480226.5", "url": "https://www.ensembl.org/id/ENST00000480226.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417537.1", "url": "https://www.ensembl.org/id/ENSP00000417537.1" } ] } }, { "isoform_ac": "E7EUI6-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSVSKTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 801, "header": "tr|E7EUI6-1|E7EUI6_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000488494.6", "url": "https://www.ensembl.org/id/ENST00000488494.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000418725.2", "url": "https://www.ensembl.org/id/ENSP00000418725.2" } ] } }, { "isoform_ac": "E9PLR6-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPI", "length": 143, "header": "tr|E9PLR6-1|E9PLR6_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32928212, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000534049.5", "url": "https://www.ensembl.org/id/ENST00000534049.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431326.1", "url": "https://www.ensembl.org/id/ENSP00000431326.1" } ] } }, { "isoform_ac": "E9PQJ2-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAE", "length": 104, "header": "tr|E9PQJ2-1|E9PQJ2_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32929886, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000528877.5", "url": "https://www.ensembl.org/id/ENST00000528877.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436214.1", "url": "https://www.ensembl.org/id/ENSP00000436214.1" } ] } }, { "isoform_ac": "H7C4K3-1", "url": "", "sequence": { "sequence": "MPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 741, "header": "tr|H7C4K3-1|H7C4K3_HUMAN Computationally mapped isoform of Integrin beta OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32930026, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676964.1", "url": "https://www.ensembl.org/id/ENST00000676964.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504267.1", "url": "https://www.ensembl.org/id/ENSP00000504267.1" } ] } }, { "isoform_ac": "H7C4N8-1", "url": "", "sequence": { "sequence": "XDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGV", "length": 108, "header": "tr|H7C4N8-1|H7C4N8_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32912064, "end_pos": 32911527, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000494395.1", "url": "https://www.ensembl.org/id/ENST00000494395.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000417799.1", "url": "https://www.ensembl.org/id/ENSP00000417799.1" } ] } }, { "isoform_ac": "P05556-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 798, "header": "sp|P05556-1|ITB1_HUMAN Isoform 1 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000302278.8", "url": "https://www.ensembl.org/id/ENST00000302278.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000303351.3", "url": "https://www.ensembl.org/id/ENSP00000303351.3" } ] } }, { "isoform_ac": "P05556-2", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTVSYKTSKKQSGL", "length": 789, "header": "sp|P05556-2|ITB1_HUMAN Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32908332, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676460.1", "url": "https://www.ensembl.org/id/ENST00000676460.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504641.1", "url": "https://www.ensembl.org/id/ENSP00000504641.1" } ] } }, { "isoform_ac": "P05556-3", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTSLSVAQPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP", "length": 825, "header": "sp|P05556-3|ITB1_HUMAN Isoform 3 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901608, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677310.1", "url": "https://www.ensembl.org/id/ENST00000677310.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504508.1", "url": "https://www.ensembl.org/id/ENSP00000504508.1" } ] } }, { "isoform_ac": "P05556-4", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP", "length": 819, "header": "sp|P05556-4|ITB1_HUMAN Isoform 4 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901608, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676659.1", "url": "https://www.ensembl.org/id/ENST00000676659.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502979.1", "url": "https://www.ensembl.org/id/ENSP00000502979.1" } ] } }, { "isoform_ac": "P05556-5", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNYGRKAGL", "length": 801, "header": "sp|P05556-5|ITB1_HUMAN Isoform 5 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32907072, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423113.6", "url": "https://www.ensembl.org/id/ENST00000423113.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000388694.1", "url": "https://www.ensembl.org/id/ENSP00000388694.1" } ] } }, { "isoform_ac": "Q5T3E4-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCT", "length": 49, "header": "tr|Q5T3E4-1|Q5T3E4_HUMAN Computationally mapped isoform of Integrin subunit beta 1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32932521, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414670.2", "url": "https://www.ensembl.org/id/ENST00000414670.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000400544.1", "url": "https://www.ensembl.org/id/ENSP00000400544.1" } ] } }, { "isoform_ac": "Q5T3E5-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDI", "length": 89, "header": "tr|Q5T3E5-1|Q5T3E5_HUMAN Computationally mapped isoform of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000417122", "url": "https://www.ensembl.org/id/ENST00000417122" }, { "database": "Ensembl Peptide", "id": "ENSP00000404546", "url": "https://www.ensembl.org/id/ENSP00000404546" } ] } }, { "isoform_ac": "Q5T3E6-1", "url": "", "sequence": { "sequence": "MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFK", "length": 136, "header": "tr|Q5T3E6-1|Q5T3E6_HUMAN Computationally mapped isoform of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=1 CANONICAL=P05556-1" }, "locus": { "chromosome": "10", "start_pos": 32935558, "end_pos": 32901573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437302", "url": "https://www.ensembl.org/id/ENST00000437302" }, { "database": "Ensembl Peptide", "id": "ENSP00000398029", "url": "https://www.ensembl.org/id/ENSP00000398029" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 102, "start_aa": "Thr", "end_pos": 102, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr102", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05556" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TVMPYISTTPAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 191, "start_aa": "Thr", "end_pos": 202, "end_aa": "Lys", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 212, "start_aa": "Asn", "end_pos": 212, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn212", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "4WK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK2" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 214, "start_aa": "Thr", "end_pos": 214, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr214", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P05556", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05556" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 269, "start_aa": "Asn", "end_pos": 269, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn269", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "22451694", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22451694" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "3VI4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3VI4" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "3VI3", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3VI3" }, { "id": "7NWL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NWL" }, { "id": "4WJK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WJK" }, { "id": "4WK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK0" }, { "id": "4WK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK2" }, { "id": "4WK4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK4" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 363, "start_aa": "Asn", "end_pos": 363, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn363", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "7NWL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NWL" }, { "id": "4WJK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WJK" }, { "id": "4WK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK0" }, { "id": "4WK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK2" }, { "id": "4WK4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK4" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LSEGVTISYK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 389, "start_aa": "Leu", "end_pos": 398, "end_aa": "Lys", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 394, "start_aa": "Thr", "end_pos": 394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr394", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 406, "start_aa": "Asn", "end_pos": 406, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn406", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 406, "start_aa": "Asn", "end_pos": 406, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn406", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "22451694", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22451694" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "3VI4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3VI4" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "3VI3", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3VI3" }, { "id": "7NWL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NWL" }, { "id": "4WJK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WJK" }, { "id": "4WK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK0" }, { "id": "4WK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK2" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 417, "start_aa": "Asn", "end_pos": 417, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn417", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "7NWL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NWL" }, { "id": "4WJK", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WJK" }, { "id": "4WK0", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK0" }, { "id": "4WK2", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK2" }, { "id": "4WK4", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4WK4" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 481, "start_aa": "Asn", "end_pos": 481, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn481", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 481, "start_aa": "Asn", "end_pos": 481, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn481", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 481, "start_aa": "Asn", "end_pos": 481, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn481", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 481, "start_aa": "Asn", "end_pos": 481, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn481", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 520, "start_aa": "Asn", "end_pos": 520, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn520", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 584, "start_aa": "Asn", "end_pos": 584, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn584", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 586, "start_aa": "Thr", "end_pos": 586, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr586", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 588, "start_aa": "Ser", "end_pos": 588, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser588", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05556" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 593, "start_aa": "Ser", "end_pos": 593, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser593", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 596, "start_aa": "Thr", "end_pos": 596, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr596", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 597, "start_aa": "Ser", "end_pos": 597, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser597", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 598, "start_aa": "Thr", "end_pos": 598, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr598", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 602, "start_aa": "Ser", "end_pos": 602, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser602", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23165GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71051TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94831VI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "33962943", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33962943" }, { "id": "7NXD", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NXD" }, { "id": "7NWL", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/7NWL" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 94, "start_aa": "Asn", "end_pos": 94, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn94", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05556" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "P05556", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "1414", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1414" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 97, "start_aa": "Asn", "end_pos": 97, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn97", "evidence": [ { "id": "P05556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 99, "start_aa": "Ser", "end_pos": 99, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser99", "evidence": [ { "id": "P05556", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "22661428", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22661428" }, { "id": "P05556", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05556" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G14996IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G16529MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G45209NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G48954CA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G50489VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G56318NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G56549DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G73759SD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G80537QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G86696LV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G86753CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G91905FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G92574YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G98366ZJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "glytoucan_ac": "G99074EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "283", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/283" }, { "id": "8620897", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8620897" } ] } ], "phosphorylation": [ { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser224" }, { "start_pos": 226, "end_pos": 226, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr226" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser327" }, { "start_pos": 333, "end_pos": 333, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr333" }, { "start_pos": 777, "end_pos": 777, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Thr777" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "IntAct", "id": "P05556", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05556*" }, { "database": "PubMed", "id": "21806020", "url": "https://glygen.org/publication/PubMed/21806020" }, { "database": "phospho.ELM", "id": "P05556", "url": "http://phospho.elm.eu.org/byAccession/P05556.html" }, { "database": "PubMed", "id": "23092334", "url": "https://glygen.org/publication/PubMed/23092334" } ], "site_lbl": "Tyr783" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "10896784", "url": "https://glygen.org/publication/PubMed/10896784" }, { "database": "PubMed", "id": "19005162", "url": "https://glygen.org/publication/PubMed/19005162" } ], "site_lbl": "Ser785" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P05556", "url": "http://phospho.elm.eu.org/byAccession/P05556.html" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "14660602", "url": "https://glygen.org/publication/PubMed/14660602" }, { "database": "PubMed", "id": "14502569", "url": "https://glygen.org/publication/PubMed/14502569" }, { "database": "PubMed", "id": "19005162", "url": "https://glygen.org/publication/PubMed/19005162" }, { "database": "PubMed", "id": "19115199", "url": "https://glygen.org/publication/PubMed/19115199" } ], "site_lbl": "Thr788" }, { "start_pos": 789, "end_pos": 789, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "phospho.ELM", "id": "P05556", "url": "http://phospho.elm.eu.org/byAccession/P05556.html" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "14660602", "url": "https://glygen.org/publication/PubMed/14660602" }, { "database": "PubMed", "id": "14502569", "url": "https://glygen.org/publication/PubMed/14502569" }, { "database": "PubMed", "id": "19005162", "url": "https://glygen.org/publication/PubMed/19005162" }, { "database": "PubMed", "id": "19115199", "url": "https://glygen.org/publication/PubMed/19115199" }, { "database": "PubMed", "id": "19887187", "url": "https://glygen.org/publication/PubMed/19887187" } ], "site_lbl": "Thr789" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "P05556", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05556*" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" }, { "database": "PubMed", "id": "21806020", "url": "https://glygen.org/publication/PubMed/21806020" } ], "site_lbl": "Tyr795" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P05556", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis.", "journal": "Cell", "date": "1999", "authors": "Munger JS, Huang X, Kawakatsu H, Griffiths MJ, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA, Rifkin DB, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10025398", "url": "https://glygen.org/publication/PubMed/10025398" } ] }, { "title": "Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1999", "authors": "Ganapathy ME, Prasad PD, Huang W, Seth P, Leibach FH, Ganapathy V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "10087012", "url": "https://glygen.org/publication/PubMed/10087012" } ] }, { "title": "Carboxy-terminal conversion of profibrillin to fibrillin at a basic site by PACE/furin-like activity required for incorporation in the matrix.", "journal": "Journal of cell science", "date": "1999", "authors": "Raghunath M, Putnam EA, Ritty T, Hamstra D, Park ES, Tschodrich-Rotter M, Peters R, Rehemtulla A, Milewicz DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10198291", "url": "https://glygen.org/publication/PubMed/10198291" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Expression, purification and crystallization of a BH domain from the GTPase regulatory protein associated with focal adhesion kinase.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "1999", "authors": "Sheffield PJ, Derewenda U, Taylor J, Parsons TJ, Derewenda ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10232922", "url": "https://glygen.org/publication/PubMed/10232922" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor.", "journal": "Blood", "date": "1999-07-15", "authors": "Barillari G, Sgadari C, Fiorelli V, Samaniego F, Colombini S, Manzari V, Modesti A, Nair B C, Cafaro A, St\u00fcrzl M, Ensoli B", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "10397733", "url": "https://glygen.org/publication/PubMed/10397733" } ] }, { "title": "Ultrastructural distribution of 36-kD microfibril-associated glycoprotein (MAGP-36) in human and bovine tissues.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1999", "authors": "Toyoshima T, Yamashita K, Furuichi H, Shishibori T, Itano T, Kobayashi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10424889", "url": "https://glygen.org/publication/PubMed/10424889" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "A novel protease-docking function of integrin at invadopodia.", "journal": "The Journal of biological chemistry", "date": "1999-08-27", "authors": "Mueller S C, Ghersi G, Akiyama S K, Sang Q X, Howard L, Pineiro-Sanchez M, Nakahara H, Yeh Y, Chen W T", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "10455171", "url": "https://glygen.org/publication/PubMed/10455171" } ] }, { "title": "Association of frabin with the actin cytoskeleton is essential for microspike formation through activation of Cdc42 small G protein.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Umikawa M, Obaishi H, Nakanishi H, Satoh-Horikawa K, Takahashi K, Hotta I, Matsuura Y, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10464238", "url": "https://glygen.org/publication/PubMed/10464238" } ] }, { "title": "The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Joberty G, Perlungher RR, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10490598", "url": "https://glygen.org/publication/PubMed/10490598" } ] }, { "title": "Identification and molecular cloning of p75/AIRM1, a novel member of the sialoadhesin family that functions as an inhibitory receptor in human natural killer cells.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Falco M, Biassoni R, Bottino C, Vitale M, Sivori S, Augugliaro R, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10499918", "url": "https://glygen.org/publication/PubMed/10499918" } ] }, { "title": "Sema3A-induced growth-cone collapse is mediated by Rac1 amino acids 17-32.", "journal": "Current biology : CB", "date": "1999", "authors": "Vastrik I, Eickholt BJ, Walsh FS, Ridley A, Doherty P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10508610", "url": "https://glygen.org/publication/PubMed/10508610" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.", "journal": "Cell", "date": "1999", "authors": "Tamagnone L, Artigiani S, Chen H, He Z, Ming GI, Song H, Chedotal A, Winberg ML, Goodman CS, Poo M, Tessier-Lavigne M, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "10520995", "url": "https://glygen.org/publication/PubMed/10520995" } ] }, { "title": "HGF induces FAK activation and integrin-mediated adhesion in MTLn3 breast carcinoma cells.", "journal": "International journal of cancer", "date": "1999", "authors": "Beviglia L, Kramer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "10521801", "url": "https://glygen.org/publication/PubMed/10521801" } ] }, { "title": "Dependence of Dbl and Dbs transformation on MEK and NF-kappaB activation.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Whitehead IP, Lambert QT, Glaven JA, Abe K, Rossman KL, Mahon GM, Trzaskos JM, Kay R, Campbell SL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10523665", "url": "https://glygen.org/publication/PubMed/10523665" } ] }, { "title": "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Movilla N, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "10523675", "url": "https://glygen.org/publication/PubMed/10523675" } ] }, { "title": "Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member.", "journal": "FEBS letters", "date": "1999", "authors": "Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10526156", "url": "https://glygen.org/publication/PubMed/10526156" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "Tropoelastin binding to fibulins, nidogen-2 and other extracellular matrix proteins.", "journal": "FEBS letters", "date": "1999", "authors": "Sasaki T, Gohring W, Miosge N, Abrams WR, Rosenbloom J, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10544250", "url": "https://glygen.org/publication/PubMed/10544250" } ] }, { "title": "Identification and characterization of hPEM-2, a guanine nucleotide exchange factor specific for Cdc42.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Reid T, Bathoorn A, Ahmadian MR, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10559246", "url": "https://glygen.org/publication/PubMed/10559246" } ] }, { "title": "Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Tatsumoto T, Xie X, Blumenthal R, Okamoto I, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10579713", "url": "https://glygen.org/publication/PubMed/10579713" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Nodelman IM, Bowman GD, Lindberg U, Schutt CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10600384", "url": "https://glygen.org/publication/PubMed/10600384" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "Homophilic NCAM interactions interfere with L1 stimulated neurite outgrowth.", "journal": "FEBS letters", "date": "1999", "authors": "Kristiansen LV, Marques FA, Soroka V, Ronn LC, Kiselyov V, Pedersen N, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10611478", "url": "https://glygen.org/publication/PubMed/10611478" } ] }, { "title": "A novel muscle-specific beta 1 integrin binding protein (MIBP) that modulates myogenic differentiation.", "journal": "J. Cell Biol.", "date": "1999", "authors": "Li J, Mayne R, Wu C", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "10613898", "url": "https://glygen.org/publication/PubMed/10613898" } ] }, { "title": "Endogenous, hyperactive Rac3 controls proliferation of breast cancer cells by a p21-activated kinase-dependent pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Mira JP, Benard V, Groffen J, Sanders LC, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "10618392", "url": "https://glygen.org/publication/PubMed/10618392" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "Role of the latent transforming growth factor beta binding protein 1 in fibrillin-containing microfibrils in bone cells in vitro and in vivo.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2000", "authors": "Dallas SL, Keene DR, Bruder SP, Saharinen J, Sakai LY, Mundy GR, Bonewald LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10646116", "url": "https://glygen.org/publication/PubMed/10646116" } ] }, { "title": "Switch in the protein tyrosine phosphatase associated with human CD100 semaphorin at terminal B-cell differentiation stage.", "journal": "Blood", "date": "2000", "authors": "Billard C, Delaire S, Raffoux E, Bensussan A, Boumsell L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "10648410", "url": "https://glygen.org/publication/PubMed/10648410" } ] }, { "title": "TrioGEF1 controls Rac- and Cdc42-dependent cell structures through the direct activation of rhoG.", "journal": "Journal of cell science", "date": "2000", "authors": "Blangy A, Vignal E, Schmidt S, Debant A, Gauthier-Rouviere C, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "10652265", "url": "https://glygen.org/publication/PubMed/10652265" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Diaphanous-related formins bridge Rho GTPase and Src tyrosine kinase signaling.", "journal": "Molecular cell", "date": "2000", "authors": "Tominaga T, Sahai E, Chardin P, McCormick F, Courtneidge SA, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10678165", "url": "https://glygen.org/publication/PubMed/10678165" } ] }, { "title": "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.", "journal": "Human molecular genetics", "date": "2000", "authors": "Prakash SK, Paylor R, Jenna S, Lamarche-Vane N, Armstrong DL, Xu B, Mancini MA, Zoghbi HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10699171", "url": "https://glygen.org/publication/PubMed/10699171" } ] }, { "title": "Molecular cloning and characterization of a novel human STE20-like kinase, hSLK.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Yamada E, Tsujikawa K, Itoh S, Kameda Y, Kohama Y, Yamamoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10699464", "url": "https://glygen.org/publication/PubMed/10699464" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "Cooperative effect of hepatocyte growth factor and fibronectin in anchorage-independent survival of mammary carcinoma cells: requirement for phosphatidylinositol 3-kinase activity.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "2000", "authors": "Qiao H, Saulnier R, Patryzkat A, Rahimi N, Raptis L, Rossiter J, Tremblay E, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "10714768", "url": "https://glygen.org/publication/PubMed/10714768" } ] }, { "title": "The CMRF-35H gene structure predicts for an independently expressed member of an ITIM/ITAM pair of molecules localized to human chromosome 17.", "journal": "Tissue antigens", "date": "2000", "authors": "Clark GJ, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10746781", "url": "https://glygen.org/publication/PubMed/10746781" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "A MAP kinase-signaling pathway mediates neurite outgrowth on L1 and requires Src-dependent endocytosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2000", "authors": "Schmid RS, Pruitt WM, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10818153", "url": "https://glygen.org/publication/PubMed/10818153" } ] }, { "title": "Trio combines with dock to regulate Pak activity during photoreceptor axon pathfinding in Drosophila.", "journal": "Cell", "date": "2000", "authors": "Newsome TP, Schmidt S, Dietzl G, Keleman K, Asling B, Debant A, Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "10847683", "url": "https://glygen.org/publication/PubMed/10847683" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "A human homolog of the C. elegans polarity determinant Par-6 links Rac and Cdc42 to PKCzeta signaling and cell transformation.", "journal": "Current biology : CB", "date": "2000", "authors": "Qiu RG, Abo A, Steven Martin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "10873802", "url": "https://glygen.org/publication/PubMed/10873802" } ] }, { "title": "Homo-oligomer formation by basigin, an immunoglobulin superfamily member, via its N-terminal immunoglobulin domain.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Yoshida S, Shibata M, Yamamoto S, Hagihara M, Asai N, Takahashi M, Mizutani S, Muramatsu T, Kadomatsu K", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "10880960", "url": "https://glygen.org/publication/PubMed/10880960" } ] }, { "title": "Phosphorylation of the beta1 integrin cytoplasmic domain: toward an understanding of function and mechanism.", "journal": "Experimental cell research", "date": "2000", "authors": "Mulrooney J, Foley K, Vineberg S, Barreuther M, Grabel L", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "10896784", "url": "https://glygen.org/publication/PubMed/10896784" } ] }, { "title": "CD147 is tightly associated with lactate transporters MCT1 and MCT4 and facilitates their cell surface expression.", "journal": "The EMBO journal", "date": "2000", "authors": "Kirk P, Wilson MC, Heddle C, Brown MH, Barclay AN, Halestrap AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "10921872", "url": "https://glygen.org/publication/PubMed/10921872" } ] }, { "title": "Specific sequence motif of 8-Cys repeats of TGF-beta binding proteins, LTBPs, creates a hydrophobic interaction surface for binding of small latent TGF-beta.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Saharinen J, Keski-Oja J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10930463", "url": "https://glygen.org/publication/PubMed/10930463" } ] }, { "title": "Fibrillin-rich microfibrils of the extracellular matrix: ultrastructure and assembly.", "journal": "Micron (Oxford, England : 1993)", "date": "2001", "authors": "Sherratt MJ, Wess TJ, Baldock C, Ashworth J, Purslow PP, Shuttleworth CA, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "10936461", "url": "https://glygen.org/publication/PubMed/10936461" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Estrogen-induced activation of Erk-1 and Erk-2 requires the G protein-coupled receptor homolog, GPR30, and occurs via trans-activation of the epidermal growth factor receptor through release of HB-EGF.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2000", "authors": "Filardo EJ, Quinn JA, Bland KI, Frackelton AR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "11043579", "url": "https://glygen.org/publication/PubMed/11043579" } ] }, { "title": "Integrins as receptors for laminins.", "journal": "Microscopy research and technique", "date": "2000", "authors": "Belkin AM, Stepp MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11054877", "url": "https://glygen.org/publication/PubMed/11054877" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11058585", "url": "https://glygen.org/publication/PubMed/11058585" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor.", "journal": "The Biochemical journal", "date": "2000", "authors": "Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11085924", "url": "https://glygen.org/publication/PubMed/11085924" } ] }, { "title": "Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2001", "authors": "Souchelnytskyi S, Ronnstrand L, Heldin CH, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11100470", "url": "https://glygen.org/publication/PubMed/11100470" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Identification of CD72 as a lymphocyte receptor for the class IV semaphorin CD100: a novel mechanism for regulating B cell signaling.", "journal": "Immunity", "date": "2000", "authors": "Kumanogoh A, Watanabe C, Lee I, Wang X, Shi W, Araki H, Hirata H, Iwahori K, Uchida J, Yasui T, Matsumoto M, Yoshida K, Yakura H, Pan C, Parnes JR, Kikutani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "11114375", "url": "https://glygen.org/publication/PubMed/11114375" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Evidence that furin is an authentic transforming growth factor-beta1-converting enzyme.", "journal": "The American journal of pathology", "date": "2001", "authors": "Dubois CM, Blanchette F, Laprise MH, Leduc R, Grondin F, Seidah NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11141505", "url": "https://glygen.org/publication/PubMed/11141505" } ] }, { "title": "Rac2 is an essential regulator of neutrophil nicotinamide adenine dinucleotide phosphate oxidase activation in response to specific signaling pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Kim C, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "11145705", "url": "https://glygen.org/publication/PubMed/11145705" } ] }, { "title": "Differential localization of Rho GTPases in live cells: regulation by hypervariable regions and RhoGDI binding.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Michaelson D, Silletti J, Murphy G, D'Eustachio P, Rush M, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "11149925", "url": "https://glygen.org/publication/PubMed/11149925" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "Identification of NKp80, a novel triggering molecule expressed by human NK cells.", "journal": "European journal of immunology", "date": "2001", "authors": "Vitale M, Falco M, Castriconi R, Parolini S, Zambello R, Semenzato G, Biassoni R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11265639", "url": "https://glygen.org/publication/PubMed/11265639" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "A new focal adhesion protein that interacts with integrin-linked kinase and regulates cell adhesion and spreading.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Tu Y, Huang Y, Zhang Y, Hua Y, Wu C", "evidence": [ { "database": "Reactome", "id": "R-HSA-446343", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343" } ], "reference": [ { "type": "PubMed", "id": "11331308", "url": "https://glygen.org/publication/PubMed/11331308" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Reuther GW, Lambert QT, Booden MA, Wennerberg K, Becknell B, Marcucci G, Sondek J, Caligiuri MA, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11373293", "url": "https://glygen.org/publication/PubMed/11373293" } ] }, { "title": "Processing of immunosuppressive pro-TGF-beta 1,2 by human glioblastoma cells involves cytoplasmic and secreted furin-like proteases.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Leitlein J, Aulwurm S, Waltereit R, Naumann U, Wagenknecht B, Garten W, Weller M, Platten M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "11390472", "url": "https://glygen.org/publication/PubMed/11390472" } ] }, { "title": "Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Furukawa Y, Kawasoe T, Daigo Y, Nishiwaki T, Ishiguro H, Takahashi M, Kitayama J, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11396949", "url": "https://glygen.org/publication/PubMed/11396949" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Rich, a rho GTPase-activating protein domain-containing protein involved in signaling by Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Richnau N, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11431473", "url": "https://glygen.org/publication/PubMed/11431473" } ] }, { "title": "PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.", "journal": "Journal of biochemistry", "date": "2001", "authors": "Shibata H, Oishi K, Yamagiwa A, Matsumoto M, Mukai H, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11432776", "url": "https://glygen.org/publication/PubMed/11432776" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Protein interaction studies of MAGP-1 with tropoelastin and fibrillin-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Jensen SA, Reinhardt DP, Gibson MA, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "11481325", "url": "https://glygen.org/publication/PubMed/11481325" } ] }, { "title": "NTB-A [correction of GNTB-A], a novel SH2D1A-associated surface molecule contributing to the inability of natural killer cells to kill Epstein-Barr virus-infected B cells in X-linked lymphoproliferative disease.", "journal": "The Journal of experimental medicine", "date": "2001", "authors": "Bottino C, Falco M, Parolini S, Marcenaro E, Augugliaro R, Sivori S, Landi E, Biassoni R, Notarangelo LD, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11489943", "url": "https://glygen.org/publication/PubMed/11489943" } ] }, { "title": "Structural basis of MHC class I recognition by natural killer cell receptors.", "journal": "Immunological reviews", "date": "2001", "authors": "Sawicki MW, Dimasi N, Natarajan K, Wang J, Margulies DH, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11513152", "url": "https://glygen.org/publication/PubMed/11513152" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "The gene encoding the immunoregulatory signaling molecule CMRF-35A localized to human chromosome 17 in close proximity to other members of the CMRF-35 family.", "journal": "Tissue antigens", "date": "2001", "authors": "Clark GJ, Cooper B, Fitzpatrick S, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11556966", "url": "https://glygen.org/publication/PubMed/11556966" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "Endocytic protein intersectin-l regulates actin assembly via Cdc42 and N-WASP.", "journal": "Nature cell biology", "date": "2001", "authors": "Hussain NK, Jenna S, Glogauer M, Quinn CC, Wasiak S, Guipponi M, Antonarakis SE, Kay BK, Stossel TP, Lamarche-Vane N, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11584276", "url": "https://glygen.org/publication/PubMed/11584276" } ] }, { "title": "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.", "journal": "Cell", "date": "2001", "authors": "Wong K, Ren XR, Huang YZ, Xie Y, Liu G, Saito H, Tang H, Wen L, Brady-Kalnay SM, Mei L, Wu JY, Xiong WC, Rao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11672528", "url": "https://glygen.org/publication/PubMed/11672528" } ] }, { "title": "Kinectin is a key effector of RhoG microtubule-dependent cellular activity.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Vignal E, Blangy A, Martin M, Gauthier-Rouviere C, Fort P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11689693", "url": "https://glygen.org/publication/PubMed/11689693" } ] }, { "title": "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3.", "journal": "Oncogene", "date": "2001", "authors": "De Toledo M, Coulon V, Schmidt S, Fort P, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11704860", "url": "https://glygen.org/publication/PubMed/11704860" } ] }, { "title": "Characterization of STEF, a guanine nucleotide exchange factor for Rac1, required for neurite growth.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Matsuo N, Hoshino M, Yoshizawa M, Nabeshima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11707441", "url": "https://glygen.org/publication/PubMed/11707441" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "Fluorescence resonance energy transfer studies on the interaction between the lactate transporter MCT1 and CD147 provide information on the topology and stoichiometry of the complex in situ.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wilson MC, Meredith D, Halestrap AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "11719518", "url": "https://glygen.org/publication/PubMed/11719518" } ] }, { "title": "Interaction between krit1 and icap1alpha infers perturbation of integrin beta1-mediated angiogenesis in the pathogenesis of cerebral cavernous malformation.", "journal": "Hum. Mol. Genet.", "date": "2001", "authors": "Zhang J, Clatterbuck RE, Rigamonti D, Chang DD, Dietz HC", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "11741838", "url": "https://glygen.org/publication/PubMed/11741838" } ] }, { "title": "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Dan C, Nath N, Liberto M, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11756552", "url": "https://glygen.org/publication/PubMed/11756552" } ] }, { "title": "Estrogen action via the G protein-coupled receptor, GPR30: stimulation of adenylyl cyclase and cAMP-mediated attenuation of the epidermal growth factor receptor-to-MAPK signaling axis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Filardo EJ, Quinn JA, Frackelton AR Jr, Bland KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "11773440", "url": "https://glygen.org/publication/PubMed/11773440" } ] }, { "title": "AR and ER interaction with a p21-activated kinase (PAK6).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Lee SR, Ramos SM, Ko A, Masiello D, Swanson KD, Lu ML, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11773441", "url": "https://glygen.org/publication/PubMed/11773441" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "Splice variants of human beta 1 integrins: origin, biosynthesis and functions.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2002", "authors": "Armulik A", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" } ], "reference": [ { "type": "PubMed", "id": "11779688", "url": "https://glygen.org/publication/PubMed/11779688" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.", "journal": "Molecular cell", "date": "2002", "authors": "Krugmann S, Anderson KE, Ridley SH, Risso N, McGregor A, Coadwell J, Davidson K, Eguinoa A, Ellson CD, Lipp P, Manifava M, Ktistakis N, Painter G, Thuring JW, Cooper MA, Lim ZY, Holmes AB, Dove SK, Michell RH, Grewal A, Nazarian A, Erdjument-Bromage H, Tempst P, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804589", "url": "https://glygen.org/publication/PubMed/11804589" } ] }, { "title": "ARAP1: a point of convergence for Arf and Rho signaling.", "journal": "Molecular cell", "date": "2002", "authors": "Miura K, Jacques KM, Stauffer S, Kubosaki A, Zhu K, Hirsch DS, Resau J, Zheng Y, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11804590", "url": "https://glygen.org/publication/PubMed/11804590" } ] }, { "title": "Different splice variants of filamin-B affect myogenesis, subcellular distribution, and determine binding to integrin [beta] subunits.", "journal": "The Journal of cell biology", "date": "2002", "authors": "van der Flier A, Kuikman I, Kramer D, Geerts D, Kreft M, Takafuta T, Shapiro SS, Sonnenberg A", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "11807098", "url": "https://glygen.org/publication/PubMed/11807098" } ] }, { "title": "The integrin cytoplasmic domain-associated protein ICAP-1 binds and regulates Rho family GTPases during cell spreading.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Degani S, Balzac F, Brancaccio M, Guazzone S, Retta SF, Silengo L, Eva A, Tarone G", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "11807099", "url": "https://glygen.org/publication/PubMed/11807099" } ] }, { "title": "A reassessment of the MAdCAM-1 structure and its role in integrin recognition.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Dando J, Wilkinson KW, Ortlepp S, King DJ, Brady RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11807247", "url": "https://glygen.org/publication/PubMed/11807247" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.", "journal": "Medicinal research reviews", "date": "2002", "authors": "Yusuf-Makagiansar H, Anderson ME, Yakovleva TV, Murray JS, Siahaan TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11857637", "url": "https://glygen.org/publication/PubMed/11857637" } ] }, { "title": "Structure and function of major histocompatibility complex (MHC) class I specific receptors expressed on human natural killer (NK) cells.", "journal": "Molecular immunology", "date": "2002", "authors": "Borrego F, Kabat J, Kim DK, Lieto L, Maasho K, Pena J, Solana R, Coligan JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11858820", "url": "https://glygen.org/publication/PubMed/11858820" } ] }, { "title": "KIR: diverse, rapidly evolving receptors of innate and adaptive immunity.", "journal": "Annual review of immunology", "date": "2002", "authors": "Vilches C, Parham P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11861603", "url": "https://glygen.org/publication/PubMed/11861603" } ] }, { "title": "The Human Rho-GEF trio and its target GTPase RhoG are involved in the NGF pathway, leading to neurite outgrowth.", "journal": "Current biology : CB", "date": "2002", "authors": "Estrach S, Schmidt S, Diriong S, Penna A, Blangy A, Fort P, Debant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11864571", "url": "https://glygen.org/publication/PubMed/11864571" } ] }, { "title": "Distinct role of phosphatidylinositol 3-kinase and Rho family GTPases in Vav3-induced cell transformation, cell motility, and morphological changes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sachdev P, Zeng L, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11884391", "url": "https://glygen.org/publication/PubMed/11884391" } ] }, { "title": "Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.", "journal": "Nature cell biology", "date": "2002", "authors": "Krendel M, Zenke FT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11912491", "url": "https://glygen.org/publication/PubMed/11912491" } ] }, { "title": "Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Fournier HN, Dupe-Manet S, Bouvard D, Lacombe ML, Marie C, Block MR, Albiges-Rizo C", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "11919189", "url": "https://glygen.org/publication/PubMed/11919189" } ] }, { "title": "Rac function and regulation during Drosophila development.", "journal": "Nature", "date": "2002", "authors": "Hakeda-Suzuki S, Ng J, Tzu J, Dietzl G, Sun Y, Harms M, Nardine T, Luo L, Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "11919634", "url": "https://glygen.org/publication/PubMed/11919634" } ] }, { "title": "Association of Fyn and Lyn with the proline-rich domain of glycoprotein VI regulates intracellular signaling.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Suzuki-Inoue K, Tulasne D, Shen Y, Bori-Sanz T, Inoue O, Jung SM, Moroi M, Andrews RK, Berndt MC, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "11943772", "url": "https://glygen.org/publication/PubMed/11943772" } ] }, { "title": "Active site residues of cyclophilin A are crucial for its signaling activity via CD147.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Yurchenko V, Zybarth G, O'Connor M, Dai WW, Franchin G, Hao T, Guo H, Hung HC, Toole B, Gallay P, Sherry B, Bukrinsky M", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "11943775", "url": "https://glygen.org/publication/PubMed/11943775" } ] }, { "title": "A structural perspective on MHC class I recognition by killer cell immunoglobulin-like receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Boyington JC, Sun PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955593", "url": "https://glygen.org/publication/PubMed/11955593" } ] }, { "title": "Asymmetric ligand recognition by the activating natural killer cell receptor NKG2D, a symmetric homodimer.", "journal": "Molecular immunology", "date": "2002", "authors": "Strong RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955595", "url": "https://glygen.org/publication/PubMed/11955595" } ] }, { "title": "Recognition of immunoglobulins by Fcgamma receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Radaev S, Sun P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955599", "url": "https://glygen.org/publication/PubMed/11955599" } ] }, { "title": "Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain.", "journal": "International journal of molecular medicine", "date": "2002", "authors": "De Langhe S, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "11956649", "url": "https://glygen.org/publication/PubMed/11956649" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "SWAP-70 is a guanine-nucleotide-exchange factor that mediates signalling of membrane ruffling.", "journal": "Nature", "date": "2002", "authors": "Shinohara M, Terada Y, Iwamatsu A, Shinohara A, Mochizuki N, Higuchi M, Gotoh Y, Ihara S, Nagata S, Itoh H, Fukui Y, Jessberger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "11961559", "url": "https://glygen.org/publication/PubMed/11961559" } ] }, { "title": "Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).", "journal": "Clinical & experimental metastasis", "date": "2002", "authors": "Tsuji T, Kawada Y, Kai-Murozono M, Komatsu S, Han SA, Takeuchi K, Mizushima H, Miyazaki K, Irimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "11964076", "url": "https://glygen.org/publication/PubMed/11964076" } ] }, { "title": "RhoGDI-3 regulates RhoG and targets this protein to the Golgi complex through its unique N-terminal domain.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Brunet N, Morin A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "11967128", "url": "https://glygen.org/publication/PubMed/11967128" } ] }, { "title": "The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mu D, Cambier S, Fjellbirkeland L, Baron JL, Munger JS, Kawakatsu H, Sheppard D, Broaddus VC, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "11970960", "url": "https://glygen.org/publication/PubMed/11970960" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.", "journal": "The Biochemical journal", "date": "2002", "authors": "Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12071859", "url": "https://glygen.org/publication/PubMed/12071859" } ] }, { "title": "A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.", "journal": "The Biochemical journal", "date": "2002", "authors": "Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12093360", "url": "https://glygen.org/publication/PubMed/12093360" } ] }, { "title": "p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr.", "journal": "Oncogene", "date": "2002", "authors": "Korus M, Mahon GM, Cheng L, Whitehead IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12096337", "url": "https://glygen.org/publication/PubMed/12096337" } ] }, { "title": "Kalirin Dbl-homology guanine nucleotide exchange factor 1 domain initiates new axon outgrowths via RhoG-mediated mechanisms.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "May V, Schiller MR, Eipper BA, Mains RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "12177196", "url": "https://glygen.org/publication/PubMed/12177196" } ] }, { "title": "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Endris V, Wogatzky B, Leimer U, Bartsch D, Zatyka M, Latif F, Maher ER, Tariverdian G, Kirsch S, Karch D, Rappold GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12195014", "url": "https://glygen.org/publication/PubMed/12195014" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "CS1, a novel member of the CD2 family, is homophilic and regulates NK cell function.", "journal": "Molecular immunology", "date": "2002", "authors": "Kumaresan PR, Lai WC, Chuang SS, Bennett M, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12213321", "url": "https://glygen.org/publication/PubMed/12213321" } ] }, { "title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12221096", "url": "https://glygen.org/publication/PubMed/12221096" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Laminin modulates morphogenic properties of the collagen XVIII endostatin domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Javaherian K, Park SY, Pickl WF, LaMontagne KR, Sjin RT, Gillies S, Lo KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "12237301", "url": "https://glygen.org/publication/PubMed/12237301" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "A novel FERM domain including guanine nucleotide exchange factor is involved in Rac signaling and regulates neurite remodeling.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Kubo T, Yamashita T, Yamaguchi A, Sumimoto H, Hosokawa K, Tohyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12351724", "url": "https://glygen.org/publication/PubMed/12351724" } ] }, { "title": "The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.", "journal": "The Biochemical journal", "date": "2003", "authors": "Ludbrook SB, Barry ST, Delves CJ, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12358597", "url": "https://glygen.org/publication/PubMed/12358597" } ] }, { "title": "RhoG signals in parallel with Rac1 and Cdc42.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wennerberg K, Ellerbroek SM, Liu RY, Karnoub AE, Burridge K, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "12376551", "url": "https://glygen.org/publication/PubMed/12376551" } ] }, { "title": "Integrin alpha8beta1 mediates adhesion to LAP-TGFbeta1.", "journal": "Journal of cell science", "date": "2002", "authors": "Lu M, Munger JS, Steadele M, Busald C, Tellier M, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12415008", "url": "https://glygen.org/publication/PubMed/12415008" } ] }, { "title": "Latent transforming growth factor beta-binding protein 1 interacts with fibrillin and is a microfibril-associated protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Isogai Z, Ono RN, Ushiro S, Keene DR, Chen Y, Mazzieri R, Charbonneau NL, Reinhardt DP, Rifkin DB, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12429738", "url": "https://glygen.org/publication/PubMed/12429738" } ] }, { "title": "The diaphanous-related formin mDia1 controls serum response factor activity through its effects on actin polymerization.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Copeland JW, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12429848", "url": "https://glygen.org/publication/PubMed/12429848" } ] }, { "title": "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.", "journal": "Journal of cell science", "date": "2002", "authors": "Cote JF, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12432077", "url": "https://glygen.org/publication/PubMed/12432077" } ] }, { "title": "Cis and trans interactions of L1 with neuropilin-1 control axonal responses to semaphorin 3A.", "journal": "The EMBO journal", "date": "2002", "authors": "Castellani V, De Angelis E, Kenwrick S, Rougon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "12456642", "url": "https://glygen.org/publication/PubMed/12456642" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "Disruption of focal adhesions by integrin cytoplasmic domain-associated protein-1 alpha.", "journal": "The Journal of biological chemistry", "date": "2003-02-21", "authors": "Bouvard Daniel, Vignoud Lucile, Dup\u00e9-Manet Sandra, Abed Nadia, Fournier Henri-No\u00ebl, Vincent-Monegat Carole, Retta Saverio Francesco, Fassler Reinhard, Block Marc R", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "12473654", "url": "https://glygen.org/publication/PubMed/12473654" } ] }, { "title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.", "journal": "Circulation research", "date": "2002", "authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12480817", "url": "https://glygen.org/publication/PubMed/12480817" } ] }, { "title": "Making sense of latent TGFbeta activation.", "journal": "Journal of cell science", "date": "2003", "authors": "Annes JP, Munger JS, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "12482908", "url": "https://glygen.org/publication/PubMed/12482908" } ] }, { "title": "Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.", "journal": "Human genetics", "date": "2003", "authors": "Speckman RA, Wright Daw JA, Helms C, Duan S, Cao L, Taillon-Miller P, Kwok PY, Menter A, Bowcock AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12483297", "url": "https://glygen.org/publication/PubMed/12483297" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "Deleted in liver cancer (DLC) 2 encodes a RhoGAP protein with growth suppressor function and is underexpressed in hepatocellular carcinoma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ching YP, Wong CM, Chan SF, Leung TH, Ng DC, Jin DY, Ng IO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12531887", "url": "https://glygen.org/publication/PubMed/12531887" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "A Rac/Cdc42-specific exchange factor, GEFT, induces cell proliferation, transformation, and migration.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Guo X, Stafford LJ, Bryan B, Xia C, Ma W, Wu X, Liu D, Songyang Z, Liu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12547822", "url": "https://glygen.org/publication/PubMed/12547822" } ] }, { "title": "The immunoglobulin-superfamily molecule basigin is a binding protein for oligomannosidic carbohydrates: an anti-idiotypic approach.", "journal": "Journal of neurochemistry", "date": "2003", "authors": "Heller M, von der Ohe M, Kleene R, Mohajeri MH, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "12558975", "url": "https://glygen.org/publication/PubMed/12558975" } ] }, { "title": "RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.", "journal": "Nature cell biology", "date": "2003", "authors": "Gasman S, Kalaidzidis Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12577064", "url": "https://glygen.org/publication/PubMed/12577064" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "Expression of potential lymphocyte trafficking mediator molecules in the mammary gland.", "journal": "Veterinary research", "date": "2003", "authors": "Nishimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12588680", "url": "https://glygen.org/publication/PubMed/12588680" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "ArhGAP15, a novel human RacGAP protein with GTPase binding property.", "journal": "FEBS letters", "date": "2003", "authors": "Seoh ML, Ng CH, Yong J, Lim L, Leung T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12650940", "url": "https://glygen.org/publication/PubMed/12650940" } ] }, { "title": "Translocation of CrkL to focal adhesions mediates integrin-induced migration downstream of Src family kinases.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Li L, Guris DL, Okura M, Imamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12665586", "url": "https://glygen.org/publication/PubMed/12665586" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Lin Cristiane G, Leu Shr-Jeng, Chen Ningyu, Tebeau Christopher M, Lin Shao-Xia, Yeung Cho-Yau, Lau Lester F", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "12695522", "url": "https://glygen.org/publication/PubMed/12695522" } ] }, { "title": "Actin dynamics control SRF activity by regulation of its coactivator MAL.", "journal": "Cell", "date": "2003", "authors": "Miralles F, Posern G, Zaromytidou AI, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12732141", "url": "https://glygen.org/publication/PubMed/12732141" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "A role for VASP in RhoA-Diaphanous signalling to actin dynamics and SRF activity.", "journal": "The EMBO journal", "date": "2003", "authors": "Grosse R, Copeland JW, Newsome TP, Way M, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12805219", "url": "https://glygen.org/publication/PubMed/12805219" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12857875", "url": "https://glygen.org/publication/PubMed/12857875" } ] }, { "title": "Microtubule network facilitates nuclear targeting of human cytomegalovirus capsid.", "journal": "Journal of virology", "date": "2003", "authors": "Ogawa-Goto K, Tanaka K, Gibson W, Moriishi E, Miura Y, Kurata T, Irie S, Sata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "12857923", "url": "https://glygen.org/publication/PubMed/12857923" } ] }, { "title": "Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.", "journal": "The Biochemical journal", "date": "2003", "authors": "Caloca MJ, Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12877655", "url": "https://glygen.org/publication/PubMed/12877655" } ] }, { "title": "Involvement of CD100, a lymphocyte semaphorin, in the activation of the human immune system via CD72: implications for the regulation of immune and inflammatory responses.", "journal": "International immunology", "date": "2003", "authors": "Ishida I, Kumanogoh A, Suzuki K, Akahani S, Noda K, Kikutani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "12882840", "url": "https://glygen.org/publication/PubMed/12882840" } ] }, { "title": "Alpha5beta1 integrin as a cellular coreceptor for human parvovirus B19: requirement of functional activation of beta1 integrin for viral entry.", "journal": "Blood", "date": "2003-12-01", "authors": "Weigel-Kelley Kirsten A, Yoder Mervin C, Srivastava Arun", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "12907437", "url": "https://glygen.org/publication/PubMed/12907437" } ] }, { "title": "T cell receptor engagement leads to the recruitment of IBP, a novel guanine nucleotide exchange factor, to the immunological synapse.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gupta S, Fanzo JC, Hu C, Cox D, Jang SY, Lee AE, Greenberg S, Pernis AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "12923183", "url": "https://glygen.org/publication/PubMed/12923183" } ] }, { "title": "Integrin-using rotaviruses bind alpha2beta1 integrin alpha2 I domain via VP4 DGE sequence and recognize alphaXbeta2 and alphaVbeta3 by using VP7 during cell entry.", "journal": "Journal of virology", "date": "2003-09", "authors": "Graham Kate L, Halasz Peter, Tan Yan, Hewish Marilyn J, Takada Yoshikazu, Mackow Erich R, Robinson Martyn K, Coulson Barbara S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "12941907", "url": "https://glygen.org/publication/PubMed/12941907" } ] }, { "title": "Syndecan-4 as a molecule involved in defense mechanisms.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Ishiguro K, Kojima T, Muramatsu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "12975610", "url": "https://glygen.org/publication/PubMed/12975610" } ] }, { "title": "TGF beta signals through a heteromeric protein kinase receptor complex.", "journal": "Cell", "date": "1992", "authors": "Wrana JL, Attisano L, Carcamo J, Zentella A, Doody J, Laiho M, Wang XF, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "1333888", "url": "https://glygen.org/publication/PubMed/1333888" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Balbona K, Tran H, Godyna S, Ingham KC, Strickland DK, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1400330", "url": "https://glygen.org/publication/PubMed/1400330" } ] }, { "title": "Reduced cell adhesion during mitosis by threonine phosphorylation of beta1 integrin.", "journal": "Journal of cellular physiology", "date": "2003", "authors": "Suzuki K, Takahashi K", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "14502569", "url": "https://glygen.org/publication/PubMed/14502569" } ] }, { "title": "G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.", "journal": "Circulation research", "date": "2003", "authors": "Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14512443", "url": "https://glygen.org/publication/PubMed/14512443" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Post-translational processing of rac p21s is important both for their interaction with the GDP/GTP exchange proteins and for their activation of NADPH oxidase.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ando S, Kaibuchi K, Sasaki T, Hiraoka K, Nishiyama T, Mizuno T, Asada M, Nunoi H, Matsuda I, Matsuura Y, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "1464587", "url": "https://glygen.org/publication/PubMed/1464587" } ] }, { "title": "Modulation of Thr phosphorylation of integrin beta1 during muscle differentiation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kim SM, Kwon MS, Park CS, Choi KR, Chun JS, Ahn J, Song WK", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "14660602", "url": "https://glygen.org/publication/PubMed/14660602" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "Comparative functional analysis of the Rac GTPases.", "journal": "FEBS letters", "date": "2003", "authors": "Haeusler LC, Blumenstein L, Stege P, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14675773", "url": "https://glygen.org/publication/PubMed/14675773" } ] }, { "title": "Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.", "journal": "Cell communication & adhesion", "date": "2003", "authors": "Wilkins-Port CE, Sanderson RD, Tominna-Sebald E, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14681059", "url": "https://glygen.org/publication/PubMed/14681059" } ] }, { "title": "EMILIN-1 deficiency induces elastogenesis and vascular cell defects.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zanetti M, Braghetta P, Sabatelli P, Mura I, Doliana R, Colombatti A, Volpin D, Bonaldo P, Bressan GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "14701737", "url": "https://glygen.org/publication/PubMed/14701737" } ] }, { "title": "Caveolin-1 regulates matrix metalloproteinases-1 induction and CD147/EMMPRIN cell surface clustering.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tang W, Hemler ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "14707126", "url": "https://glygen.org/publication/PubMed/14707126" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "MOCA induces membrane spreading by activating Rac1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Namekata K, Enokido Y, Iwasawa K, Kimura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "14718541", "url": "https://glygen.org/publication/PubMed/14718541" } ] }, { "title": "Activation of EGF receptor kinase by L1-mediated homophilic cell interactions.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Islam R, Kristiansen LV, Romani S, Garcia-Alonso L, Hortsch M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "14718570", "url": "https://glygen.org/publication/PubMed/14718570" } ] }, { "title": "Signaling by the CD19/CD21 complex on B cells.", "journal": "Current directions in autoimmunity", "date": "2004", "authors": "Carter RH, Barrington RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14719373", "url": "https://glygen.org/publication/PubMed/14719373" } ] }, { "title": "RanBPM is a phosphoprotein that associates with the plasma membrane and interacts with the integrin LFA-1.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Denti S, Sirri A, Cheli A, Rogge L, Innamorati G, Putignano S, Fabbri M, Pardi R, Bianchi E", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "14722085", "url": "https://glygen.org/publication/PubMed/14722085" } ] }, { "title": "Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Shiratori I, Ogasawara K, Saito T, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14970179", "url": "https://glygen.org/publication/PubMed/14970179" } ] }, { "title": "Syndecan-2 regulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen L, Klass C, Woods A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14976204", "url": "https://glygen.org/publication/PubMed/14976204" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "Crystal structures of a Formin Homology-2 domain reveal a tethered dimer architecture.", "journal": "Cell", "date": "2004", "authors": "Xu Y, Moseley JB, Sagot I, Poy F, Pellman D, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15006353", "url": "https://glygen.org/publication/PubMed/15006353" } ] }, { "title": "DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.", "journal": "Experimental cell research", "date": "2004", "authors": "Mavrakis KJ, McKinlay KJ, Jones P, Sablitzky F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15023524", "url": "https://glygen.org/publication/PubMed/15023524" } ] }, { "title": "Alsin is a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Topp JD, Gray NW, Gerard RD, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15033976", "url": "https://glygen.org/publication/PubMed/15033976" } ] }, { "title": "Cutting edge: CD96 (tactile) promotes NK cell-target cell adhesion by interacting with the poliovirus receptor (CD155).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fuchs A, Cella M, Giurisato E, Shaw AS, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15034010", "url": "https://glygen.org/publication/PubMed/15034010" } ] }, { "title": "BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Lua BL, Low BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15064355", "url": "https://glygen.org/publication/PubMed/15064355" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Cdc42 and mDia3 regulate microtubule attachment to kinetochores.", "journal": "Nature", "date": "2004", "authors": "Yasuda S, Oceguera-Yanez F, Kato T, Okamoto M, Yonemura S, Terada Y, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15085137", "url": "https://glygen.org/publication/PubMed/15085137" } ] }, { "title": "Scambio, a novel guanine nucleotide exchange factor for Rho.", "journal": "Molecular cancer", "date": "2004", "authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15107133", "url": "https://glygen.org/publication/PubMed/15107133" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Ellerbroek SM, Wennerberg K, Arthur WT, Dunty JM, Bowman DR, DeMali KA, Der C, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "15133129", "url": "https://glygen.org/publication/PubMed/15133129" } ] }, { "title": "Crystal structure of the human T cell receptor CD3 epsilon gamma heterodimer complexed to the therapeutic mAb OKT3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Kjer-Nielsen L, Dunstone MA, Kostenko L, Ely LK, Beddoe T, Mifsud NA, Purcell AW, Brooks AG, McCluskey J, Rossjohn J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15136729", "url": "https://glygen.org/publication/PubMed/15136729" } ] }, { "title": "Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.", "journal": "FEBS letters", "date": "2004", "authors": "Sakakibara T, Nemoto Y, Nukiwa T, Takeshima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15147912", "url": "https://glygen.org/publication/PubMed/15147912" } ] }, { "title": "OSCAR is an FcRgamma-associated receptor that is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells.", "journal": "Blood", "date": "2004", "authors": "Merck E, Gaillard C, Gorman DM, Montero-Julian F, Durand I, Zurawski SM, Menetrier-Caux C, Carra G, Lebecque S, Trinchieri G, Bates EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15155468", "url": "https://glygen.org/publication/PubMed/15155468" } ] }, { "title": "Myosin-X provides a motor-based link between integrins and the cytoskeleton.", "journal": "Nat. Cell Biol.", "date": "2004", "authors": "Zhang Hongquan, Berg Jonathan S, Li Zhilun, Wang Yunling, L\u00e5ng Pernilla, Sousa Aurea D, Bhaskar Aparna, Cheney Richard E, Str\u00f6mblad Staffan", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "15156152", "url": "https://glygen.org/publication/PubMed/15156152" } ] }, { "title": "Cdc42, Rac1, and Rac2 display distinct patterns of activation during phagocytosis.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Hoppe AD, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15169870", "url": "https://glygen.org/publication/PubMed/15169870" } ] }, { "title": "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin.", "journal": "Mol. Biol. Cell", "date": "2004", "authors": "Fukushi Jun-ichi, Makagiansar Irwan T, Stallcup William B", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "15181153", "url": "https://glygen.org/publication/PubMed/15181153" } ] }, { "title": "CD200 is a ligand for all members of the CD200R family of immunoregulatory molecules.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Gorczynski R, Chen Z, Kai Y, Lee L, Wong S, Marsden PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15187158", "url": "https://glygen.org/publication/PubMed/15187158" } ] }, { "title": "Plexin-B3 is a functional receptor for semaphorin 5A.", "journal": "EMBO reports", "date": "2004", "authors": "Artigiani S, Conrotto P, Fazzari P, Gilestro GF, Barberis D, Giordano S, Comoglio PM, Tamagnone L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "15218527", "url": "https://glygen.org/publication/PubMed/15218527" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "Interaction of ACE2 and integrin beta1 in failing human heart.", "journal": "Biochim. Biophys. Acta", "date": "2004", "authors": "Lin Qishan, Keller Rebecca S, Weaver Barbara, Zisman Lawrence S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "15276642", "url": "https://glygen.org/publication/PubMed/15276642" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Su ZJ, Hahn CN, Goodall GJ, Reck NM, Leske AF, Davy A, Kremmidiotis G, Vadas MA, Gamble JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15302923", "url": "https://glygen.org/publication/PubMed/15302923" } ] }, { "title": "The LILR family: modulators of innate and adaptive immune pathways in health and disease.", "journal": "Tissue antigens", "date": "2004", "authors": "Brown D, Trowsdale J, Allen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15304001", "url": "https://glygen.org/publication/PubMed/15304001" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "Galpha13 stimulates cell migration through cortactin-interacting protein Hax-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Radhika V, Onesime D, Ha JH, Dhanasekaran N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15339924", "url": "https://glygen.org/publication/PubMed/15339924" } ] }, { "title": "Vilse, a conserved Rac/Cdc42 GAP mediating Robo repulsion in tracheal cells and axons.", "journal": "Genes & development", "date": "2004", "authors": "Lundstrom A, Gallio M, Englund C, Steneberg P, Hemphala J, Aspenstrom P, Keleman K, Falileeva L, Dickson BJ, Samakovlis C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15342493", "url": "https://glygen.org/publication/PubMed/15342493" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "Structural basis of heteromeric smad protein assembly in TGF-beta signaling.", "journal": "Molecular cell", "date": "2004", "authors": "Chacko BM, Qin BY, Tiwari A, Shi G, Lam S, Hayward LJ, De Caestecker M, Lin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15350224", "url": "https://glygen.org/publication/PubMed/15350224" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "alpha4beta1- and alpha6beta1-integrins are functional receptors for midkine, a heparin-binding growth factor.", "journal": "J. Cell Sci.", "date": "2004", "authors": "Muramatsu Hisako, Zou Peng, Suzuki Hiromichi, Oda Yoshihiro, Chen Guo-Yun, Sakaguchi Nahoko, Sakuma Sadatoshi, Maeda Nobuaki, Noda Masaharu, Takada Yoshikazu, Muramatsu Takashi", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "15466886", "url": "https://glygen.org/publication/PubMed/15466886" } ] }, { "title": "The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Beauvais DM, Burbach BJ, Rapraeger AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "15479743", "url": "https://glygen.org/publication/PubMed/15479743" } ] }, { "title": "WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Wang Y, Suzuki H, Yokoo T, Tada-Iida K, Kihara R, Miura M, Watanabe K, Sone H, Shimano H, Toyoshima H, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15485661", "url": "https://glygen.org/publication/PubMed/15485661" } ] }, { "title": "Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.", "journal": "Cell", "date": "2004", "authors": "Canagarajah B, Leskow FC, Ho JY, Mischak H, Saidi LF, Kazanietz MG, Hurley JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15507211", "url": "https://glygen.org/publication/PubMed/15507211" } ] }, { "title": "Formin is a processive motor that requires profilin to accelerate actin assembly and associated ATP hydrolysis.", "journal": "Cell", "date": "2004", "authors": "Romero S, Le Clainche C, Didry D, Egile C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15507212", "url": "https://glygen.org/publication/PubMed/15507212" } ] }, { "title": "An alternative form of the integrin beta 1 subunit with a variant cytoplasmic domain.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Languino L R, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "1551917", "url": "https://glygen.org/publication/PubMed/1551917" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Arnett KL, Harrison SC, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15534202", "url": "https://glygen.org/publication/PubMed/15534202" } ] }, { "title": "Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells.", "journal": "Endocrinology", "date": "2005", "authors": "Thomas P, Pang Y, Filardo EJ, Dong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15539556", "url": "https://glygen.org/publication/PubMed/15539556" } ] }, { "title": "The SAP family of adaptors in immune regulation.", "journal": "Seminars in immunology", "date": "2004", "authors": "Latour S, Veillette A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15541655", "url": "https://glygen.org/publication/PubMed/15541655" } ] }, { "title": "SWAP-70 regulates c-kit-induced mast cell activation, cell-cell adhesion, and migration.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Sivalenka RR, Jessberger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15542837", "url": "https://glygen.org/publication/PubMed/15542837" } ] }, { "title": "Semaphorin 3E and plexin-D1 control vascular pattern independently of neuropilins.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Gu C, Yoshida Y, Livet J, Reimert DV, Mann F, Merte J, Henderson CE, Jessell TM, Kolodkin AL, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "15550623", "url": "https://glygen.org/publication/PubMed/15550623" } ] }, { "title": "TGF-beta activation by traction?", "journal": "Trends in cell biology", "date": "2004", "authors": "Keski-Oja J, Koli K, von Melchner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "15564041", "url": "https://glygen.org/publication/PubMed/15564041" } ] }, { "title": "A Rac1/phosphatidylinositol 3-kinase/Akt3 anti-apoptotic pathway, triggered by AlsinLF, the product of the ALS2 gene, antagonizes Cu/Zn-superoxide dismutase (SOD1) mutant-induced motoneuronal cell death.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kanekura K, Hashimoto Y, Kita Y, Sasabe J, Aiso S, Nishimoto I, Matsuoka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15579468", "url": "https://glygen.org/publication/PubMed/15579468" } ] }, { "title": "The KIR gene family: life in the fast lane of evolution.", "journal": "European journal of immunology", "date": "2005", "authors": "Uhrberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15580655", "url": "https://glygen.org/publication/PubMed/15580655" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Adhesion molecule L1 stimulates neuronal migration through Vav2-Pak1 signaling.", "journal": "Neuroreport", "date": "2004", "authors": "Schmid RS, Midkiff BR, Kedar VP, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "15597056", "url": "https://glygen.org/publication/PubMed/15597056" } ] }, { "title": "TIM, a Dbl-related protein, regulates cell shape and cytoskeletal organization in a Rho-dependent manner.", "journal": "Cellular signalling", "date": "2005", "authors": "Xie X, Chang SW, Tatsumoto T, Chan AM, Miki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15601624", "url": "https://glygen.org/publication/PubMed/15601624" } ] }, { "title": "PVR (CD155) and Nectin-2 (CD112) as ligands of the human DNAM-1 (CD226) activating receptor: involvement in tumor cell lysis.", "journal": "Molecular immunology", "date": "2005", "authors": "Pende D, Bottino C, Castriconi R, Cantoni C, Marcenaro S, Rivera P, Spaggiari GM, Dondero A, Carnemolla B, Reymond N, Mingari MC, Lopez M, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15607800", "url": "https://glygen.org/publication/PubMed/15607800" } ] }, { "title": "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lavelin I, Geiger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15611138", "url": "https://glygen.org/publication/PubMed/15611138" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "A transmembrane intracellular estrogen receptor mediates rapid cell signaling.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Revankar CM, Cimino DF, Sklar LA, Arterburn JB, Prossnitz ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15705806", "url": "https://glygen.org/publication/PubMed/15705806" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Local phosphatidylinositol 3,4,5-trisphosphate accumulation recruits Vav2 and Vav3 to activate Rac1/Cdc42 and initiate neurite outgrowth in nerve growth factor-stimulated PC12 cells.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Aoki K, Nakamura T, Fujikawa K, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15728722", "url": "https://glygen.org/publication/PubMed/15728722" } ] }, { "title": "CD19 function in central and peripheral B-cell development.", "journal": "Immunologic research", "date": "2005", "authors": "Del Nagro CJ, Otero DC, Anzelon AN, Omori SA, Kolla RV, Rickert RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15778510", "url": "https://glygen.org/publication/PubMed/15778510" } ] }, { "title": "Nectin-like protein 2 defines a subset of T-cell zone dendritic cells and is a ligand for class-I-restricted T-cell-associated molecule.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Galibert L, Diemer GS, Liu Z, Johnson RS, Smith JL, Walzer T, Comeau MR, Rauch CT, Wolfson MF, Sorensen RA, Van der Vuurst de Vries AR, Branstetter DG, Koelling RM, Scholler J, Fanslow WC, Baum PR, Derry JM, Yan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15781451", "url": "https://glygen.org/publication/PubMed/15781451" } ] }, { "title": "Neutrophil migration across tight junctions is mediated by adhesive interactions between epithelial coxsackie and adenovirus receptor and a junctional adhesion molecule-like protein on neutrophils.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Zen K, Liu Y, McCall IC, Wu T, Lee W, Babbin BA, Nusrat A, Parkos CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15800062", "url": "https://glygen.org/publication/PubMed/15800062" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Rac2 regulates neutrophil chemotaxis, superoxide production, and myeloid colony formation through multiple distinct effector pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Carstanjen D, Yamauchi A, Koornneef A, Zang H, Filippi MD, Harris C, Towe J, Atkinson S, Zheng Y, Dinauer MC, Williams DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "15814684", "url": "https://glygen.org/publication/PubMed/15814684" } ] }, { "title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.", "journal": "Biochemistry", "date": "2005", "authors": "Heo J, Thapar R, Campbell SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15850391", "url": "https://glygen.org/publication/PubMed/15850391" } ] }, { "title": "Anti-alpha4 integrin therapy for multiple sclerosis: mechanisms and rationale.", "journal": "Neurology", "date": "2005", "authors": "Rice GP, Hartung HP, Calabresi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15851719", "url": "https://glygen.org/publication/PubMed/15851719" } ] }, { "title": "Involvement of a Rac activator,P-Rex1, in neurotrophin-derived signaling and neuronal migration.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2005", "authors": "Yoshizawa M, Kawauchi T, Sone M, Nishimura YV, Terao M, Chihama K, Nabeshima Y, Hoshino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15858067", "url": "https://glygen.org/publication/PubMed/15858067" } ] }, { "title": "Anatomy of CD1-lipid antigen complexes.", "journal": "Nature reviews. Immunology", "date": "2005", "authors": "Moody DB, Zajonc DM, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15864273", "url": "https://glygen.org/publication/PubMed/15864273" } ] }, { "title": "Structural and mechanistic insights into the interaction between Rho and mammalian Dia.", "journal": "Nature", "date": "2005", "authors": "Rose R, Weyand M, Lammers M, Ishizaki T, Ahmadian MR, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15864301", "url": "https://glygen.org/publication/PubMed/15864301" } ] }, { "title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.", "journal": "Molecular cell", "date": "2005", "authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15866170", "url": "https://glygen.org/publication/PubMed/15866170" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Joseph RE, Norris FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "15897194", "url": "https://glygen.org/publication/PubMed/15897194" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "Metabolic activation-related CD147-CD98 complex.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Xu D, Hemler ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "15901826", "url": "https://glygen.org/publication/PubMed/15901826" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "RhoB regulates endosome transport by promoting actin assembly on endosomal membranes through Dia1.", "journal": "Journal of cell science", "date": "2005", "authors": "Fernandez-Borja M, Janssen L, Verwoerd D, Hordijk P, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15944396", "url": "https://glygen.org/publication/PubMed/15944396" } ] }, { "title": "Cell surface expression of CD147/EMMPRIN is regulated by cyclophilin 60.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Pushkarsky T, Yurchenko V, Vanpouille C, Brichacek B, Vaisman I, Hatakeyama S, Nakayama KI, Sherry B, Bukrinsky MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "15946952", "url": "https://glygen.org/publication/PubMed/15946952" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Regulation of p21-activated kinase-independent Rac1 signal transduction by nischarin.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Reddig PJ, Xu D, Juliano RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16002401", "url": "https://glygen.org/publication/PubMed/16002401" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "Siglecs--the major subfamily of I-type lectins.", "journal": "Glycobiology", "date": "2006", "authors": "Varki A, Angata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16014749", "url": "https://glygen.org/publication/PubMed/16014749" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "The Z-disc proteins myotilin and FATZ-1 interact with each other and are connected to the sarcolemma via muscle-specific filamins.", "journal": "J. Cell Sci.", "date": "2005", "authors": "Gontier Yves, Taivainen Anu, Fontao Lionel, Sonnenberg Arnoud, van der Flier Arjan, Carpen Olli, Faulkner Georgine, Borradori Luca", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "16076904", "url": "https://glygen.org/publication/PubMed/16076904" } ] }, { "title": "Isoform-specific membrane targeting mechanism of Rac during Fc gamma R-mediated phagocytosis: positive charge-dependent and independent targeting mechanism of Rac to the phagosome.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Ueyama T, Eto M, Kami K, Tatsuno T, Kobayashi T, Shirai Y, Lennartz MR, Takeya R, Sumimoto H, Saito N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "16081809", "url": "https://glygen.org/publication/PubMed/16081809" } ] }, { "title": "Heterotypic interaction of CRTAM with Necl2 induces cell adhesion on activated NK cells and CD8+ T cells.", "journal": "International immunology", "date": "2005", "authors": "Arase N, Takeuchi A, Unno M, Hirano S, Yokosuka T, Arase H, Saito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16091383", "url": "https://glygen.org/publication/PubMed/16091383" } ] }, { "title": "GPVI and integrin alphaIIb beta3 signaling in platelets.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Watson SP, Auger JM, McCarty OJ, Pearce AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "16102042", "url": "https://glygen.org/publication/PubMed/16102042" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Winkler S, Mohl M, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16112081", "url": "https://glygen.org/publication/PubMed/16112081" } ] }, { "title": "Chloroquine is a potent inhibitor of SARS coronavirus infection and spread.", "journal": "Virology journal", "date": "2005", "authors": "Vincent MJ, Bergeron E, Benjannet S, Erickson BR, Rollin PE, Ksiazek TG, Seidah NG, Nichol ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16115318", "url": "https://glygen.org/publication/PubMed/16115318" } ] }, { "title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.", "journal": "Nature genetics", "date": "2005", "authors": "Bauer H, Willert J, Koschorz B, Herrmann BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16116428", "url": "https://glygen.org/publication/PubMed/16116428" } ] }, { "title": "HLA class I/NK cell receptor interaction in early human decidua basalis: possible functional consequences.", "journal": "Chemical immunology and allergy", "date": "2005", "authors": "Rabot M, Tabiasco J, Polgar B, Aguerre-Girr M, Berrebi A, Bensussan A, Strbo N, Rukavina D, Le Bouteiller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16129954", "url": "https://glygen.org/publication/PubMed/16129954" } ] }, { "title": "Deletion of gpUL132, a structural component of human cytomegalovirus, results in impaired virus replication in fibroblasts.", "journal": "Journal of virology", "date": "2005", "authors": "Spaderna S, Kropff B, Kodel Y, Shen S, Coley S, Lu S, Britt W, Mach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "16140760", "url": "https://glygen.org/publication/PubMed/16140760" } ] }, { "title": "Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Sudhakar A, Nyberg P, Keshamouni VG, Mannam AP, Li J, Sugimoto H, Cosgrove D, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16151532", "url": "https://glygen.org/publication/PubMed/16151532" } ] }, { "title": "ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion.", "journal": "Nature cell biology", "date": "2005", "authors": "Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16184169", "url": "https://glygen.org/publication/PubMed/16184169" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "P-Rex1 regulates neutrophil function.", "journal": "Current biology : CB", "date": "2005", "authors": "Welch HC, Condliffe AM, Milne LJ, Ferguson GJ, Hill K, Webb LM, Okkenhaug K, Coadwell WJ, Andrews SR, Thelen M, Jones GE, Hawkins PT, Stephens LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "16243035", "url": "https://glygen.org/publication/PubMed/16243035" } ] }, { "title": "P-Rex1 is a primary Rac2 guanine nucleotide exchange factor in mouse neutrophils.", "journal": "Current biology : CB", "date": "2005", "authors": "Dong X, Mo Z, Bokoch G, Guo C, Li Z, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16243036", "url": "https://glygen.org/publication/PubMed/16243036" } ] }, { "title": "Phosphorylation of ACAP1 by Akt regulates the stimulation-dependent recycling of integrin beta1 to control cell migration.", "journal": "Developmental cell", "date": "2005", "authors": "Li J, Ballif BA, Powelka AM, Dai J, Gygi SP, Hsu VW", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "16256741", "url": "https://glygen.org/publication/PubMed/16256741" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Mechanisms regulating tissue-specific polarity of monocarboxylate transporters and their chaperone CD147 in kidney and retinal epithelia.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Deora AA, Philp N, Hu J, Bok D, Rodriguez-Boulan E", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "16260747", "url": "https://glygen.org/publication/PubMed/16260747" } ] }, { "title": "The regulation of mDia1 by autoinhibition and its release by Rho*GTP.", "journal": "The EMBO journal", "date": "2005", "authors": "Lammers M, Rose R, Scrima A, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16292343", "url": "https://glygen.org/publication/PubMed/16292343" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Activation of Rac1 by RhoG regulates cell migration.", "journal": "Journal of cell science", "date": "2006", "authors": "Katoh H, Hiramoto K, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "16339170", "url": "https://glygen.org/publication/PubMed/16339170" } ] }, { "title": "Cutting edge: lectin-like transcript-1 is a ligand for the inhibitory human NKR-P1A receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Rosen DB, Bettadapura J, Alsharifi M, Mathew PA, Warren HS, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16339513", "url": "https://glygen.org/publication/PubMed/16339513" } ] }, { "title": "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Hernandez-Caselles T, Martinez-Esparza M, Perez-Oliva AB, Quintanilla-Cecconi AM, Garcia-Alonso A, Alvarez-Lopez DM, Garcia-Penarrubia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16380601", "url": "https://glygen.org/publication/PubMed/16380601" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "Ligand-binding specificities of laminin-binding integrins: a comprehensive survey of laminin-integrin interactions using recombinant alpha3beta1, alpha6beta1, alpha7beta1 and alpha6beta4 integrins.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2006", "authors": "Nishiuchi R, Takagi J, Hayashi M, Ido H, Yagi Y, Sanzen N, Tsuji T, Yamada M, Sekiguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16413178", "url": "https://glygen.org/publication/PubMed/16413178" } ] }, { "title": "Control of the assembly of ATP- and ADP-actin by formins and profilin.", "journal": "Cell", "date": "2006", "authors": "Kovar DR, Harris ES, Mahaffy R, Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16439214", "url": "https://glygen.org/publication/PubMed/16439214" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Biochemical characterization of Alsin, a Rab5 and Rac1 guanine nucleotide exchange factor.", "journal": "Methods in enzymology", "date": "2005", "authors": "Topp JD, Carney DS, Horazdovsky BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16473593", "url": "https://glygen.org/publication/PubMed/16473593" } ] }, { "title": "Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.", "journal": "The Journal of cell biology", "date": "2006", "authors": "ten Klooster JP, Jaffer ZM, Chernoff J, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16492808", "url": "https://glygen.org/publication/PubMed/16492808" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Beta1 integrin mediates internalization of mammalian reovirus.", "journal": "Journal of virology", "date": "2006-03", "authors": "Maginnis Melissa S, Forrest J Craig, Kopecky-Bromberg Sarah A, Dickeson S Kent, Santoro Samuel A, Zutter Mary M, Nemerow Glen R, Bergelson Jeffrey M, Dermody Terence S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "16501085", "url": "https://glygen.org/publication/PubMed/16501085" } ] }, { "title": "Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Ueyama T, Geiszt M, Leto TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16507994", "url": "https://glygen.org/publication/PubMed/16507994" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "The human orthologue of CdGAP is a phosphoprotein and a GTPase-activating protein for Cdc42 and Rac1 but not RhoA.", "journal": "Biology of the cell", "date": "2006", "authors": "Tcherkezian J, Triki I, Stenne R, Danek EI, Lamarche-Vane N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16519628", "url": "https://glygen.org/publication/PubMed/16519628" } ] }, { "title": "Chronic antidepressants potentiate via sigma-1 receptors the brain-derived neurotrophic factor-induced signaling for glutamate release.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yagasaki Y, Numakawa T, Kumamaru E, Hayashi T, Su TP, Kunugi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16522641", "url": "https://glygen.org/publication/PubMed/16522641" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "How TCRs bind MHCs, peptides, and coreceptors.", "journal": "Annual review of immunology", "date": "2006", "authors": "Rudolph MG, Stanfield RL, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16551255", "url": "https://glygen.org/publication/PubMed/16551255" } ] }, { "title": "Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Wilhelmsen K, Litjens SH, Sonnenberg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "16581764", "url": "https://glygen.org/publication/PubMed/16581764" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "Regulation of phagocyte oxygen radical production by the GTP-binding protein Rac 2.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Knaus UG, Heyworth PG, Evans T, Curnutte JT, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "1660188", "url": "https://glygen.org/publication/PubMed/1660188" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "The human CENP-A centromeric nucleosome-associated complex.", "journal": "Nature cell biology", "date": "2006", "authors": "Foltz DR, Jansen LE, Black BE, Bailey AO, Yates JR 3rd, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16622419", "url": "https://glygen.org/publication/PubMed/16622419" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16636067", "url": "https://glygen.org/publication/PubMed/16636067" } ] }, { "title": "Nature of functional estrogen receptors at the plasma membrane.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Pedram A, Razandi M, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "16645038", "url": "https://glygen.org/publication/PubMed/16645038" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Plexin-A1 and its interaction with DAP12 in immune responses and bone homeostasis.", "journal": "Nature cell biology", "date": "2006", "authors": "Takegahara N, Takamatsu H, Toyofuku T, Tsujimura T, Okuno T, Yukawa K, Mizui M, Yamamoto M, Prasad DV, Suzuki K, Ishii M, Terai K, Moriya M, Nakatsuji Y, Sakoda S, Sato S, Akira S, Takeda K, Inui M, Takai T, Ikawa M, Okabe M, Kumanogoh A, Kikutani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "16715077", "url": "https://glygen.org/publication/PubMed/16715077" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Structural basis for recognition of MHC and MHC-like ligands by natural killer cell receptors.", "journal": "Seminars in immunology", "date": "2006", "authors": "Deng L, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16737824", "url": "https://glygen.org/publication/PubMed/16737824" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "Collagens are functional, high affinity ligands for the inhibitory immune receptor LAIR-1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Lebbink RJ, de Ruiter T, Adelmeijer J, Brenkman AB, van Helvoort JM, Koch M, Farndale RW, Lisman T, Sonnenberg A, Lenting PJ, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16754721", "url": "https://glygen.org/publication/PubMed/16754721" } ] }, { "title": "Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.", "journal": "J. Cell Biol.", "date": "2006", "authors": "Pellinen T, Arjonen A, Vuoriluoto K, Kallio K, Fransen JA, Ivaska J", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "16754960", "url": "https://glygen.org/publication/PubMed/16754960" } ] }, { "title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Miyano K, Ueno N, Takeya R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16762923", "url": "https://glygen.org/publication/PubMed/16762923" } ] }, { "title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.", "journal": "Molecular genetics and metabolism", "date": "2006", "authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16777452", "url": "https://glygen.org/publication/PubMed/16777452" } ] }, { "title": "Physical and functional interaction of Fyn tyrosine kinase with a brain-enriched Rho GTPase-activating protein TCGAP.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Liu H, Nakazawa T, Tezuka T, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16777849", "url": "https://glygen.org/publication/PubMed/16777849" } ] }, { "title": "Direct interaction of focal adhesion kinase (FAK) with Met is required for FAK to promote hepatocyte growth factor-induced cell invasion.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Chen SY, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "16782899", "url": "https://glygen.org/publication/PubMed/16782899" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.", "journal": "Nature cell biology", "date": "2006", "authors": "Ohta Y, Hartwig JH, Stossel TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16862148", "url": "https://glygen.org/publication/PubMed/16862148" } ] }, { "title": "CD40/CD40L dyad in the inflammatory and immune responses in the central nervous system.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Chen K, Huang J, Gong W, Zhang L, Yu P, Wang JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16893496", "url": "https://glygen.org/publication/PubMed/16893496" } ] }, { "title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2006", "authors": "Mohl M, Winkler S, Wieland T, Lutz S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16896804", "url": "https://glygen.org/publication/PubMed/16896804" } ] }, { "title": "The role of NK cell recognition of nectin and nectin-like proteins in tumor immunosurveillance.", "journal": "Seminars in cancer biology", "date": "2006", "authors": "Fuchs A, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16904340", "url": "https://glygen.org/publication/PubMed/16904340" } ] }, { "title": "Tropoelastin massively associates during coacervation to form quantized protein spheres.", "journal": "Biochemistry", "date": "2006", "authors": "Clarke AW, Arnspang EC, Mithieux SM, Korkmaz E, Braet F, Weiss AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "16906757", "url": "https://glygen.org/publication/PubMed/16906757" } ] }, { "title": "Gene targeting of Cdc42 and Cdc42GAP affirms the critical involvement of Cdc42 in filopodia induction, directed migration, and proliferation in primary mouse embryonic fibroblasts.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Yang L, Wang L, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16914516", "url": "https://glygen.org/publication/PubMed/16914516" } ] }, { "title": "Is the CD200/CD200 receptor interaction more than just a myeloid cell inhibitory signal?", "journal": "Critical reviews in immunology", "date": "2006", "authors": "Minas K, Liversidge J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16928187", "url": "https://glygen.org/publication/PubMed/16928187" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Autoinhibition regulates cellular localization and actin assembly activity of the diaphanous-related formins FRLalpha and mDia1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Seth A, Otomo C, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16943183", "url": "https://glygen.org/publication/PubMed/16943183" } ] }, { "title": "Laminin alpha1 chain LG4 module promotes cell attachment through syndecans and cell spreading through integrin alpha2beta1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hozumi K, Suzuki N, Nielsen PK, Nomizu M, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "16945929", "url": "https://glygen.org/publication/PubMed/16945929" } ] }, { "title": "Identification of a DOCK180-related guanine nucleotide exchange factor that is capable of mediating a positive feedback activation of Cdc42.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lin Q, Yang W, Baird D, Feng Q, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "16968698", "url": "https://glygen.org/publication/PubMed/16968698" } ] }, { "title": "Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.", "journal": "Experimental cell research", "date": "2006", "authors": "Hiramoto K, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "17027967", "url": "https://glygen.org/publication/PubMed/17027967" } ] }, { "title": "Mapping the assembly pathways that specify formation of the trilaminar kinetochore plates in human cells.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Liu ST, Rattner JB, Jablonski SA, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17030981", "url": "https://glygen.org/publication/PubMed/17030981" } ] }, { "title": "NTB-A receptor crystal structure: insights into homophilic interactions in the signaling lymphocytic activation molecule receptor family.", "journal": "Immunity", "date": "2006", "authors": "Cao E, Ramagopal UA, Fedorov A, Fedorov E, Yan Q, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17045824", "url": "https://glygen.org/publication/PubMed/17045824" } ] }, { "title": "Mutual activation of natural killer cells and monocytes mediated by NKp80-AICL interaction.", "journal": "Nature immunology", "date": "2006", "authors": "Welte S, Kuttruff S, Waldhauer I, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17057721", "url": "https://glygen.org/publication/PubMed/17057721" } ] }, { "title": "The Rac effector p67phox regulates phagocyte NADPH oxidase by stimulating Vav1 guanine nucleotide exchange activity.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Ming W, Li S, Billadeau DD, Quilliam LA, Dinauer MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17060455", "url": "https://glygen.org/publication/PubMed/17060455" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.", "journal": "Journal of cell science", "date": "2006", "authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17077126", "url": "https://glygen.org/publication/PubMed/17077126" } ] }, { "title": "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.", "journal": "J. Proteome Res.", "date": "2006", "authors": "Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17081065", "url": "https://glygen.org/publication/PubMed/17081065" } ] }, { "title": "Tissue vitronectin in normal adult human dermis is non-covalently bound to elastic tissue.", "journal": "The Journal of investigative dermatology", "date": "1991", "authors": "Hintner H, Dahlback K, Dahlback B, Pepys MB, Breathnach SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1708799", "url": "https://glygen.org/publication/PubMed/1708799" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.", "journal": "Cell", "date": "2006", "authors": "Cheeseman IM, Chappie JS, Wilson-Kubalek EM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17129783", "url": "https://glygen.org/publication/PubMed/17129783" } ] }, { "title": "Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Hamann MJ, Lubking CM, Luchini DN, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17145773", "url": "https://glygen.org/publication/PubMed/17145773" } ] }, { "title": "Vav proteins control MyD88-dependent oxidative burst.", "journal": "Blood", "date": "2007", "authors": "Miletic AV, Graham DB, Montgrain V, Fujikawa K, Kloeppel T, Brim K, Weaver B, Schreiber R, Xavier R, Swat W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17158234", "url": "https://glygen.org/publication/PubMed/17158234" } ] }, { "title": "alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity.", "journal": "The Journal of biological chemistry", "date": "2007-03-02", "authors": "Jovanovic Jelena, Takagi Junichi, Choulier Laurence, Abrescia Nicola G A, Stuart David I, van der Merwe P Anton, Mardon Helen J, Handford Penny A", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17158881", "url": "https://glygen.org/publication/PubMed/17158881" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.", "journal": "Experimental cell research", "date": "2007", "authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17196961", "url": "https://glygen.org/publication/PubMed/17196961" } ] }, { "title": "RhoB and the mammalian Diaphanous-related formin mDia2 in endosome trafficking.", "journal": "Experimental cell research", "date": "2007", "authors": "Wallar BJ, Deward AD, Resau JH, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17198702", "url": "https://glygen.org/publication/PubMed/17198702" } ] }, { "title": "Asef is a Cdc42-specific guanine nucleotide exchange factor.", "journal": "Biological chemistry", "date": "2007", "authors": "Gotthardt K, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17214551", "url": "https://glygen.org/publication/PubMed/17214551" } ] }, { "title": "A soluble form of the MHC class I-specific CD160 receptor is released from human activated NK lymphocytes and inhibits cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Giustiniani J, Marie-Cardine A, Bensussan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17237375", "url": "https://glygen.org/publication/PubMed/17237375" } ] }, { "title": "IQGAP3, a novel effector of Rac1 and Cdc42, regulates neurite outgrowth.", "journal": "Journal of cell science", "date": "2007", "authors": "Wang S, Watanabe T, Noritake J, Fukata M, Yoshimura T, Itoh N, Harada T, Nakagawa M, Matsuura Y, Arimura N, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17244649", "url": "https://glygen.org/publication/PubMed/17244649" } ] }, { "title": "Serine phosphorylation by casein kinase II controls endocytic L1 trafficking and axon growth.", "journal": "Journal of neuroscience research", "date": "2007", "authors": "Nakata A, Kamiguchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "17253643", "url": "https://glygen.org/publication/PubMed/17253643" } ] }, { "title": "Characterization of IQGAP1-containing complexes in NK-like cells: evidence for Rac 2 and RACK1 association during homotypic adhesion.", "journal": "Journal of proteome research", "date": "2007", "authors": "Meng X, Krokhin O, Cheng K, Ens W, Wilkins JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17269730", "url": "https://glygen.org/publication/PubMed/17269730" } ] }, { "title": "The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Ogawa T, Tsubota Y, Hashimoto J, Kariya Y, Miyazaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "17314405", "url": "https://glygen.org/publication/PubMed/17314405" } ] }, { "title": "Semaphorin-4A, an activator for T-cell-mediated immunity, suppresses angiogenesis via Plexin-D1.", "journal": "The EMBO journal", "date": "2007", "authors": "Toyofuku T, Yabuki M, Kamei J, Kamei M, Makino N, Kumanogoh A, Hori M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "17318185", "url": "https://glygen.org/publication/PubMed/17318185" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "A comparative analysis of the fibulin protein family. Biochemical characterization, binding interactions, and tissue localization.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kobayashi N, Kostka G, Garbe JH, Keene DR, Bachinger HP, Hanisch FG, Markova D, Tsuda T, Timpl R, Chu ML, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "17324935", "url": "https://glygen.org/publication/PubMed/17324935" } ] }, { "title": "Complement-mediated activation of the adaptive immune responses: role of C3d in linking the innate and adaptive immunity.", "journal": "Immunologic research", "date": "2006", "authors": "Toapanta FR, Ross TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17337780", "url": "https://glygen.org/publication/PubMed/17337780" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "Profilin-actin complexes directly elongate actin filaments at the barbed end.", "journal": "Biochemistry", "date": "1992", "authors": "Pring M, Weber A, Bubb MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "1737036", "url": "https://glygen.org/publication/PubMed/1737036" } ] }, { "title": "Activation of the novel estrogen receptor G protein-coupled receptor 30 (GPR30) at the plasma membrane.", "journal": "Endocrinology", "date": "2007", "authors": "Filardo E, Quinn J, Pang Y, Graeber C, Shaw S, Dong J, Thomas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "17379646", "url": "https://glygen.org/publication/PubMed/17379646" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Structural basis for the autoinhibition of focal adhesion kinase.", "journal": "Cell", "date": "2007", "authors": "Lietha D, Cai X, Ceccarelli DF, Li Y, Schaller MD, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "17574028", "url": "https://glygen.org/publication/PubMed/17574028" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Role of the small GTPase Rac in p22phox-dependent NADPH oxidases.", "journal": "Biochimie", "date": "2007", "authors": "Miyano K, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17583407", "url": "https://glygen.org/publication/PubMed/17583407" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.", "journal": "Oncogene", "date": "2007", "authors": "Kawasaki Y, Sagara M, Shibata Y, Shirouzu M, Yokoyama S, Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17599059", "url": "https://glygen.org/publication/PubMed/17599059" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "A reciprocal tensin-3-cten switch mediates EGF-driven mammary cell migration.", "journal": "Nat. Cell Biol.", "date": "2007", "authors": "Katz Menachem, Amit Ido, Citri Ami, Shay Tal, Carvalho Silvia, Lavi Sara, Milanezi Fernanda, Lyass Ljuba, Amariglio Ninette, Jacob-Hirsch Jasmine, Ben-Chetrit Nir, Tarcic Gabi, Lindzen Moshit, Avraham Roi, Liao Yi-Chun, Trusk Patricia, Lyass Asya, Rechavi Gideon, Spector Neil L, Lo Su Hao, Schmitt Fernando, Bacus Sarah S, Yarden Yosef", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17643115", "url": "https://glygen.org/publication/PubMed/17643115" } ] }, { "title": "High occupancy of sigma-1 receptors in the human brain after single oral administration of fluvoxamine: a positron emission tomography study using [11C]SA4503.", "journal": "Biological psychiatry", "date": "2007", "authors": "Ishikawa M, Ishiwata K, Ishii K, Kimura Y, Sakata M, Naganawa M, Oda K, Miyatake R, Fujisaki M, Shimizu E, Shirayama Y, Iyo M, Hashimoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "17662961", "url": "https://glygen.org/publication/PubMed/17662961" } ] }, { "title": "Membrane translocation of P-Rex1 is mediated by G protein betagamma subunits and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Barber MA, Donald S, Thelen S, Anderson KE, Thelen M, Welch HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "17698854", "url": "https://glygen.org/publication/PubMed/17698854" } ] }, { "title": "Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Zhang Y, Sawada T, Jing X, Yokote H, Yan X, Sakaguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17702745", "url": "https://glygen.org/publication/PubMed/17702745" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth.", "journal": "Molecular and cellular neurosciences", "date": "2007", "authors": "Vogt DL, Gray CD, Young WS 3rd, Orellana SA, Malouf AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17804252", "url": "https://glygen.org/publication/PubMed/17804252" } ] }, { "title": "Rab25 associates with alpha5beta1 integrin to promote invasive migration in 3D microenvironments.", "journal": "Dev. Cell", "date": "2007", "authors": "Caswell Patrick T, Spence Heather J, Parsons Maddy, White Dominic P, Clark Katherine, Cheng Kwai Wa, Mills Gordon B, Humphries Martin J, Messent Anthea J, Anderson Kurt I, McCaffrey Mary W, Ozanne Bradford W, Norman Jim C", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17925226", "url": "https://glygen.org/publication/PubMed/17925226" } ] }, { "title": "The Epstein-Barr virus BMRF-2 protein facilitates virus attachment to oral epithelial cells.", "journal": "Virology", "date": "2008-01-20", "authors": "Xiao Jianqiao, Palefsky Joel M, Herrera Rossana, Berline Jennifer, Tugizov Sharof M", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17945327", "url": "https://glygen.org/publication/PubMed/17945327" } ] }, { "title": "Interaction of integrin beta1 with cytokeratin 1 in neuroblastoma NMB7 cells.", "journal": "Biochem. Soc. Trans.", "date": "2007", "authors": "Chuang N-N, Huang C-C", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "17956333", "url": "https://glygen.org/publication/PubMed/17956333" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "START-GAP3/DLC3 is a GAP for RhoA and Cdc42 and is localized in focal adhesions regulating cell morphology.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Kawai K, Kiyota M, Seike J, Deki Y, Yagisawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "17976533", "url": "https://glygen.org/publication/PubMed/17976533" } ] }, { "title": "LFA-1-mediated leukocyte adhesion regulated by interaction of CD43 with LFA-1 and CD147.", "journal": "Molecular immunology", "date": "2008", "authors": "Khunkaewla P, Schiller HB, Paster W, Leksa V, Cermak L, Andera L, Horejsi V, Stockinger H", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "17996943", "url": "https://glygen.org/publication/PubMed/17996943" } ] }, { "title": "High-resolution structural analysis of mammalian profilin 2a complex formation with two physiological ligands: the formin homology 1 domain of mDia1 and the proline-rich domain of VASP.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Kursula P, Kursula I, Massimi M, Song YH, Downer J, Stanley WA, Witke W, Wilmanns M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18001770", "url": "https://glygen.org/publication/PubMed/18001770" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "Homotypic interactions mediated by Slamf1 and Slamf6 receptors control NKT cell lineage development.", "journal": "Immunity", "date": "2007", "authors": "Griewank K, Borowski C, Rietdijk S, Wang N, Julien A, Wei DG, Mamchak AA, Terhorst C, Bendelac A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18031695", "url": "https://glygen.org/publication/PubMed/18031695" } ] }, { "title": "CD1 antigen presentation: how it works.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Barral DC, Brenner MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18037897", "url": "https://glygen.org/publication/PubMed/18037897" } ] }, { "title": "Heterotrimeric G protein betagamma subunits stimulate FLJ00018, a guanine nucleotide exchange factor for Rac1 and Cdc42.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Ueda H, Nagae R, Kozawa M, Morishita R, Kimura S, Nagase T, Ohara O, Yoshida S, Asano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18045877", "url": "https://glygen.org/publication/PubMed/18045877" } ] }, { "title": "Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells.", "journal": "Immunity", "date": "2007", "authors": "Pogge von Strandmann E, Simhadri VR, von Tresckow B, Sasse S, Reiners KS, Hansen HP, Rothe A, Boll B, Simhadri VL, Borchmann P, McKinnon PJ, Hallek M, Engert A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18055229", "url": "https://glygen.org/publication/PubMed/18055229" } ] }, { "title": "Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kwofie MA, Skowronski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "18056264", "url": "https://glygen.org/publication/PubMed/18056264" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Molecular architecture of the kinetochore-microtubule interface.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Cheeseman IM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18097444", "url": "https://glygen.org/publication/PubMed/18097444" } ] }, { "title": "Activation of the small GTPase Rac2 via the B cell receptor regulates B cell adhesion and immunological-synapse formation.", "journal": "Immunity", "date": "2008", "authors": "Arana E, Vehlow A, Harwood NE, Vigorito E, Henderson R, Turner M, Tybulewicz VL, Batista FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "18191593", "url": "https://glygen.org/publication/PubMed/18191593" } ] }, { "title": "Entry route of HCMV into endothelial cells.", "journal": "Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology", "date": "2008", "authors": "Sinzger C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18203656", "url": "https://glygen.org/publication/PubMed/18203656" } ] }, { "title": "The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Lebbink RJ, van den Berg MC, de Ruiter T, Raynal N, van Roon JA, Lenting PJ, Jin B, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18209062", "url": "https://glygen.org/publication/PubMed/18209062" } ] }, { "title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18218625", "url": "https://glygen.org/publication/PubMed/18218625" } ] }, { "title": "Fibronectin type III (FN3) modules of the neuronal cell adhesion molecule L1 interact directly with the fibroblast growth factor (FGF) receptor.", "journal": "Molecular and cellular neurosciences", "date": "2008", "authors": "Kulahin N, Li S, Hinsby A, Kiselyov V, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18222703", "url": "https://glygen.org/publication/PubMed/18222703" } ] }, { "title": "Biophysical characterization of O-glycosylated CD99 recognition by paired Ig-like type 2 receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tabata S, Kuroki K, Wang J, Kajikawa M, Shiratori I, Kohda D, Arase H, Maenaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18234675", "url": "https://glygen.org/publication/PubMed/18234675" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Role of chimaerins, a group of Rac-specific GTPase activating proteins, in T-cell receptor signaling.", "journal": "Cellular signalling", "date": "2008", "authors": "Caloca MJ, Delgado P, Alarcon B, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18249095", "url": "https://glygen.org/publication/PubMed/18249095" } ] }, { "title": "Targeting of bone morphogenetic protein growth factor complexes to fibrillin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sengle G, Charbonneau NL, Ono RN, Sasaki T, Alvarez J, Keene DR, Bachinger HP, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "18339631", "url": "https://glygen.org/publication/PubMed/18339631" } ] }, { "title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18347018", "url": "https://glygen.org/publication/PubMed/18347018" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Mutation of Dock5, a member of the guanine exchange factor Dock180 superfamily, in the rupture of lens cataract mouse.", "journal": "Experimental eye research", "date": "2008", "authors": "Omi N, Kiyokawa E, Matsuda M, Kinoshita K, Yamada S, Yamada K, Matsushima Y, Wang Y, Kawai J, Suzuki M, Hayashizaki Y, Hiai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18396277", "url": "https://glygen.org/publication/PubMed/18396277" } ] }, { "title": "ErbB2 directly activates the exchange factor Dock7 to promote Schwann cell migration.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Yamauchi J, Miyamoto Y, Chan JR, Tanoue A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18426980", "url": "https://glygen.org/publication/PubMed/18426980" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "The type I TGF-beta receptor is covalently modified and regulated by sumoylation.", "journal": "Nature cell biology", "date": "2008", "authors": "Kang JS, Saunier EF, Akhurst RJ, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "18469808", "url": "https://glygen.org/publication/PubMed/18469808" } ] }, { "title": "The structure of alpha-parvin CH2-paxillin LD1 complex reveals a novel modular recognition for focal adhesion assembly.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wang X, Fukuda K, Byeon IJ, Velyvis A, Wu C, Gronenborn A, Qin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-446343", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343" } ], "reference": [ { "type": "PubMed", "id": "18508764", "url": "https://glygen.org/publication/PubMed/18508764" } ] }, { "title": "Tegument proteins of human cytomegalovirus.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2008", "authors": "Kalejta RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18535146", "url": "https://glygen.org/publication/PubMed/18535146" } ] }, { "title": "The RGD integrin binding site in human L1-CAM is important for nuclear signaling.", "journal": "Experimental cell research", "date": "2008", "authors": "Gast D, Riedle S, Kiefel H, Muerkoster SS, Schafer H, Schafer MK, Altevogt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18555990", "url": "https://glygen.org/publication/PubMed/18555990" } ] }, { "title": "G protein-coupled receptor 30 localizes to the endoplasmic reticulum and is not activated by estradiol.", "journal": "Endocrinology", "date": "2008", "authors": "Otto C, Rohde-Schulz B, Schwarz G, Fuchs I, Klewer M, Brittain D, Langer G, Bader B, Prelle K, Nubbemeyer R, Fritzemeier KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "18566127", "url": "https://glygen.org/publication/PubMed/18566127" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Structural and functional aspects of lipid binding by CD1 molecules.", "journal": "Annual review of cell and developmental biology", "date": "2008", "authors": "Silk JD, Salio M, Brown J, Jones EY, Cerundolo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18593354", "url": "https://glygen.org/publication/PubMed/18593354" } ] }, { "title": "Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Saegusa J, Akakura N, Wu CY, Hoogland C, Ma Z, Lam KS, Liu FT, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "18635536", "url": "https://glygen.org/publication/PubMed/18635536" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Phosphorylation and activation of the Rac1 and Cdc42 GEF Asef in A431 cells stimulated by EGF.", "journal": "Journal of cell science", "date": "2008", "authors": "Itoh RE, Kiyokawa E, Aoki K, Nishioka T, Akiyama T, Matsuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18653540", "url": "https://glygen.org/publication/PubMed/18653540" } ] }, { "title": "Parallel phosphatidylinositol 3-kinase (PI3K)-dependent and Src-dependent pathways lead to CXCL8-mediated Rac2 activation and chemotaxis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sai J, Raman D, Liu Y, Wikswo J, Richmond A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "18662984", "url": "https://glygen.org/publication/PubMed/18662984" } ] }, { "title": "P-Rex1 - a multidomain protein that regulates neurite differentiation.", "journal": "Journal of cell science", "date": "2008", "authors": "Waters JE, Astle MV, Ooms LM, Balamatsias D, Gurung R, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "18697831", "url": "https://glygen.org/publication/PubMed/18697831" } ] }, { "title": "Immobilized metal affinity chromatography revisited: pH/acid control toward high selectivity in phosphoproteomics.", "journal": "Journal of proteome research", "date": "2008", "authors": "Tsai CF, Wang YT, Chen YR, Lai CY, Lin PY, Pan KT, Chen JY, Khoo KH, Chen YJ", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "18707149", "url": "https://glygen.org/publication/PubMed/18707149" } ] }, { "title": "Integrin trafficking regulated by Rab21 is necessary for cytokinesis.", "journal": "Developmental cell", "date": "2008", "authors": "Pellinen T, Tuomi S, Arjonen A, Wolf M, Edgren H, Meyer H, Grosse R, Kitzing T, Rantala JK, Kallioniemi O, Fassler R, Kallio M, Ivaska J", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "18804435", "url": "https://glygen.org/publication/PubMed/18804435" } ] }, { "title": "FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Huber C, Martensson A, Bokoch GM, Nemazee D, Gavin AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "18838382", "url": "https://glygen.org/publication/PubMed/18838382" } ] }, { "title": "Clustering of VASP actively drives processive, WH2 domain-mediated actin filament elongation.", "journal": "The EMBO journal", "date": "2008", "authors": "Breitsprecher D, Kiesewetter AK, Linkner J, Urbanke C, Resch GP, Small JV, Faix J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18923426", "url": "https://glygen.org/publication/PubMed/18923426" } ] }, { "title": "Structural analysis of the interactions between paxillin LD motifs and alpha-parvin.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Lorenz S, Vakonakis I, Lowe ED, Campbell ID, Noble ME, Hoellerer MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-446343", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343" } ], "reference": [ { "type": "PubMed", "id": "18940607", "url": "https://glygen.org/publication/PubMed/18940607" } ] }, { "title": "Increased extracellular pressure enhances cancer cell integrin-binding affinity through phosphorylation of beta1-integrin at threonine 788/789.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Craig DH, Gayer CP, Schaubert KL, Wei Y, Li J, Laouar Y, Basson MD", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "19005162", "url": "https://glygen.org/publication/PubMed/19005162" } ] }, { "title": "JAM-L-mediated leukocyte adhesion to endothelial cells is regulated in cis by alpha4beta1 integrin activation.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Luissint AC, Lutz PG, Calderwood DA, Couraud PO, Bourdoulous S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "19064666", "url": "https://glygen.org/publication/PubMed/19064666" } ] }, { "title": "Targeting transforming growth factor (TGF)-betaRI inhibits activation of beta1 integrin and blocks vascular invasion in hepatocellular carcinoma.", "journal": "Hepatology (Baltimore, Md.)", "date": "2009", "authors": "Fransvea E, Mazzocca A, Antonaci S, Giannelli G", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "19115199", "url": "https://glygen.org/publication/PubMed/19115199" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Triggering Receptor Expressed on Myeloid Cells (TREM) family and the application of its antagonists.", "journal": "Recent patents on anti-infective drug discovery", "date": "2009", "authors": "Molloy EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19149696", "url": "https://glygen.org/publication/PubMed/19149696" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "Silencing of D4-GDI inhibits growth and invasive behavior in MDA-MB-231 cells by activation of Rac-dependent p38 and JNK signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Zhang Y, Rivera Rosado LA, Moon SY, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "19269969", "url": "https://glygen.org/publication/PubMed/19269969" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Coordinate regulation of estrogen-mediated fibronectin matrix assembly and epidermal growth factor receptor transactivation by the G protein-coupled receptor, GPR30.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2009", "authors": "Quinn JA, Graeber CT, Frackelton AR Jr, Kim M, Schwarzbauer JE, Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19342448", "url": "https://glygen.org/publication/PubMed/19342448" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "SCAI acts as a suppressor of cancer cell invasion through the transcriptional control of beta1-integrin.", "journal": "Nature cell biology", "date": "2009", "authors": "Brandt DT, Baarlink C, Kitzing TM, Kremmer E, Ivaska J, Nollau P, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19350017", "url": "https://glygen.org/publication/PubMed/19350017" } ] }, { "title": "The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.", "journal": "Trends in immunology", "date": "2009", "authors": "Clark GJ, Ju X, Tate C, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19359216", "url": "https://glygen.org/publication/PubMed/19359216" } ] }, { "title": "von Willebrand factor binding to platelet GpIb initiates signals for platelet activation.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Kroll MH, Harris TS, Moake JL, Handin RI, Schafer AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "1939645", "url": "https://glygen.org/publication/PubMed/1939645" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "Cdc42GAP, reactive oxygen species, and the vimentin network.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Li QF, Spinelli AM, Tang DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19494238", "url": "https://glygen.org/publication/PubMed/19494238" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "The insert region of the Rac GTPases is dispensable for activation of superoxide-producing NADPH oxidases.", "journal": "The Biochemical journal", "date": "2009", "authors": "Miyano K, Koga H, Minakami R, Sumimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "19534724", "url": "https://glygen.org/publication/PubMed/19534724" } ] }, { "title": "Suppression of RhoG activity is mediated by a syndecan 4-synectin-RhoGDI1 complex and is reversed by PKCalpha in a Rac1 activation pathway.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Elfenbein A, Rhodes JM, Meller J, Schwartz MA, Matsuda M, Simons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "19581409", "url": "https://glygen.org/publication/PubMed/19581409" } ] }, { "title": "The CD300 molecules regulate monocyte and dendritic cell functions.", "journal": "Immunobiology", "date": "2009", "authors": "Clark GJ, Ju X, Azlan M, Tate C, Ding Y, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19592130", "url": "https://glygen.org/publication/PubMed/19592130" } ] }, { "title": "The rho-guanine nucleotide exchange factor domain of obscurin activates rhoA signaling in skeletal muscle.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Ford-Speelman DL, Roche JA, Bowman AL, Bloch RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19605563", "url": "https://glygen.org/publication/PubMed/19605563" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.", "journal": "Biochemistry", "date": "2009", "authors": "Levay M, Settleman J, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19673492", "url": "https://glygen.org/publication/PubMed/19673492" } ] }, { "title": "Chromatin structure regulates human cytomegalovirus gene expression during latency, reactivation and lytic infection.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "19682613", "url": "https://glygen.org/publication/PubMed/19682613" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "19713215", "url": "https://glygen.org/publication/PubMed/19713215" } ] }, { "title": "Single-molecule imaging reveals transforming growth factor-beta-induced type II receptor dimerization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Zhang W, Jiang Y, Wang Q, Ma X, Xiao Z, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "19720988", "url": "https://glygen.org/publication/PubMed/19720988" } ] }, { "title": "Estradiol-mediated ERK phosphorylation and apoptosis in vascular smooth muscle cells requires GPR 30.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Ding Q, Gros R, Limbird LE, Chorazyczewski J, Feldman RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19741198", "url": "https://glygen.org/publication/PubMed/19741198" } ] }, { "title": "Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Han Y, Eppinger E, Schuster IG, Weigand LU, Liang X, Kremmer E, Peschel C, Krackhardt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19815554", "url": "https://glygen.org/publication/PubMed/19815554" } ] }, { "title": "beta(1)-integrin mediates pressure-stimulated phagocytosis.", "journal": "American journal of surgery", "date": "2009", "authors": "Bhalla S, Shiratsuchi H, Craig DH, Basson MD", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "19887187", "url": "https://glygen.org/publication/PubMed/19887187" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "Conserved estrogen binding and signaling functions of the G protein-coupled estrogen receptor 1 (GPER) in mammals and fish.", "journal": "Steroids", "date": "2010", "authors": "Thomas P, Alyea R, Pang Y, Peyton C, Dong J, Berg AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19931550", "url": "https://glygen.org/publication/PubMed/19931550" } ] }, { "title": "The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.", "journal": "Journal of cell science", "date": "2009", "authors": "Bristow JM, Sellers MH, Majumdar D, Anderson B, Hu L, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "19934221", "url": "https://glygen.org/publication/PubMed/19934221" } ] }, { "title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2009", "authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20030946", "url": "https://glygen.org/publication/PubMed/20030946" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P05556-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.", "journal": "Oncogene", "date": "2010", "authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20101212", "url": "https://glygen.org/publication/PubMed/20101212" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "Identification of a primary target of thalidomide teratogenicity.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Ito T, Ando H, Suzuki T, Ogura T, Hotta K, Imamura Y, Yamaguchi Y, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "20223979", "url": "https://glygen.org/publication/PubMed/20223979" } ] }, { "title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.", "journal": "Nature cell biology", "date": "2010", "authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20400958", "url": "https://glygen.org/publication/PubMed/20400958" } ] }, { "title": "Identification of the fibronectin sequences required for assembly of a fibrillar matrix.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Schwarzbauer JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566977" } ], "reference": [ { "type": "PubMed", "id": "2045422", "url": "https://glygen.org/publication/PubMed/2045422" } ] }, { "title": "Focal-adhesion targeting links caveolin-1 to a Rac1-degradation pathway.", "journal": "Journal of cell science", "date": "2010", "authors": "Nethe M, Anthony EC, Fernandez-Borja M, Dee R, Geerts D, Hensbergen PJ, Deelder AM, Schmidt G, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20460433", "url": "https://glygen.org/publication/PubMed/20460433" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.", "journal": "Endocrinology", "date": "2010", "authors": "Li D, Sewer MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20591975", "url": "https://glygen.org/publication/PubMed/20591975" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Monomeric type I and type III transforming growth factor-beta receptors and their dimerization revealed by single-molecule imaging.", "journal": "Cell research", "date": "2010", "authors": "Zhang W, Yuan J, Yang Y, Xu L, Wang Q, Zuo W, Fang X, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "20625381", "url": "https://glygen.org/publication/PubMed/20625381" } ] }, { "title": "The glycoprotein B disintegrin-like domain binds beta 1 integrin to mediate cytomegalovirus entry.", "journal": "Journal of virology", "date": "2010-10", "authors": "Feire Adam L, Roy Ren\u00e9 M, Manley Kate, Compton Teresa", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "20660204", "url": "https://glygen.org/publication/PubMed/20660204" } ] }, { "title": "Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Hiramoto-Yamaki N, Takeuchi S, Ueda S, Harada K, Fujimoto S, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "20679435", "url": "https://glygen.org/publication/PubMed/20679435" } ] }, { "title": "Assembly of fibronectin extracellular matrix.", "journal": "Annual review of cell and developmental biology", "date": "2010", "authors": "Singh P, Carraher C, Schwarzbauer JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566977" } ], "reference": [ { "type": "PubMed", "id": "20690820", "url": "https://glygen.org/publication/PubMed/20690820" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Efficient inhibition of collagen-induced platelet activation and adhesion by LAIR-2, a soluble Ig-like receptor family member.", "journal": "PloS one", "date": "2010", "authors": "Lenting PJ, Westerlaken GH, Denis CV, Akkerman JW, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "20730098", "url": "https://glygen.org/publication/PubMed/20730098" } ] }, { "title": "Phosphorylation of focal adhesion kinase on tyrosine 194 by Met leads to its activation through relief of autoinhibition.", "journal": "Oncogene", "date": "2011", "authors": "Chen TH, Chan PC, Chen CL, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "20802513", "url": "https://glygen.org/publication/PubMed/20802513" } ] }, { "title": "srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Guo S, Bao S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "20810653", "url": "https://glygen.org/publication/PubMed/20810653" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "The distinct role of guanine nucleotide exchange factor Vav1 in Bcl-2 transcription and apoptosis inhibition in Jurkat leukemia T cells.", "journal": "Acta pharmacologica Sinica", "date": "2011", "authors": "Yin J, Wan YJ, Li SY, Du MJ, Zhang CZ, Zhou XL, Cao YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "21151158", "url": "https://glygen.org/publication/PubMed/21151158" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "PANP is a novel O-glycosylated PILRalpha ligand expressed in neural tissues.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Kogure A, Shiratori I, Wang J, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21241660", "url": "https://glygen.org/publication/PubMed/21241660" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Kindlin-2 regulates podocyte adhesion and fibronectin matrix deposition through interactions with phosphoinositides and integrins.", "journal": "J. Cell Sci.", "date": "2011", "authors": "Qu H, Tu Y, Shi X, Larjava H, Saleem MA, Shattil SJ, Fukuda K, Qin J, Kretzler M, Wu C", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "21325030", "url": "https://glygen.org/publication/PubMed/21325030" } ] }, { "title": "Evidence for two CRIB domains in phospholipase D2 (PLD2) that the enzyme uses to specifically bind to the small GTPase Rac2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Peng HJ, Henkels KM, Mahankali M, Dinauer MC, Gomez-Cambronero J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "21378159", "url": "https://glygen.org/publication/PubMed/21378159" } ] }, { "title": "Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.", "journal": "Developmental cell", "date": "2011", "authors": "Cheng L, Zhang J, Ahmad S, Rozier L, Yu H, Deng H, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21397845", "url": "https://glygen.org/publication/PubMed/21397845" } ] }, { "title": "Neisseria meningitidis adhesin NadA targets beta1 integrins: functional similarity to Yersinia invasin.", "journal": "The Journal of biological chemistry", "date": "2011-06-10", "authors": "N\u00e4gele Virginie, Heesemann J\u00fcrgen, Schielke Stephanie, Jim\u00e9nez-Soto Luisa F, Kurzai Oliver, Ackermann Nikolaus", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "21471204", "url": "https://glygen.org/publication/PubMed/21471204" } ] }, { "title": "The Rac1 exchange factor Dock5 is essential for bone resorption by osteoclasts.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2011", "authors": "Vives V, Laurin M, Cres G, Larrousse P, Morichaud Z, Noel D, Cote JF, Blangy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21542010", "url": "https://glygen.org/publication/PubMed/21542010" } ] }, { "title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Naji L, Pacholsky D, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21565175", "url": "https://glygen.org/publication/PubMed/21565175" } ] }, { "title": "RhoA and RhoC have distinct roles in migration and invasion by acting through different targets.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Vega FM, Fruhwirth G, Ng T, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21576392", "url": "https://glygen.org/publication/PubMed/21576392" } ] }, { "title": "Multiple factors confer specific Cdc42 and Rac protein activation by dedicator of cytokinesis (DOCK) nucleotide exchange factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Kulkarni K, Yang J, Zhang Z, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21613211", "url": "https://glygen.org/publication/PubMed/21613211" } ] }, { "title": "Ephexin4 and EphA2 mediate resistance to anoikis through RhoG and phosphatidylinositol 3-kinase.", "journal": "Experimental cell research", "date": "2011", "authors": "Harada K, Hiramoto-Yamaki N, Negishi M, Katoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "21621533", "url": "https://glygen.org/publication/PubMed/21621533" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin alphavbeta8-mediated activation of TGF-beta.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Kitamura H, Cambier S, Somanath S, Barker T, Minagawa S, Markovics J, Goodsell A, Publicover J, Reichardt L, Jablons D, Wolters P, Hill A, Marks JD, Lou J, Pittet JF, Gauldie J, Baron JL, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "21646718", "url": "https://glygen.org/publication/PubMed/21646718" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "Heparan sulfate proteoglycans.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Sarrazin S, Lamanna WC, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "21690215", "url": "https://glygen.org/publication/PubMed/21690215" } ] }, { "title": "The IQGAP1 protein is a calmodulin-regulated barbed end capper of actin filaments: possible implications in its function in cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Pelikan-Conchaudron A, Le Clainche C, Didry D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21730051", "url": "https://glygen.org/publication/PubMed/21730051" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Osteoblast mineralization requires beta1 integrin/ICAP-1-dependent fibronectin deposition.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Brunner M, Millon-Fremillon A, Chevalier G, Nakchbandi IA, Mosher D, Block MR, Albiges-Rizo C, Bouvard D", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "21768292", "url": "https://glygen.org/publication/PubMed/21768292" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Specific lipid recognition is a general feature of CD300 and TREM molecules.", "journal": "Immunogenetics", "date": "2012", "authors": "Cannon JP, O'Driscoll M, Litman GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21800138", "url": "https://glygen.org/publication/PubMed/21800138" } ] }, { "title": "The metastasis-promoting phosphatase PRL-3 shows activity toward phosphoinositides.", "journal": "Biochemistry", "date": "2011-09-06", "authors": "McParland Victoria, Varsano Giulia, Li Xun, Thornton Janet, Baby Jancy, Aravind Ajay, Meyer Christoph, Pavic Karolina, Rios Pablo, K\u00f6hn Maja", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "21806020", "url": "https://glygen.org/publication/PubMed/21806020" } ] }, { "title": "OSCAR is a collagen receptor that costimulates osteoclastogenesis in DAP12-deficient humans and mice.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Barrow AD, Raynal N, Andersen TL, Slatter DA, Bihan D, Pugh N, Cella M, Kim T, Rho J, Negishi-Koga T, Delaisse JM, Takayanagi H, Lorenzo J, Colonna M, Farndale RW, Choi Y, Trowsdale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21841309", "url": "https://glygen.org/publication/PubMed/21841309" } ] }, { "title": "The G-protein-coupled estrogen receptor GPER in health and disease.", "journal": "Nature reviews. Endocrinology", "date": "2011", "authors": "Prossnitz ER, Barton M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "21844907", "url": "https://glygen.org/publication/PubMed/21844907" } ] }, { "title": "ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Maeda M, Hasegawa H, Hyodo T, Ito S, Asano E, Yuang H, Funasaka K, Shimokata K, Hasegawa Y, Hamaguchi M, Senga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21865595", "url": "https://glygen.org/publication/PubMed/21865595" } ] }, { "title": "Dynamic remodeling of the actin cytoskeleton by FMNL1gamma is required for structural maintenance of the Golgi complex.", "journal": "Journal of cell science", "date": "2011", "authors": "Colon-Franco JM, Gomez TS, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21868368", "url": "https://glygen.org/publication/PubMed/21868368" } ] }, { "title": "B7-H6/NKp30 interaction: a mechanism of alerting NK cells against tumors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kaifu T, Escaliere B, Gastinel LN, Vivier E, Baratin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21877119", "url": "https://glygen.org/publication/PubMed/21877119" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Dysregulation of Rho GTPases in the alphaPix/Arhgef6 mouse model of X-linked intellectual disability is paralleled by impaired structural and synaptic plasticity and cognitive deficits.", "journal": "Human molecular genetics", "date": "2012", "authors": "Ramakers GJ, Wolfer D, Rosenberger G, Kuchenbecker K, Kreienkamp HJ, Prange-Kiel J, Rune G, Richter K, Langnaese K, Masneuf S, Bosl MR, Fischer KD, Krugers HJ, Lipp HP, van Galen E, Kutsche K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "21989057", "url": "https://glygen.org/publication/PubMed/21989057" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Detection of Rho GEF and GAP activity through a sensitive split luciferase assay system.", "journal": "The Biochemical journal", "date": "2012", "authors": "Anderson EL, Hamann MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22004470", "url": "https://glygen.org/publication/PubMed/22004470" } ] }, { "title": "ACAP4 protein cooperates with Grb2 protein to orchestrate epidermal growth factor-stimulated integrin beta1 recycling in cell migration.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Yu X, Wang F, Liu H, Adams G, Aikhionbare F, Liu D, Cao X, Fan L, Hu G, Chen Y, Frost A, Partridge E, Ding X, Yao X", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "22027826", "url": "https://glygen.org/publication/PubMed/22027826" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "The C terminus of formin FMNL3 accelerates actin polymerization and contains a WH2 domain-like sequence that binds both monomers and filament barbed ends.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Heimsath EG Jr, Higgs HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22094460", "url": "https://glygen.org/publication/PubMed/22094460" } ] }, { "title": "ARHGAP25, a novel Rac GTPase-activating protein, regulates phagocytosis in human neutrophilic granulocytes.", "journal": "Blood", "date": "2012", "authors": "Csepanyi-Komi R, Sirokmany G, Geiszt M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22096251", "url": "https://glygen.org/publication/PubMed/22096251" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.", "journal": "PLoS pathogens", "date": "2011", "authors": "Gabaev I, Steinbruck L, Pokoyski C, Pich A, Stanton RJ, Schwinzer R, Schulz TF, Jacobs R, Messerle M, Kay-Fedorov PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "22174689", "url": "https://glygen.org/publication/PubMed/22174689" } ] }, { "title": "MEK1/2 dual-specificity protein kinases: structure and regulation.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "22177953", "url": "https://glygen.org/publication/PubMed/22177953" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "The formin FMNL3 is a cytoskeletal regulator of angiogenesis.", "journal": "Journal of cell science", "date": "2012", "authors": "Hetheridge C, Scott AN, Swain RK, Copeland JW, Higgs HN, Bicknell R, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22275430", "url": "https://glygen.org/publication/PubMed/22275430" } ] }, { "title": "The GRAF family member oligophrenin1 is a RhoGAP with BAR domain and regulates Rho GTPases in platelets.", "journal": "Cardiovascular research", "date": "2012", "authors": "Elvers M, Beck S, Fotinos A, Ziegler M, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22298643", "url": "https://glygen.org/publication/PubMed/22298643" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Evolutionarily conserved paired immunoglobulin-like receptor alpha (PILRalpha) domain mediates its interaction with diverse sialylated ligands.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sun Y, Senger K, Baginski TK, Mazloom A, Chinn Y, Pantua H, Hamidzadeh K, Ramani SR, Luis E, Tom I, Sebrell A, Quinones G, Ma Y, Mukhyala K, Sai T, Ding J, Haley B, Shadnia H, Kapadia SB, Gonzalez LC, Hass PE, Zarrin AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "22396535", "url": "https://glygen.org/publication/PubMed/22396535" } ] }, { "title": "An extension of hypotheses regarding rapid-acting, treatment-refractory, and conventional antidepressant activity of dextromethorphan and dextrorphan.", "journal": "Medical hypotheses", "date": "2012", "authors": "Lauterbach EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22401777", "url": "https://glygen.org/publication/PubMed/22401777" } ] }, { "title": "RAC1 activation mediates Twist1-induced cancer cell migration.", "journal": "Nature cell biology", "date": "2012", "authors": "Yang WH, Lan HY, Huang CH, Tai SK, Tzeng CH, Kao SY, Wu KJ, Hung MC, Yang MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22407364", "url": "https://glygen.org/publication/PubMed/22407364" } ] }, { "title": "Crystal structure of alpha5beta1 integrin ectodomain: atomic details of the fibronectin receptor.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Nagae M, Re S, Mihara E, Nogi T, Sugita Y, Takagi J", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "22451694", "url": "https://glygen.org/publication/PubMed/22451694" } ] }, { "title": "Dock7: a GEF for Rho-family GTPases and a novel myosin VI-binding partner in neuronal PC12 cells.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2012", "authors": "Majewski L, Sobczak M, Havrylov S, Jozwiak J, Redowicz MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22475431", "url": "https://glygen.org/publication/PubMed/22475431" } ] }, { "title": "The epidermal basement membrane is a composite of separate laminin- or collagen IV-containing networks connected by aggregated perlecan, but not by nidogens.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Behrens DT, Villone D, Koch M, Brunner G, Sorokin L, Robenek H, Bruckner-Tuderman L, Bruckner P, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "22493504", "url": "https://glygen.org/publication/PubMed/22493504" } ] }, { "title": "Minireview: G protein-coupled estrogen receptor-1, GPER-1: its mechanism of action and role in female reproductive cancer, renal and vascular physiology.", "journal": "Endocrinology", "date": "2012", "authors": "Filardo EJ, Thomas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "22495674", "url": "https://glygen.org/publication/PubMed/22495674" } ] }, { "title": "A human integrin beta 1 subunit with a unique cytoplasmic domain generated by alternative mRNA processing.", "journal": "Gene", "date": "1990-11-15", "authors": "Altruda F, Cervella P, Tarone G, Botta C, Balzac F, Stefanuto G, Silengo L", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "2249781", "url": "https://glygen.org/publication/PubMed/2249781" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide.", "journal": "Leukemia", "date": "2012", "authors": "Lopez-Girona A, Mendy D, Ito T, Miller K, Gandhi AK, Kang J, Karasawa S, Carmel G, Jackson P, Abbasian M, Mahmoudi A, Cathers B, Rychak E, Gaidarova S, Chen R, Schafer PH, Handa H, Daniel TO, Evans JF, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22552008", "url": "https://glygen.org/publication/PubMed/22552008" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "Mechanistic insights into regulated cargo binding by ACAP1 protein.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Bai M, Pang X, Lou J, Zhou Q, Zhang K, Ma J, Li J, Sun F, Hsu VW", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "22645133", "url": "https://glygen.org/publication/PubMed/22645133" } ] }, { "title": "Polydom/SVEP1 is a ligand for integrin alpha9beta1.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Sato-Nishiuchi R, Nakano I, Ozawa A, Sato Y, Takeichi M, Kiyozumi D, Yamazaki K, Yasunaga T, Futaki S, Sekiguchi K", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "22654117", "url": "https://glygen.org/publication/PubMed/22654117" } ] }, { "title": "Discovery of O-GlcNAc-modified proteins in published large-scale proteome data.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Hahne H, Gholami AM, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "database": "O-GlcNAc Atlas", "id": "P05556", "url": "https://oglcnac.org/atlas/detail/P05556" } ], "reference": [ { "type": "PubMed", "id": "22661428", "url": "https://glygen.org/publication/PubMed/22661428" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Dock3 regulates BDNF-TrkB signaling for neurite outgrowth by forming a ternary complex with Elmo and RhoG.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2012", "authors": "Namekata K, Watanabe H, Guo X, Kittaka D, Kawamura K, Kimura A, Harada C, Harada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22734669", "url": "https://glygen.org/publication/PubMed/22734669" } ] }, { "title": "Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2012", "authors": "Moriya K, Yamamoto T, Takamitsu E, Matsunaga Y, Kimoto M, Fukushige D, Kimoto C, Suzuki T, Utsumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22790947", "url": "https://glygen.org/publication/PubMed/22790947" } ] }, { "title": "An overview of tubulin inhibitors that interact with the colchicine binding site.", "journal": "Pharmaceutical research", "date": "2012", "authors": "Lu Y, Chen J, Xiao M, Li W, Miller DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22814904", "url": "https://glygen.org/publication/PubMed/22814904" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "The neural cell adhesion molecule N-CAM enhances L1-dependent cell-cell interactions.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Kadmon G, Kowitz A, Altevogt P, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "2295682", "url": "https://glygen.org/publication/PubMed/2295682" } ] }, { "title": "Serine-71 phosphorylation of Rac1 modulates downstream signaling.", "journal": "PloS one", "date": "2012", "authors": "Schwarz J, Proff J, Havemeier A, Ladwein M, Rottner K, Barlag B, Pich A, Tatge H, Just I, Gerhard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "22970203", "url": "https://glygen.org/publication/PubMed/22970203" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Phosphatase of regenerating liver-3 directly interacts with integrin \u03b21 and regulates its phosphorylation at tyrosine 783.", "journal": "BMC biochemistry", "date": "2012-10-23", "authors": "Tian Wei, Qu Like, Meng Lin, Liu Caiyun, Wu Jian, Shou Chengchao", "evidence": [ { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "23092334", "url": "https://glygen.org/publication/PubMed/23092334" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "Integrins alphavbeta3 and alpha4beta1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Fujita M, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "23125415", "url": "https://glygen.org/publication/PubMed/23125415" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "The novel synaptogenic protein Farp1 links postsynaptic cytoskeletal dynamics and transsynaptic organization.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Cheadle L, Biederer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23209303", "url": "https://glygen.org/publication/PubMed/23209303" } ] }, { "title": "FMNL3 FH2-actin structure gives insight into formin-mediated actin nucleation and elongation.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Thompson ME, Heimsath EG, Gauvin TJ, Higgs HN, Kull FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23222643", "url": "https://glygen.org/publication/PubMed/23222643" } ] }, { "title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Jaiswal M, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "23255595", "url": "https://glygen.org/publication/PubMed/23255595" } ] }, { "title": "Kalirin promotes neointimal hyperplasia by activating Rac in smooth muscle cells.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wu JH, Fanaroff AC, Sharma KC, Smith LS, Brian L, Eipper BA, Mains RE, Freedman NJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23288169", "url": "https://glygen.org/publication/PubMed/23288169" } ] }, { "title": "c-Cbl-mediated neddylation antagonizes ubiquitination and degradation of the TGF-beta type II receptor.", "journal": "Molecular cell", "date": "2013", "authors": "Zuo W, Huang F, Chiang YJ, Li M, Du J, Ding Y, Zhang T, Lee HW, Jeong LS, Chen Y, Deng H, Feng XH, Luo S, Gao C, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "23290524", "url": "https://glygen.org/publication/PubMed/23290524" } ] }, { "title": "Mechanism for KRIT1 release of ICAP1-mediated suppression of integrin activation.", "journal": "Molecular cell", "date": "2013", "authors": "Liu W, Draheim KM, Zhang R, Calderwood DA, Boggon TJ", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "23317506", "url": "https://glygen.org/publication/PubMed/23317506" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P05556", "url": "" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "ARHGDIA: a novel gene implicated in nephrotic syndrome.", "journal": "Journal of medical genetics", "date": "2013", "authors": "Gupta IR, Baldwin C, Auguste D, Ha KC, El Andalousi J, Fahiminiya S, Bitzan M, Bernard C, Akbari MR, Narod SA, Rosenblatt DS, Majewski J, Takano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23434736", "url": "https://glygen.org/publication/PubMed/23434736" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "Plekhg4 is a novel Dbl family guanine nucleotide exchange factor protein for rho family GTPases.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Gupta M, Kamynina E, Morley S, Chung S, Muakkassa N, Wang H, Brathwaite S, Sharma G, Manor D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23572525", "url": "https://glygen.org/publication/PubMed/23572525" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P05556", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "From alpha4beta2 Nicotinic Ligands to the Discovery of sigma1 Receptor Ligands: Pharmacophore Analysis and Rational Design.", "journal": "ACS medicinal chemistry letters", "date": "2012", "authors": "Yu LF, Zhang HK, Gunosewoyo H, Kozikowski AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "23641311", "url": "https://glygen.org/publication/PubMed/23641311" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "CS1 (SLAMF7) inhibits production of proinflammatory cytokines by activated monocytes.", "journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]", "date": "2013", "authors": "Kim JR, Horton NC, Mathew SO, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23695528", "url": "https://glygen.org/publication/PubMed/23695528" } ] }, { "title": "ARF1 controls Rac1 signaling to regulate migration of MDA-MB-231 invasive breast cancer cells.", "journal": "Cellular signalling", "date": "2013", "authors": "Lewis-Saravalli S, Campbell S, Claing A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23707487", "url": "https://glygen.org/publication/PubMed/23707487" } ] }, { "title": "Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.", "journal": "Biochemistry", "date": "2013", "authors": "Zhou Y, Johnson JL, Cerione RA, Erickson JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23718289", "url": "https://glygen.org/publication/PubMed/23718289" } ] }, { "title": "RNA-aptamers that modulate the RhoGEF activity of Tiam1.", "journal": "Bioorganic & medicinal chemistry", "date": "2013", "authors": "Niebel B, Wosnitza CI, Famulok M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "23757206", "url": "https://glygen.org/publication/PubMed/23757206" } ] }, { "title": "FMNL1 promotes proliferation and migration of leukemia cells.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Favaro P, Traina F, Machado-Neto JA, Lazarini M, Lopes MR, Pereira JK, Costa FF, Infante E, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23801653", "url": "https://glygen.org/publication/PubMed/23801653" } ] }, { "title": "The recruitment of p47(phox) and Rac2G12V at the phagosome is transient and phosphatidylserine dependent.", "journal": "Biology of the cell", "date": "2013", "authors": "Faure MC, Sulpice JC, Delattre M, Lavielle M, Prigent M, Cuif MH, Melchior C, Tschirhart E, Nusse O, Dupre-Crochet S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "23870057", "url": "https://glygen.org/publication/PubMed/23870057" } ] }, { "title": "Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.", "journal": "Blood", "date": "2013", "authors": "Klimosch SN, Bartel Y, Wiemann S, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23929856", "url": "https://glygen.org/publication/PubMed/23929856" } ] }, { "title": "RasGRF2 Rac-GEF activity couples NMDA receptor calcium flux to enhanced synaptic transmission.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Schwechter B, Rosenmund C, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "23940355", "url": "https://glygen.org/publication/PubMed/23940355" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Mitogen-activated protein kinases in innate immunity.", "journal": "Nature reviews. Immunology", "date": "2013", "authors": "Arthur JS, Ley SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "23954936", "url": "https://glygen.org/publication/PubMed/23954936" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "The human minor histocompatibility antigen 1 is a RhoGAP.", "journal": "PloS one", "date": "2013", "authors": "de Kreuk BJ, Schaefer A, Anthony EC, Tol S, Fernandez-Borja M, Geerts D, Pool J, Hambach L, Goulmy E, Hordijk PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24086303", "url": "https://glygen.org/publication/PubMed/24086303" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "The RhoGAP ARHGAP19 controls cytokinesis and chromosome segregation in T lymphocytes.", "journal": "Journal of cell science", "date": "2014", "authors": "David MD, Petit D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24259668", "url": "https://glygen.org/publication/PubMed/24259668" } ] }, { "title": "4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2013", "authors": "Lucas X, Wohlwend D, Hugle M, Schmidtkunz K, Gerhardt S, Schule R, Jung M, Einsle O, Gunther S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24272870", "url": "https://glygen.org/publication/PubMed/24272870" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "iPTMnet", "id": "P05556", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05556" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "BAG-6, a jack of all trades in health and disease.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2014", "authors": "Binici J, Koch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "24305946", "url": "https://glygen.org/publication/PubMed/24305946" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.", "journal": "Nature communications", "date": "2013", "authors": "Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24335996", "url": "https://glygen.org/publication/PubMed/24335996" } ] }, { "title": "Rho-GTPase-activating protein interacting with Cdc-42-interacting protein 4 homolog 2 (Rich2): a new Ras-related C3 botulinum toxin substrate 1 (Rac1) GTPase-activating protein that controls dendritic spine morphogenesis.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Raynaud F, Moutin E, Schmidt S, Dahl J, Bertaso F, Boeckers TM, Homburger V, Fagni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24352656", "url": "https://glygen.org/publication/PubMed/24352656" } ] }, { "title": "FAK dimerization controls its kinase-dependent functions at focal adhesions.", "journal": "The EMBO journal", "date": "2014", "authors": "Brami-Cherrier K, Gervasi N, Arsenieva D, Walkiewicz K, Boutterin MC, Ortega A, Leonard PG, Seantier B, Gasmi L, Bouceba T, Kadare G, Girault JA, Arold ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "24480479", "url": "https://glygen.org/publication/PubMed/24480479" } ] }, { "title": "Estrogen biology: new insights into GPER function and clinical opportunities.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Prossnitz ER, Barton M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "24530924", "url": "https://glygen.org/publication/PubMed/24530924" } ] }, { "title": "Dual kinase-bromodomain inhibitors for rationally designed polypharmacology.", "journal": "Nature chemical biology", "date": "2014", "authors": "Ciceri P, Muller S, O'Mahony A, Fedorov O, Filippakopoulos P, Hunt JP, Lasater EA, Pallares G, Picaud S, Wells C, Martin S, Wodicka LM, Shah NP, Treiber DK, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24584101", "url": "https://glygen.org/publication/PubMed/24584101" } ] }, { "title": "The phosphatidylserine receptor TIM4 utilizes integrins as coreceptors to effect phagocytosis.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Flannagan RS, Canton J, Furuya W, Glogauer M, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "24623723", "url": "https://glygen.org/publication/PubMed/24623723" } ] }, { "title": "P-Rex1 directly activates RhoG to regulate GPCR-driven Rac signalling and actin polarity in neutrophils.", "journal": "Journal of cell science", "date": "2014", "authors": "Damoulakis G, Gambardella L, Rossman KL, Lawson CD, Anderson KE, Fukui Y, Welch HC, Der CJ, Stephens LR, Hawkins PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "24659802", "url": "https://glygen.org/publication/PubMed/24659802" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "The chemokine fractalkine can activate integrins without CX3CR1 through direct binding to a ligand-binding site distinct from the classical RGD-binding site.", "journal": "PloS one", "date": "2014", "authors": "Fujita M, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "24789099", "url": "https://glygen.org/publication/PubMed/24789099" } ] }, { "title": "Tensin-4-dependent MET stabilization is essential for survival and proliferation in carcinoma cells.", "journal": "Dev. Cell", "date": "2014", "authors": "Muharram G, Sahgal P, Korpela T, De Franceschi N, Kaukonen R, Clark K, Tulasne D, Carpen O, Ivaska J", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" }, { "database": "Reactome", "id": "R-HSA-8875513", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513" } ], "reference": [ { "type": "PubMed", "id": "24814316", "url": "https://glygen.org/publication/PubMed/24814316" } ] }, { "title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.", "journal": "Nature cell biology", "date": "2014", "authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24859002", "url": "https://glygen.org/publication/PubMed/24859002" } ] }, { "title": "Formins as effector proteins of Rho GTPases.", "journal": "Small GTPases", "date": "2014", "authors": "Kuhn S, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "24914801", "url": "https://glygen.org/publication/PubMed/24914801" } ] }, { "title": "ARHGAP22 localizes at endosomes and regulates actin cytoskeleton.", "journal": "PloS one", "date": "2014", "authors": "Mori M, Saito K, Ohta Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24933155", "url": "https://glygen.org/publication/PubMed/24933155" } ] }, { "title": "Dynamic control of excitatory synapse development by a Rac1 GEF/GAP regulatory complex.", "journal": "Developmental cell", "date": "2014", "authors": "Um K, Niu S, Duman JG, Cheng JX, Tu YK, Schwechter B, Liu F, Hiles L, Narayanan AS, Ash RT, Mulherkar S, Alpadi K, Smirnakis SM, Tolias KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "24960694", "url": "https://glygen.org/publication/PubMed/24960694" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) forms a plasma membrane complex with membrane-associated guanylate kinases (MAGUKs) and protein kinase A-anchoring protein 5 (AKAP5) that constitutively inhibits cAMP production.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Broselid S, Berg KA, Chavera TA, Kahn R, Clarke WP, Olde B, Leeb-Lundberg LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "24962572", "url": "https://glygen.org/publication/PubMed/24962572" } ] }, { "title": "Arhgap36-dependent activation of Gli transcription factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Rack PG, Ni J, Payumo AY, Nguyen V, Crapster JA, Hovestadt V, Kool M, Jones DT, Mich JK, Firestone AJ, Pfister SM, Cho YJ, Chen JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25024229", "url": "https://glygen.org/publication/PubMed/25024229" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.", "journal": "PloS one", "date": "2014", "authors": "Yeung CY, Taylor SH, Garva R, Holmes DF, Zeef LA, Soininen R, Boot-Handford RP, Kadler KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25211221", "url": "https://glygen.org/publication/PubMed/25211221" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins alphavbeta3, alpha4beta1, and alpha5beta1.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Fujita M, Zhu K, Fujita CK, Zhao M, Lam KS, Kurth MJ, Takada YK, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "25398877", "url": "https://glygen.org/publication/PubMed/25398877" } ] }, { "title": "CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.", "journal": "Oncotarget", "date": "2015", "authors": "Wang SJ, Cui HY, Liu YM, Zhao P, Zhang Y, Fu ZG, Chen ZN, Jiang JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25428919", "url": "https://glygen.org/publication/PubMed/25428919" } ] }, { "title": "CD1 and mycobacterial lipids activate human T cells.", "journal": "Immunological reviews", "date": "2015", "authors": "Van Rhijn I, Moody DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25703557", "url": "https://glygen.org/publication/PubMed/25703557" } ] }, { "title": "Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.", "journal": "Experimental cell research", "date": "2015", "authors": "Wu D, Zhu X, Jimenez-Cowell K, Mold AJ, Sollecito CC, Lombana N, Jiao M, Wei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25704760", "url": "https://glygen.org/publication/PubMed/25704760" } ] }, { "title": "OSCAR is a receptor for surfactant protein D that activates TNF-alpha release from human CCR2+ inflammatory monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Barrow AD, Palarasah Y, Bugatti M, Holehouse AS, Byers DE, Holtzman MJ, Vermi W, Skjodt K, Crouch E, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25716998", "url": "https://glygen.org/publication/PubMed/25716998" } ] }, { "title": "Human-specific gene ARHGAP11B promotes basal progenitor amplification and neocortex expansion.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Florio M, Albert M, Taverna E, Namba T, Brandl H, Lewitus E, Haffner C, Sykes A, Wong FK, Peters J, Guhr E, Klemroth S, Prufer K, Kelso J, Naumann R, Nusslein I, Dahl A, Lachmann R, Paabo S, Huttner WB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25721503", "url": "https://glygen.org/publication/PubMed/25721503" } ] }, { "title": "Rho guanine nucleotide exchange factors involved in cyclic-stretch-induced reorientation of vascular endothelial cells.", "journal": "Journal of cell science", "date": "2015", "authors": "Abiko H, Fujiwara S, Ohashi K, Hiatari R, Mashiko T, Sakamoto N, Sato M, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25795300", "url": "https://glygen.org/publication/PubMed/25795300" } ] }, { "title": "Structure guided design of potent and selective ponatinib-based hybrid inhibitors for RIPK1.", "journal": "Cell reports", "date": "2015", "authors": "Najjar M, Suebsuwong C, Ray SS, Thapa RJ, Maki JL, Nogusa S, Shah S, Saleh D, Gough PJ, Bertin J, Yuan J, Balachandran S, Cuny GD, Degterev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "25801024", "url": "https://glygen.org/publication/PubMed/25801024" } ] }, { "title": "Dock10, a Cdc42 and Rac1 GEF, induces loss of elongation, filopodia, and ruffles in cervical cancer epithelial HeLa cells.", "journal": "Biology open", "date": "2015", "authors": "Ruiz-Lafuente N, Alcaraz-Garcia MJ, Garcia-Serna AM, Sebastian-Ruiz S, Moya-Quiles MR, Garcia-Alonso AM, Parrado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "25862245", "url": "https://glygen.org/publication/PubMed/25862245" } ] }, { "title": "CC-122, a pleiotropic pathway modifier, mimics an interferon response and has antitumor activity in DLBCL.", "journal": "Blood", "date": "2015", "authors": "Hagner PR, Man HW, Fontanillo C, Wang M, Couto S, Breider M, Bjorklund C, Havens CG, Lu G, Rychak E, Raymon H, Narla RK, Barnes L, Khambatta G, Chiu H, Kosek J, Kang J, Amantangelo MD, Waldman M, Lopez-Girona A, Cai T, Pourdehnad M, Trotter M, Daniel TO, Schafer PH, Klippel A, Thakurta A, Chopra R, Gandhi AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "26002965", "url": "https://glygen.org/publication/PubMed/26002965" } ] }, { "title": "Mitochondrial Dysfunction in Human Leukemic Stem/Progenitor Cells upon Loss of RAC2.", "journal": "PloS one", "date": "2015", "authors": "Capala ME, Maat H, Bonardi F, van den Boom V, Kuipers J, Vellenga E, Giepmans BN, Schuringa JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "26016997", "url": "https://glygen.org/publication/PubMed/26016997" } ] }, { "title": "A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis.", "journal": "Nature communications", "date": "2015", "authors": "Abraham S, Scarcia M, Bagshaw RD, McMahon K, Grant G, Harvey T, Yeo M, Esteves FOG, Thygesen HH, Jones PF, Speirs V, Hanby AM, Selby PJ, Lorger M, Dear TN, Pawson T, Marshall CJ, Mavria G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26129894", "url": "https://glygen.org/publication/PubMed/26129894" } ] }, { "title": "The G-protein coupled estrogen receptor, GPER: The inside and inside-out story.", "journal": "Molecular and cellular endocrinology", "date": "2015", "authors": "Gaudet HM, Cheng SB, Christensen EM, Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "26190834", "url": "https://glygen.org/publication/PubMed/26190834" } ] }, { "title": "Activation of human T cells by CD1 and self-lipids.", "journal": "Immunological reviews", "date": "2015", "authors": "de Jong A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26284469", "url": "https://glygen.org/publication/PubMed/26284469" } ] }, { "title": "Recognition of Microbial Glycolipids by Natural Killer T Cells.", "journal": "Frontiers in immunology", "date": "2015", "authors": "Zajonc DM, Girardi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26300885", "url": "https://glygen.org/publication/PubMed/26300885" } ] }, { "title": "Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.", "journal": "The Journal of clinical investigation", "date": "2015", "authors": "Kong R, Yi F, Wen P, Liu J, Chen X, Ren J, Li X, Shang Y, Nie Y, Wu K, Fan D, Zhu L, Feng W, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26529257", "url": "https://glygen.org/publication/PubMed/26529257" } ] }, { "title": "Cytomegalovirus latency and reactivation: recent insights into an age old problem.", "journal": "Reviews in medical virology", "date": "2016", "authors": "Dupont L, Reeves MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "26572645", "url": "https://glygen.org/publication/PubMed/26572645" } ] }, { "title": "Inhibitory effects of Arhgap6 on cervical carcinoma cells.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2016", "authors": "Li J, Liu Y, Yin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "26628301", "url": "https://glygen.org/publication/PubMed/26628301" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "Differential Rac1 signalling by guanine nucleotide exchange factors implicates FLII in regulating Rac1-driven cell migration.", "journal": "Nature communications", "date": "2016", "authors": "Marei H, Carpy A, Woroniuk A, Vennin C, White G, Timpson P, Macek B, Malliri A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "26887924", "url": "https://glygen.org/publication/PubMed/26887924" } ] }, { "title": "Estrogen Enhances Linkage in the Vascular Endothelial Calmodulin Network via a Feedforward Mechanism at the G Protein-coupled Estrogen Receptor 1.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Tran QK, Firkins R, Giles J, Francis S, Matnishian V, Tran P, VerMeer M, Jasurda J, Burgard MA, Gebert-Oberle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "26987903", "url": "https://glygen.org/publication/PubMed/26987903" } ] }, { "title": "Oligophrenin1 protects mice against myocardial ischemia and reperfusion injury by modulating inflammation and myocardial apoptosis.", "journal": "Cellular signalling", "date": "2016", "authors": "Niermann C, Gorressen S, Klier M, Gowert NS, Billuart P, Kelm M, Merx MW, Elvers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27117132", "url": "https://glygen.org/publication/PubMed/27117132" } ] }, { "title": "ARHGEF15 overexpression worsens the prognosis in patients with pancreatic ductal adenocarcinoma through enhancing the motility and proliferative activity of the cancer cells.", "journal": "Molecular cancer", "date": "2016", "authors": "Fukushima H, Yasumoto M, Ogasawara S, Akiba J, Kitasato Y, Nakayama M, Naito Y, Ishida Y, Okabe Y, Yasunaga M, Horiuchi H, Sakamoto E, Itadani H, Mizuarai S, Oie S, Yano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27145964", "url": "https://glygen.org/publication/PubMed/27145964" } ] }, { "title": "Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers.", "journal": "Cancer research", "date": "2016", "authors": "Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27216196", "url": "https://glygen.org/publication/PubMed/27216196" } ] }, { "title": "Emerging roles for the novel estrogen-sensing receptor GPER1 in the CNS.", "journal": "Neuropharmacology", "date": "2017", "authors": "Alexander A, Irving AJ, Harvey J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "27392633", "url": "https://glygen.org/publication/PubMed/27392633" } ] }, { "title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27481945", "url": "https://glygen.org/publication/PubMed/27481945" } ] }, { "title": "Human Cytomegalovirus Latency: Approaching the Gordian Knot.", "journal": "Annual review of virology", "date": "2016", "authors": "Goodrum F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "27501258", "url": "https://glygen.org/publication/PubMed/27501258" } ] }, { "title": "PLEKHG3 enhances polarized cell migration by activating actin filaments at the cell front.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Nguyen TT, Park WS, Park BO, Kim CY, Oh Y, Kim JM, Choi H, Kyung T, Kim CH, Lee G, Hahn KM, Meyer T, Heo WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27555588", "url": "https://glygen.org/publication/PubMed/27555588" } ] }, { "title": "Rac GTPase Activating Protein ARHGAP25 Regulates Leukocyte Transendothelial Migration in Mice.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Csepanyi-Komi R, Wisniewski E, Bartos B, Levai P, Nemeth T, Balazs B, Kurz AR, Bierschenk S, Sperandio M, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27566826", "url": "https://glygen.org/publication/PubMed/27566826" } ] }, { "title": "Disruption of ArhGAP15 results in hyperactive Rac1, affects the architecture and function of hippocampal inhibitory neurons and causes cognitive deficits.", "journal": "Scientific reports", "date": "2016", "authors": "Zamboni V, Armentano M, Saro G, Ciraolo E, Ghigo A, Germena G, Umbach A, Valnegri P, Passafaro M, Carabelli V, Gavello D, Bianchi V, D'Adamo P, de Curtis I, El-Assawi N, Mauro A, Priano L, Ferri N, Hirsch E, Merlo GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27713499", "url": "https://glygen.org/publication/PubMed/27713499" } ] }, { "title": "SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis.", "journal": "Cell reports", "date": "2016", "authors": "Baranov MV, Revelo NH, Dingjan I, Maraspini R, Ter Beest M, Honigmann A, van den Bogaart G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "27806292", "url": "https://glygen.org/publication/PubMed/27806292" } ] }, { "title": "RhoGTPase Regulators Orchestrate Distinct Stages of Synaptic Development.", "journal": "PloS one", "date": "2017", "authors": "Martin-Vilchez S, Whitmore L, Asmussen H, Zareno J, Horwitz R, Newell-Litwa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "28114311", "url": "https://glygen.org/publication/PubMed/28114311" } ] }, { "title": "Characterization of the activation of small GTPases by their GEFs on membranes using artificial membrane tethering.", "journal": "The Biochemical journal", "date": "2017", "authors": "Peurois F, Veyron S, Ferrandez Y, Ladid I, Benabdi S, Zeghouf M, Peyroche G, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "28196833", "url": "https://glygen.org/publication/PubMed/28196833" } ] }, { "title": "Phosphorylated cortactin recruits Vav2 guanine nucleotide exchange factor to activate Rac3 and promote invadopodial function in invasive breast cancer cells.", "journal": "Molecular biology of the cell", "date": "2017", "authors": "Rosenberg BJ, Gil-Henn H, Mader CC, Halo T, Yin T, Condeelis J, Machida K, Wu YI, Koleske AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "28356423", "url": "https://glygen.org/publication/PubMed/28356423" } ] }, { "title": "Viral gene products actively promote latent infection by epigenetic silencing mechanisms.", "journal": "Current opinion in virology", "date": "2017", "authors": "Knipe DM, Raja P, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "28415052", "url": "https://glygen.org/publication/PubMed/28415052" } ] }, { "title": "A Cereblon Modulator (CC-220) with Improved Degradation of Ikaros and Aiolos.", "journal": "Journal of medicinal chemistry", "date": "2018", "authors": "Matyskiela ME, Zhang W, Man HW, Muller G, Khambatta G, Baculi F, Hickman M, LeBrun L, Pagarigan B, Carmel G, Lu CC, Lu G, Riley M, Satoh Y, Schafer P, Daniel TO, Carmichael J, Cathers BE, Chamberlain PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "28425720", "url": "https://glygen.org/publication/PubMed/28425720" } ] }, { "title": "G protein-coupled estrogen receptor 1 (GPER1)/GPR30 increases ERK1/2 activity through PDZ motif-dependent and -independent mechanisms.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Gonzalez de Valdivia E, Broselid S, Kahn R, Olde B, Leeb-Lundberg LMF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "28450397", "url": "https://glygen.org/publication/PubMed/28450397" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "Direct binding to integrins and loss of disulfide linkage in interleukin-1beta (IL-1beta) are involved in the agonistic action of IL-1beta.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Takada YK, Yu J, Fujita M, Saegusa J, Wu CY, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "29030430", "url": "https://glygen.org/publication/PubMed/29030430" } ] }, { "title": "Allosteric inhibition of the guanine nucleotide exchange factor DOCK5 by a small molecule.", "journal": "Scientific reports", "date": "2017", "authors": "Ferrandez Y, Zhang W, Peurois F, Akendengue L, Blangy A, Zeghouf M, Cherfils J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29089502", "url": "https://glygen.org/publication/PubMed/29089502" } ] }, { "title": "Unraveling the molecular mechanism of interactions of the Rho GTPases Cdc42 and Rac1 with the scaffolding protein IQGAP2.", "journal": "The Journal of biological chemistry", "date": "2018", "authors": "Ozdemir ES, Jang H, Gursoy A, Keskin O, Li Z, Sacks DB, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29358323", "url": "https://glygen.org/publication/PubMed/29358323" } ] }, { "title": "ARHGEF39 promotes tumor progression via activation of Rac1/P38 MAPK/ATF2 signaling and predicts poor prognosis in non-small cell lung cancer patients.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2018", "authors": "Zhou H, Cai L, Zhang X, Li A, Miao Y, Li Q, Qiu X, Wang E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "29382922", "url": "https://glygen.org/publication/PubMed/29382922" } ] }, { "title": "Amino acid sequence of the human fibronectin receptor.", "journal": "J. Cell Biol.", "date": "1987", "authors": "Argraves W S, Suzuki S, Arai H, Thompson K, Pierschbacher M D, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "2958481", "url": "https://glygen.org/publication/PubMed/2958481" } ] }, { "title": "Cell surface proteoglycan binds mouse mammary epithelial cells to fibronectin and behaves as a receptor for interstitial matrix.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Saunders S, Bernfield M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "2963012", "url": "https://glygen.org/publication/PubMed/2963012" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P05556", "url": "" }, { "database": "GlyConnect", "id": "1414", "url": "https://glyconnect.expasy.org/browser/proteins/1414" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Cereblon modulator iberdomide induces degradation of the transcription factors Ikaros and Aiolos: immunomodulation in healthy volunteers and relevance to systemic lupus erythematosus.", "journal": "Annals of the rheumatic diseases", "date": "2018", "authors": "Schafer PH, Ye Y, Wu L, Kosek J, Ringheim G, Yang Z, Liu L, Thomas M, Palmisano M, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "29945920", "url": "https://glygen.org/publication/PubMed/29945920" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "database": "O-GlcNAc Atlas", "id": "P05556", "url": "https://oglcnac.org/atlas/detail/P05556" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "A First-in-Human Study of Novel Cereblon Modulator Avadomide (CC-122) in Advanced Malignancies.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2019", "authors": "Rasco DW, Papadopoulos KP, Pourdehnad M, Gandhi AK, Hagner PR, Li Y, Wei X, Chopra R, Hege K, DiMartino J, Shih K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "30201761", "url": "https://glygen.org/publication/PubMed/30201761" } ] }, { "title": "HCMV miRNA Targets Reveal Important Cellular Pathways for Viral Replication, Latency, and Reactivation.", "journal": "Non-coding RNA", "date": "2018", "authors": "Diggins NL, Hancock MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30360396", "url": "https://glygen.org/publication/PubMed/30360396" } ] }, { "title": "HCMV latency: what regulates the regulators?", "journal": "Medical microbiology and immunology", "date": "2019", "authors": "Elder E, Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30761409", "url": "https://glygen.org/publication/PubMed/30761409" } ] }, { "title": "Structural Basis for the Dual Substrate Specificity of DOCK7 Guanine Nucleotide Exchange Factor.", "journal": "Structure (London, England : 1993)", "date": "2019", "authors": "Kukimoto-Niino M, Tsuda K, Ihara K, Mishima-Tsumagari C, Honda K, Ohsawa N, Shirouzu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "30853411", "url": "https://glygen.org/publication/PubMed/30853411" } ] }, { "title": "Targeting RIPK1 for the treatment of human diseases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Degterev A, Ofengeim D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "31048504", "url": "https://glygen.org/publication/PubMed/31048504" } ] }, { "title": "Integrin Binding to the Trimeric Interface of CD40L Plays a Critical Role in CD40/CD40L Signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2019", "authors": "Takada YK, Yu J, Shimoda M, Takada Y", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "31331973", "url": "https://glygen.org/publication/PubMed/31331973" } ] }, { "title": "Nonconserved miR-608 suppresses prostate cancer progression through RAC2/PAK4/LIMK1 and BCL2L1/caspase-3 pathways by targeting the 3'-UTRs of RAC2/BCL2L1 and the coding region of PAK4.", "journal": "Cancer medicine", "date": "2019", "authors": "Zhang X, Fang J, Chen S, Wang W, Meng S, Liu B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "31389670", "url": "https://glygen.org/publication/PubMed/31389670" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Systems analysis of RhoGEF and RhoGAP regulatory proteins reveals spatially organized RAC1 signalling from integrin adhesions.", "journal": "Nature cell biology", "date": "2020", "authors": "Muller PM, Rademacher J, Bagshaw RD, Wortmann C, Barth C, van Unen J, Alp KM, Giudice G, Eccles RL, Heinrich LE, Pascual-Vargas P, Sanchez-Castro M, Brandenburg L, Mbamalu G, Tucholska M, Spatt L, Czajkowski MT, Welke RW, Zhang S, Nguyen V, Rrustemi T, Trnka P, Freitag K, Larsen B, Popp O, Mertins P, Gingras AC, Roth FP, Colwill K, Bakal C, Pertz O, Pawson T, Petsalaki E, Rocks O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "32203420", "url": "https://glygen.org/publication/PubMed/32203420" } ] }, { "title": "GRP78 and Integrins Play Different Roles in Host Cell Invasion during Mucormycosis.", "journal": "mBio", "date": "2020-06-02", "authors": "Alqarihi Abdullah, Gebremariam Teclegiorgis, Gu Yiyou, Swidergall Marc, Alkhazraji Sondus, Soliman Sameh S M, Bruno Vincent M, Edwards John E, Filler Scott G, Uppuluri Priya, Ibrahim Ashraf S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "32487760", "url": "https://glygen.org/publication/PubMed/32487760" } ] }, { "title": "The Integrin Binding Peptide, ATN-161, as a Novel Therapy for SARS-CoV-2 Infection.", "journal": "JACC Basic Transl. Sci.", "date": "2021", "authors": "Beddingfield Brandon J, Iwanaga Naoki, Chapagain Prem P, Zheng Wenshu, Roy Chad J, Hu Tony Y, Kolls Jay K, Bix Gregory J", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "33102950", "url": "https://glygen.org/publication/PubMed/33102950" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" }, { "database": "O-GlcNAc Atlas", "id": "P05556", "url": "https://oglcnac.org/atlas/detail/P05556" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "Structural insights into integrin \u03b15\u03b21 opening by fibronectin ligand.", "journal": "Science advances", "date": "2021-05", "authors": "Schumacher Stephanie, Dedden Dirk, Nunez Roberto Vazquez, Matoba Kyoko, Takagi Junichi, Biert\u00fcmpfel Christian, Mizuno Naoko", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556#ptm_processing" }, { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "33962943", "url": "https://glygen.org/publication/PubMed/33962943" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "PEAK1 Y635 phosphorylation regulates cell migration through association with Tensin3 and integrins.", "journal": "The Journal of cell biology", "date": "2022", "authors": "Zuidema A, Atherton P, Kreft M, Hoekman L, Bleijerveld OB, Nagaraj N, Chen N, Fassler R, Sonnenberg A", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "35687021", "url": "https://glygen.org/publication/PubMed/35687021" } ] }, { "title": "The integrin ligand SVEP1 regulates GPCR-mediated vasoconstriction via integrins \u03b19\u03b21 and \u03b14\u03b21.", "journal": "British journal of pharmacology", "date": "2022-11", "authors": "Morris Gavin E, Denniff Matthew J, Karamanavi Elisavet, Andrews Sarah A, Kostogrys Renata B, Bountziouka Vasiliki, Ghaderi-Najafabadi Maryam, Shamkhi Noor, McConnell George, Kaiser Michael A, Carleton Laura, Schofield Christine, Kessler Thorsten, Rainbow Richard D, Samani Nilesh J, Webb Thomas R", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "35802072", "url": "https://glygen.org/publication/PubMed/35802072" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05556", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05556" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "DPP-4 exacerbates LPS-induced endothelial cells inflammation via integrin-\u03b15\u03b21/FAK/AKT signaling.", "journal": "Experimental cell research", "date": "2024-01-04", "authors": "Liu Chang, Xu Jian, Fan Jiahao, Liu Chenyang, Xie Weiping, Kong Hui", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" } ], "reference": [ { "type": "PubMed", "id": "38184221", "url": "https://glygen.org/publication/PubMed/38184221" } ] }, { "title": "Integrin\u03b2-1 in disorders and cancers: molecular mechanisms and therapeutic targets.", "journal": "Cell communication and signaling : CCS", "date": "2024-01-26", "authors": "Su Chen, Mo Jie, Dong Shuilin, Liao Zhibin, Zhang Bixiang, Zhu Peng", "evidence": [ { "database": "RefSeq", "id": "NP_002202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002202" } ], "reference": [ { "type": "PubMed", "id": "38279122", "url": "https://glygen.org/publication/PubMed/38279122" } ] }, { "title": "Factor VIII/von Willebrand factor in subendothelium mediates platelet adhesion.", "journal": "Blood", "date": "1985", "authors": "Turitto VT, Weiss HJ, Zimmerman TS, Sussman II", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "3872140", "url": "https://glygen.org/publication/PubMed/3872140" } ] }, { "title": "Binding of laminin to type IV collagen: a morphological study.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Charonis AS, Tsilibary EC, Yurchenco PD, Furthmayr H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "3997977", "url": "https://glygen.org/publication/PubMed/3997977" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Lysyl oxidase: preparation and role in elastin biosynthesis.", "journal": "Methods in enzymology", "date": "1982", "authors": "Kagan HM, Sullivan KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "6123066", "url": "https://glygen.org/publication/PubMed/6123066" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Fibronectin in extended and compact conformations. Electron microscopy and sedimentation analysis.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Erickson HP, Carrell NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566977" } ], "reference": [ { "type": "PubMed", "id": "6643500", "url": "https://glygen.org/publication/PubMed/6643500" } ] }, { "title": "Guanine nucleotide exchange catalyzed by dbl oncogene product.", "journal": "Methods in enzymology", "date": "1995", "authors": "Zheng Y, Hart MJ, Cerione RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "7476457", "url": "https://glygen.org/publication/PubMed/7476457" } ] }, { "title": "Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Chuang TH, Xu X, Kaartinen V, Heisterkamp N, Groffen J, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7479768", "url": "https://glygen.org/publication/PubMed/7479768" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Binding of mouse and human fibulin-2 to extracellular matrix ligands.", "journal": "Journal of molecular biology", "date": "1995", "authors": "Sasaki T, Gohring W, Pan TC, Chu ML, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7500359", "url": "https://glygen.org/publication/PubMed/7500359" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "Autophosphorylation of the focal adhesion kinase, pp125FAK, directs SH2-dependent binding of pp60src.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Schaller MD, Hildebrand JD, Shannon JD, Fox JW, Vines RR, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "7509446", "url": "https://glygen.org/publication/PubMed/7509446" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Identification of a novel protein with GDP dissociation inhibitor activity for the ras-like proteins CDC42Hs and rac I.", "journal": "Genes, chromosomes & cancer", "date": "1993", "authors": "Adra CN, Ko J, Leonard D, Wirth LJ, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7512369", "url": "https://glygen.org/publication/PubMed/7512369" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Expression of beta 1B integrin isoform in CHO cells results in a dominant negative effect on cell adhesion and motility.", "journal": "The Journal of cell biology", "date": "1994-10", "authors": "Balzac F, Retta S F, Albini A, Melchiorri A, Koteliansky V E, Geuna M, Silengo L, Tarone G", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "7523423", "url": "https://glygen.org/publication/PubMed/7523423" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.", "journal": "Nature", "date": "1995", "authors": "Jones EY, Harlos K, Bottomley MJ, Robinson RC, Driscoll PC, Edwards RM, Clements JM, Dudgeon TJ, Stuart DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7531291", "url": "https://glygen.org/publication/PubMed/7531291" } ] }, { "title": "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1995", "authors": "Roark EF, Keene DR, Haudenschild CC, Godyna S, Little CD, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7534784", "url": "https://glygen.org/publication/PubMed/7534784" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "CD1-restricted T cell recognition of microbial lipoglycan antigens.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Sieling PA, Chatterjee D, Porcelli SA, Prigozy TI, Mazzaccaro RJ, Soriano T, Bloom BR, Brenner MB, Kronenberg M, Brennan PJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7542404", "url": "https://glygen.org/publication/PubMed/7542404" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "A novel beta 1 integrin isoform produced by alternative splicing: unique expression in cardiac and skeletal muscle.", "journal": "FEBS Lett.", "date": "1995", "authors": "van der Flier A, Kuikman I, Baudoin C, van der Neut R, Sonnenberg A", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "7544298", "url": "https://glygen.org/publication/PubMed/7544298" } ] }, { "title": "Novel isoform of beta 1 integrin expressed in skeletal and cardiac muscle.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "Zhidkova N I, Belkin A M, Mayne R", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "7545396", "url": "https://glygen.org/publication/PubMed/7545396" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "G protein beta gamma subunits stimulate phosphorylation of Shc adapter protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Touhara K, Hawes BE, van Biesen T, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "7568118", "url": "https://glygen.org/publication/PubMed/7568118" } ] }, { "title": "Receptor-tyrosine-kinase- and G beta gamma-mediated MAP kinase activation by a common signalling pathway.", "journal": "Nature", "date": "1995", "authors": "van Biesen T, Hawes BE, Luttrell DK, Krueger KM, Touhara K, Porfiri E, Sakaue M, Luttrell LM, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "7651538", "url": "https://glygen.org/publication/PubMed/7651538" } ] }, { "title": "Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Jullien-Flores V, Dorseuil O, Romero F, Letourneur F, Saragosti S, Berger R, Tavitian A, Gacon G, Camonis JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7673236", "url": "https://glygen.org/publication/PubMed/7673236" } ] }, { "title": "Expression and functional analysis of a cytoplasmic domain variant of the beta 1 integrin subunit.", "journal": "J. Cell Biol.", "date": "1993", "authors": "Balzac F, Belkin A M, Koteliansky V E, Balabanov Y V, Altruda F, Silengo L, Tarone G", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "7681433", "url": "https://glygen.org/publication/PubMed/7681433" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "The transforming growth factor beta receptors types I, II, and III form hetero-oligomeric complexes in the presence of ligand.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Moustakas A, Lin HY, Henis YI, Plamondon J, O'Connor-McCourt MD, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7693660", "url": "https://glygen.org/publication/PubMed/7693660" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7721814", "url": "https://glygen.org/publication/PubMed/7721814" } ] }, { "title": "Processing of transforming growth factor beta 1 precursor by human furin convertase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Dubois CM, Laprise MH, Blanchette F, Gentry LE, Leduc R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "7737999", "url": "https://glygen.org/publication/PubMed/7737999" } ] }, { "title": "A role for Rac in Tiam1-induced membrane ruffling and invasion.", "journal": "Nature", "date": "1995", "authors": "Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7753201", "url": "https://glygen.org/publication/PubMed/7753201" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "A dual functional signal mediator showing RhoGAP and phospholipase C-delta stimulating activities.", "journal": "The EMBO journal", "date": "1995", "authors": "Homma Y, Emori Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "7835339", "url": "https://glygen.org/publication/PubMed/7835339" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Breakpoint cluster region gene product-related domain of n-chimaerin. Discrimination between Rac-binding and GTPase-activating residues by mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ahmed S, Lee J, Wen LP, Zhao Z, Ho J, Best A, Kozma R, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8021274", "url": "https://glygen.org/publication/PubMed/8021274" } ] }, { "title": "Mechanism of activation of the TGF-beta receptor.", "journal": "Nature", "date": "1994", "authors": "Wrana JL, Attisano L, Wieser R, Ventura F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8047140", "url": "https://glygen.org/publication/PubMed/8047140" } ] }, { "title": "Direct interaction of v-Src with the focal adhesion kinase mediated by the Src SH2 domain.", "journal": "Molecular biology of the cell", "date": "1994", "authors": "Xing Z, Chen HC, Nowlen JK, Taylor SJ, Shalloway D, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "8054685", "url": "https://glygen.org/publication/PubMed/8054685" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "Gene for familial psoriasis susceptibility mapped to the distal end of human chromosome 17q.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Tomfohrde J, Silverman A, Barnes R, Fernandez-Vina MA, Young M, Lory D, Morris L, Wuepper KD, Stastny P, Menter A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8178173", "url": "https://glygen.org/publication/PubMed/8178173" } ] }, { "title": "Cloning of a TGF beta type I receptor that forms a heteromeric complex with the TGF beta type II receptor.", "journal": "Cell", "date": "1993", "authors": "Franzen P, ten Dijke P, Ichijo H, Yamashita H, Schulz P, Heldin CH, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8242743", "url": "https://glygen.org/publication/PubMed/8242743" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "Cloning and characterization of two distinct human extracellular signal-regulated kinase activator kinases, MEK1 and MEK2.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Zheng CF, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8388392", "url": "https://glygen.org/publication/PubMed/8388392" } ] }, { "title": "Infection by echoviruses 1 and 8 depends on the alpha 2 subunit of human VLA-2.", "journal": "Journal of virology", "date": "1993-11", "authors": "Bergelson J M, St John N, Kawaguchi S, Chan M, Stubdal H, Modlin J, Finberg R W", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "8411387", "url": "https://glygen.org/publication/PubMed/8411387" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "The fourth immunoglobulin-like domain of NCAM contains a carbohydrate recognition domain for oligomannosidic glycans implicated in association with L1 and neurite outgrowth.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Horstkorte R, Schachner M, Magyar JP, Vorherr T, Schmitz B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8509458", "url": "https://glygen.org/publication/PubMed/8509458" } ] }, { "title": "p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Burbelo PD, Miyamoto S, Utani A, Brill S, Yamada KM, Hall A, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8537347", "url": "https://glygen.org/publication/PubMed/8537347" } ] }, { "title": "Regulation of cell adhesion and anchorage-dependent growth by a new beta 1-integrin-linked protein kinase.", "journal": "Nature", "date": "1996", "authors": "Hannigan GE, Leung-Hagesteijn C, Fitz-Gibbon L, Coppolino MG, Radeva G, Filmus J, Bell JC, Dedhar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-446343", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343" } ], "reference": [ { "type": "PubMed", "id": "8538749", "url": "https://glygen.org/publication/PubMed/8538749" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "Beta 1D integrin displaces the beta 1A isoform in striated muscles: localization at junctional structures and signaling potential in nonmuscle cells.", "journal": "J. Cell Biol.", "date": "1996", "authors": "Belkin A M, Zhidkova N I, Balzac F, Altruda F, Tomatis D, Maier A, Tarone G, Koteliansky V E, Burridge K", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "8567725", "url": "https://glygen.org/publication/PubMed/8567725" } ] }, { "title": "Casein kinase II phosphorylates the neural cell adhesion molecule L1.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Wong EV, Schaefer AW, Landreth G, Lemmon V", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8592152", "url": "https://glygen.org/publication/PubMed/8592152" } ] }, { "title": "Fibronectin fibrils and growth factors stimulate anchorage-independent growth of a murine mammary carcinoma.", "journal": "Experimental cell research", "date": "1996", "authors": "Saulnier R, Bhardwaj B, Klassen J, Leopold D, Rahimi N, Tremblay E, Mosher D, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "8598224", "url": "https://glygen.org/publication/PubMed/8598224" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "Stimulation of fibroblast growth factor receptor-1 occupancy and signaling by cell surface-associated syndecans and glypican.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Steinfeld R, Van Den Berghe H, David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "8609172", "url": "https://glygen.org/publication/PubMed/8609172" } ] }, { "title": "Cell adhesion and integrin binding to recombinant human fibrillin-1.", "journal": "FEBS letters", "date": "1996", "authors": "Pfaff M, Reinhardt DP, Sakai LY, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1566948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948" } ], "reference": [ { "type": "PubMed", "id": "8617364", "url": "https://glygen.org/publication/PubMed/8617364" } ] }, { "title": "Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N", "evidence": [ { "database": "GlyConnect", "id": "283", "url": "https://glyconnect.expasy.org/browser/proteins/283" } ], "reference": [ { "type": "PubMed", "id": "8620897", "url": "https://glygen.org/publication/PubMed/8620897" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Partial purification and characterization of a protease from human plasma cleaving von Willebrand factor to fragments produced by in vivo proteolysis.", "journal": "Blood", "date": "1996", "authors": "Furlan M, Robles R, Lammle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "8639781", "url": "https://glygen.org/publication/PubMed/8639781" } ] }, { "title": "The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH, Streuli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8643598", "url": "https://glygen.org/publication/PubMed/8643598" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8662891", "url": "https://glygen.org/publication/PubMed/8662891" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Role of c-Src tyrosine kinase in G protein-coupled receptor- and Gbetagamma subunit-mediated activation of mitogen-activated protein kinases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Luttrell LM, Hawes BE, van Biesen T, Luttrell DK, Lansing TJ, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "8702633", "url": "https://glygen.org/publication/PubMed/8702633" } ] }, { "title": "The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Brill S, Li S, Lyman CW, Church DM, Wasmuth JJ, Weissbach L, Bernards A, Snijders AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8756646", "url": "https://glygen.org/publication/PubMed/8756646" } ] }, { "title": "Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Hotta K, Tanaka K, Mino A, Kohno H, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8769096", "url": "https://glygen.org/publication/PubMed/8769096" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Identification of IQGAP as a putative target for the small GTPases, Cdc42 and Rac1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kuroda S, Fukata M, Kobayashi K, Nakafuku M, Nomura N, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8798539", "url": "https://glygen.org/publication/PubMed/8798539" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Two GTPases, Cdc42 and Rac, bind directly to a protein implicated in the immunodeficiency disorder Wiskott-Aldrich syndrome.", "journal": "Current biology : CB", "date": "1996", "authors": "Aspenstrom P, Lindberg U, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8805223", "url": "https://glygen.org/publication/PubMed/8805223" } ] }, { "title": "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8810315", "url": "https://glygen.org/publication/PubMed/8810315" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "8939998", "url": "https://glygen.org/publication/PubMed/8939998" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Phosphorylation of Ser165 in TGF-beta type I receptor modulates TGF-beta1-induced cellular responses.", "journal": "The EMBO journal", "date": "1996", "authors": "Souchelnytskyi S, ten Dijke P, Miyazono K, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8947046", "url": "https://glygen.org/publication/PubMed/8947046" } ] }, { "title": "CD100 is associated with CD45 at the surface of human T lymphocytes. Role in T cell homotypic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Herold C, Elhabazi A, Bismuth G, Bensussan A, Boumsell L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416700", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700" } ], "reference": [ { "type": "PubMed", "id": "8955171", "url": "https://glygen.org/publication/PubMed/8955171" } ] }, { "title": "MADR2 is a substrate of the TGFbeta receptor and its phosphorylation is required for nuclear accumulation and signaling.", "journal": "Cell", "date": "1996", "authors": "Macias-Silva M, Abdollah S, Hoodless PA, Pirone R, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "8980228", "url": "https://glygen.org/publication/PubMed/8980228" } ] }, { "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.", "journal": "Nature", "date": "1997", "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8990121", "url": "https://glygen.org/publication/PubMed/8990121" } ] }, { "title": "Faciogenital dysplasia protein (FGD1) and Vav, two related proteins required for normal embryonic development, are upstream regulators of Rho GTPases.", "journal": "Current biology : CB", "date": "1996", "authors": "Olson MF, Pasteris NG, Gorski JL, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "8994827", "url": "https://glygen.org/publication/PubMed/8994827" } ] }, { "title": "cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizuno T, Yoshihara Y, Inazawa J, Kagamiyama H, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8995416", "url": "https://glygen.org/publication/PubMed/8995416" } ] }, { "title": "Characterization of two alternately spliced forms of phospholipase D1. Activation of the purified enzymes by phosphatidylinositol 4,5-bisphosphate, ADP-ribosylation factor, and Rho family monomeric GTP-binding proteins and protein kinase C-alpha.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hammond SM, Jenco JM, Nakashima S, Cadwallader K, Gu Q, Cook S, Nozawa Y, Prestwich GD, Frohman MA, Morris AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9013646", "url": "https://glygen.org/publication/PubMed/9013646" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "RhoGDIgamma: a GDP-dissociation inhibitor for Rho proteins with preferential expression in brain and pancreas.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Adra CN, Manor D, Ko JL, Zhu S, Horiuchi T, Van Aelst L, Cerione RA, Lim B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "9113980", "url": "https://glygen.org/publication/PubMed/9113980" } ] }, { "title": "Multimerization of the cytoplasmic domain of syndecan-4 is required for its ability to activate protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Oh ES, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "9115237", "url": "https://glygen.org/publication/PubMed/9115237" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "Mechanism of TGFbeta receptor inhibition by FKBP12.", "journal": "The EMBO journal", "date": "1997", "authors": "Chen YG, Liu F, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9233797", "url": "https://glygen.org/publication/PubMed/9233797" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "Laminin 5 binds the NC-1 domain of type VII collagen.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Rousselle P, Keene DR, Ruggiero F, Champliaud MF, Rest M, Burgeson RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9245798", "url": "https://glygen.org/publication/PubMed/9245798" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Characterization of RAC3, a novel member of the Rho family.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Haataja L, Groffen J, Heisterkamp N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423" } ], "reference": [ { "type": "PubMed", "id": "9252344", "url": "https://glygen.org/publication/PubMed/9252344" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "Glycoprotein VI is the collagen receptor in platelets which underlies tyrosine phosphorylation of the Fc receptor gamma-chain.", "journal": "FEBS letters", "date": "1997", "authors": "Gibbins JM, Okuma M, Farndale R, Barnes M, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "9280292", "url": "https://glygen.org/publication/PubMed/9280292" } ] }, { "title": "LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes.", "journal": "Immunity", "date": "1997", "authors": "Meyaard L, Adema GJ, Chang C, Woollatt E, Sutherland GR, Lanier LL, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9285412", "url": "https://glygen.org/publication/PubMed/9285412" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9305890", "url": "https://glygen.org/publication/PubMed/9305890" } ] }, { "title": "TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.", "journal": "The EMBO journal", "date": "1997", "authors": "Nakao A, Imamura T, Souchelnytskyi S, Kawabata M, Ishisaki A, Oeda E, Tamaki K, Hanai J, Heldin CH, Miyazono K, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9311995", "url": "https://glygen.org/publication/PubMed/9311995" } ] }, { "title": "p46, a novel natural killer cell-specific surface molecule that mediates cell activation.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Sivori S, Vitale M, Morelli L, Sanseverino L, Augugliaro R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9314561", "url": "https://glygen.org/publication/PubMed/9314561" } ] }, { "title": "Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.", "journal": "Structure (London, England : 1993)", "date": "1997-09-15", "authors": "Huizinga E G, Martijn van der Plas R, Kroon J, Sixma J J, Gros P", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "9331419", "url": "https://glygen.org/publication/PubMed/9331419" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "Phosphorylation of Ser465 and Ser467 in the C terminus of Smad2 mediates interaction with Smad4 and is required for transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Souchelnytskyi S, Tamaki K, Engstrom U, Wernstedt C, ten Dijke P, Heldin CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9346966", "url": "https://glygen.org/publication/PubMed/9346966" } ] }, { "title": "Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Berditchevski F, Chang S, Bodorova J, Hemler ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-210991", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991" } ], "reference": [ { "type": "PubMed", "id": "9360995", "url": "https://glygen.org/publication/PubMed/9360995" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "A single immunoglobulin-like domain of the human neural cell adhesion molecule L1 supports adhesion by multiple vascular and platelet integrins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Felding-Habermann B, Silletti S, Mei F, Siu CH, Yip PM, Brooks PC, Cheresh DA, O'Toole TE, Ginsberg MH, Montgomery AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "9396761", "url": "https://glygen.org/publication/PubMed/9396761" } ] }, { "title": "SH2- and SH3-mediated interactions between focal adhesion kinase and Src.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Thomas JW, Ellis B, Boerner RJ, Knight WB, White GC 2nd, Schaller MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "9417118", "url": "https://glygen.org/publication/PubMed/9417118" } ] }, { "title": "Coupling of Ras and Rac guanosine triphosphatases through the Ras exchanger Sos.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Nimnual AS, Yatsula BA, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9438849", "url": "https://glygen.org/publication/PubMed/9438849" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "Human myosin-IXb is a mechanochemically active motor and a GAP for rho.", "journal": "Journal of cell science", "date": "1998", "authors": "Post PL, Bokoch GM, Mooseker MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9490638", "url": "https://glygen.org/publication/PubMed/9490638" } ] }, { "title": "Identification of beta1C-2, a novel variant of the integrin beta1 subunit generated by utilization of an alternative splice acceptor site in exon C.", "journal": "Biochem. J.", "date": "1998", "authors": "Svineng G, F\u00e4ssler R, Johansson S", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "9494094", "url": "https://glygen.org/publication/PubMed/9494094" } ] }, { "title": "MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Toure A, Dorseuil O, Morin L, Timmons P, Jegou B, Reibel L, Gacon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9497316", "url": "https://glygen.org/publication/PubMed/9497316" } ] }, { "title": "Mac-2 binding protein is a cell-adhesive protein of the extracellular matrix which self-assembles into ring-like structures and binds beta1 integrins, collagens and fibronectin.", "journal": "EMBO J.", "date": "1998", "authors": "Sasaki T, Brakebusch C, Engel J, Timpl R", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "reference": [ { "type": "PubMed", "id": "9501082", "url": "https://glygen.org/publication/PubMed/9501082" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "Oligophrenin-1 encodes a rhoGAP protein involved in X-linked mental retardation.", "journal": "Nature", "date": "1998", "authors": "Billuart P, Bienvenu T, Ronce N, des Portes V, Vinet MC, Zemni R, Roest Crollius H, Carrie A, Fauchereau F, Cherry M, Briault S, Hamel B, Fryns JP, Beldjord C, Kahn A, Moraine C, Chelly J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9582072", "url": "https://glygen.org/publication/PubMed/9582072" } ] }, { "title": "Human colonic cancer cells synthesize and adhere to laminin-5. Their adhesion to laminin-5 involves multiple receptors among which is integrin alpha2beta1.", "journal": "Journal of cell science", "date": "1998", "authors": "Orian-Rousseau V, Aberdam D, Rousselle P, Messent A, Gavrilovic J, Meneguzzi G, Kedinger M, Simon-Assmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157" } ], "reference": [ { "type": "PubMed", "id": "9645947", "url": "https://glygen.org/publication/PubMed/9645947" } ] }, { "title": "The role of profilin in actin polymerization and nucleotide exchange.", "journal": "Biochemistry", "date": "1998", "authors": "Korenbaum E, Nordberg P, Bjorkegren-Sjogren C, Schutt CE, Lindberg U, Karlsson R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "9649308", "url": "https://glygen.org/publication/PubMed/9649308" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.", "journal": "Molecular cell", "date": "1998", "authors": "Manser E, Loo TH, Koh CG, Zhao ZS, Chen XQ, Tan L, Tan I, Leung T, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9659915", "url": "https://glygen.org/publication/PubMed/9659915" } ] }, { "title": "Activation of RhoA and SAPK/JNK signalling pathways by the RhoA-specific exchange factor mNET1.", "journal": "The EMBO journal", "date": "1998", "authors": "Alberts AS, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9670022", "url": "https://glygen.org/publication/PubMed/9670022" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Structural specializations of immunoglobulin superfamily members for adhesion to integrins and viruses.", "journal": "Immunological reviews", "date": "1998", "authors": "Wang J, Springer TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9700512", "url": "https://glygen.org/publication/PubMed/9700512" } ] }, { "title": "Structural requirements for PAK activation by Rac GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013404", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404" } ], "reference": [ { "type": "PubMed", "id": "9705280", "url": "https://glygen.org/publication/PubMed/9705280" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interactions between growth factors and integrins: latent forms of transforming growth factor-beta are ligands for the integrin alphavbeta1.", "journal": "Molecular biology of the cell", "date": "1998", "authors": "Munger JS, Harpel JG, Giancotti FG, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "9725916", "url": "https://glygen.org/publication/PubMed/9725916" } ] }, { "title": "Molecular cloning of NKp46: a novel member of the immunoglobulin superfamily involved in triggering of natural cytotoxicity.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Pessino A, Sivori S, Bottino C, Malaspina A, Morelli L, Moretta L, Biassoni R, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9730896", "url": "https://glygen.org/publication/PubMed/9730896" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia.", "journal": "The EMBO journal", "date": "1998", "authors": "Abo A, Qu J, Cammarano MS, Dan C, Fritsch A, Baud V, Belisle B, Minden A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9822598", "url": "https://glygen.org/publication/PubMed/9822598" } ] }, { "title": "Phosphorylation-dependent and constitutive activation of Rho proteins by wild-type and oncogenic Vav-2.", "journal": "The EMBO journal", "date": "1998", "authors": "Schuebel KE, Movilla N, Rosa JL, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408" } ], "reference": [ { "type": "PubMed", "id": "9822605", "url": "https://glygen.org/publication/PubMed/9822605" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] }, { "title": "SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.", "journal": "Cell", "date": "1998", "authors": "Tsukazaki T, Chiang TA, Davison AF, Attisano L, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173789", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789" } ], "reference": [ { "type": "PubMed", "id": "9865696", "url": "https://glygen.org/publication/PubMed/9865696" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013149", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:3688", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3688", "resource": "KEGG Pathway" }, { "id": "R-HSA-1566948", "name": "Elastic fibre formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566948", "resource": "Reactome", "description": "Elastic fibre formation" }, { "id": "R-HSA-1566977", "name": "Fibronectin matrix formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566977", "resource": "Reactome", "description": "Fibronectin matrix formation" }, { "id": "R-HSA-198933", "name": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-210991", "name": "Basigin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991", "resource": "Reactome", "description": "Basigin interactions" }, { "id": "R-HSA-2129379", "name": "Molecules associated with elastic fibres", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "resource": "Reactome", "description": "Molecules associated with elastic fibres" }, { "id": "R-HSA-216083", "name": "Integrin cell surface interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-2173789", "name": "TGF-beta receptor signaling activates SMADs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173789", "resource": "Reactome", "description": "TGF-beta receptor signaling activates SMADs" }, { "id": "R-HSA-3000157", "name": "Laminin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000157", "resource": "Reactome", "description": "Laminin interactions" }, { "id": "R-HSA-3000170", "name": "Syndecan interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "resource": "Reactome", "description": "Syndecan interactions" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-416700", "name": "Other semaphorin interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416700", "resource": "Reactome", "description": "Other semaphorin interactions" }, { "id": "R-HSA-445144", "name": "Signal transduction by L1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "resource": "Reactome", "description": "Signal transduction by L1" }, { "id": "R-HSA-446343", "name": "Localization of the PINCH-ILK-PARVIN complex to focal adhesions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446343", "resource": "Reactome", "description": "Localization of the PINCH-ILK-PARVIN complex to focal adhesions" }, { "id": "R-HSA-447041", "name": "CHL1 interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447041", "resource": "Reactome", "description": "CHL1 interactions" }, { "id": "R-HSA-5663220", "name": "RHO GTPases Activate Formins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "resource": "Reactome", "description": "RHO GTPases Activate Formins" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-75892", "name": "Platelet Adhesion to exposed collagen", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892", "resource": "Reactome", "description": "Platelet Adhesion to exposed collagen" }, { "id": "R-HSA-8874081", "name": "MET activates PTK2 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "resource": "Reactome", "description": "MET activates PTK2 signaling" }, { "id": "R-HSA-8875513", "name": "MET interacts with TNS proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513", "resource": "Reactome", "description": "MET interacts with TNS proteins" }, { "id": "R-HSA-9013149", "name": "RAC1 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149", "resource": "Reactome", "description": "RAC1 GTPase cycle" }, { "id": "R-HSA-9013404", "name": "RAC2 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404", "resource": "Reactome", "description": "RAC2 GTPase cycle" }, { "id": "R-HSA-9013408", "name": "RHOG GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013408", "resource": "Reactome", "description": "RHOG GTPase cycle" }, { "id": "R-HSA-9013423", "name": "RAC3 GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013423", "resource": "Reactome", "description": "RAC3 GTPase cycle" }, { "id": "R-HSA-9609690", "name": "HCMV Early Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "resource": "Reactome", "description": "HCMV Early Events" }, { "id": "R-HSA-9634597", "name": "GPER1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597", "resource": "Reactome", "description": "GPER1 signaling" }, { "id": "R-HSA-9679191", "name": "Potential therapeutics for SARS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "resource": "Reactome", "description": "Potential therapeutics for SARS" }, { "id": "R-HSA-9830674", "name": "Formation of the ureteric bud", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9830674", "resource": "Reactome", "description": "Formation of the ureteric bud" } ], "orthologs": [ { "uniprot_canonical_ac": "P09055-1", "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNLQLVSWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCLASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDTCAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVETPDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 798 }, "evidence": [ { "id": "45920664", "url": "http://www.informatics.jax.org/homology/45920664", "database": "MGI" }, { "id": "P05556", "url": "https://omabrowser.org/oma/group/P05556/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P11584-1", "protein_name": "Integrin beta-PS", "gene_name": "mys", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MILERNRRCQLALLMIAILAAIAGQTDAQKAAKLTAVSTCASKEKCHTCIQTEGCAWCMQPDFKGQSRCYQNTSSLCPEEFAYSPITVEQILVNNKLTNQYKAELAAGGGGSAMSGSSSSSYSSSSSSSSFYSQSSSGSSSASGYEEYSAGEIVQIQPQSMRLALRVNEKHNIKISYSQAEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKKLEHPCENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQDYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSVEMKDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQANSCSGHGTSMCGICNCDDSYFGNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCERNRNQLCSGPDHGTCECGRCKCKPGWTGSNCGCQESNDTCMPPGGGEICSGHGTCECGVCKCTVNDQGRFSGRHCEKCPTCSGRCQELKDCVQCQMYKTGELKNGDDCARNCTQFVPVGVEKVEIDETKDEQMCKFFDEDDCKFMFKYSEQGELHVYAQENKECPAKVFMLGIVMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKNPMYAGK", "length": 846 }, "evidence": [ { "id": "P05556", "url": "https://omabrowser.org/oma/group/P05556/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P49134-1", "protein_name": "Integrin beta-1", "gene_name": "Itgb1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNLQLVFWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCHPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESENQLKLNPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRENTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTVPCVATNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDTCAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNSKGEAHVHVVETPDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK", "length": 799 }, "evidence": [ { "id": "45920664", "url": "http://www.informatics.jax.org/homology/45920664", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 39, "go_terms": [ { "name": "myelin sheath abaxonal region", "id": "GO:0035748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035748", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "neuromuscular junction", "id": "GO:0031594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031594", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "receptor complex", "id": "GO:0043235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "intercalated disc", "id": "GO:0014704", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014704", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "filopodium", "id": "GO:0030175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030175", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cleavage furrow", "id": "GO:0032154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032154", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "ruffle membrane", "id": "GO:0032587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032587", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "ruffle", "id": "GO:0001726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001726", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "synaptic membrane", "id": "GO:0097060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097060", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha7-beta1 complex", "id": "GO:0034677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034677", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha9-beta1 complex", "id": "GO:0034679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034679", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha4-beta1 complex", "id": "GO:0034668", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034668", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin complex", "id": "GO:0008305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008305", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "glial cell projection", "id": "GO:0097386", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097386", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha3-beta1 complex", "id": "GO:0034667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034667", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha8-beta1 complex", "id": "GO:0034678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034678", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha10-beta1 complex", "id": "GO:0034680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034680", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha11-beta1 complex", "id": "GO:0034681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034681", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha1-beta1 complex", "id": "GO:0034665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034665", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha2-beta1 complex", "id": "GO:0034666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034666", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "Schaffer collateral - CA1 synapse", "id": "GO:0098685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098685", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin alpha5-beta1 complex", "id": "GO:0034674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034674", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cerebellar climbing fiber to Purkinje cell synapse", "id": "GO:0150053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150053", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "anchoring junction", "id": "GO:0070161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070161", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 64, "go_terms": [ { "name": "calcium-independent cell-matrix adhesion", "id": "GO:0007161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007161", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cardiac muscle cell myoblast differentiation", "id": "GO:0060379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060379", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "CD40 signaling pathway", "id": "GO:0023035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023035", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cardiac cell fate specification", "id": "GO:0060912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060912", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "receptor internalization", "id": "GO:0031623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031623", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "negative regulation of neuron differentiation", "id": "GO:0045665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045665", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cellular defense response", "id": "GO:0006968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006968", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell adhesion mediated by integrin", "id": "GO:0033627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033627", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell-cell adhesion mediated by integrin", "id": "GO:0033631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033631", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "muscle organ development", "id": "GO:0007517", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007517", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of wound healing", "id": "GO:0090303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090303", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "leukocyte cell-cell adhesion", "id": "GO:0007159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007159", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "lamellipodium assembly", "id": "GO:0030032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030032", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of protein localization to plasma membrane", "id": "GO:1903078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903078", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "myoblast fusion", "id": "GO:0007520", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007520", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "B cell differentiation", "id": "GO:0030183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "G1/S transition of mitotic cell cycle", "id": "GO:0000082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000082", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "wound healing, spreading of epidermal cells", "id": "GO:0035313", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035313", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "dendrite morphogenesis", "id": "GO:0048813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048813", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "homophilic cell adhesion via plasma membrane adhesion molecules", "id": "GO:0007156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007156", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "sarcomere organization", "id": "GO:0045214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045214", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "leukocyte tethering or rolling", "id": "GO:0050901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050901", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cardiac muscle cell differentiation", "id": "GO:0055007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055007", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "negative regulation of vasoconstriction", "id": "GO:0045906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045906", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of fibroblast migration", "id": "GO:0010763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010763", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell projection organization", "id": "GO:0030030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030030", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "negative regulation of Rho protein signal transduction", "id": "GO:0035024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035024", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "formation of radial glial scaffolds", "id": "GO:0021943", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021943", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "establishment of mitotic spindle orientation", "id": "GO:0000132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000132", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell-substrate adhesion", "id": "GO:0031589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031589", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "neuroblast proliferation", "id": "GO:0007405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007405", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "myoblast differentiation", "id": "GO:0045445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045445", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of neuroblast proliferation", "id": "GO:0002052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002052", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "axon extension", "id": "GO:0048675", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048675", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "germ cell migration", "id": "GO:0008354", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008354", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "regulation of collagen catabolic process", "id": "GO:0010710", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010710", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "regulation of inward rectifier potassium channel activity", "id": "GO:1901979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901979", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell migration involved in sprouting angiogenesis", "id": "GO:0002042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002042", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "regulation of cell cycle", "id": "GO:0051726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051726", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "negative regulation of anoikis", "id": "GO:2000811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000811", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of vascular endothelial growth factor signaling pathway", "id": "GO:1900748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900748", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cellular response to low-density lipoprotein particle stimulus", "id": "GO:0071404", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071404", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "heterotypic cell-cell adhesion", "id": "GO:0034113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034113", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "basement membrane organization", "id": "GO:0071711", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071711", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of fibroblast growth factor receptor signaling pathway", "id": "GO:0045743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045743", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "mesodermal cell differentiation", "id": "GO:0048333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048333", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "maintenance of blood-brain barrier", "id": "GO:0035633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035633", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "regulation of spontaneous synaptic transmission", "id": "GO:0150003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150003", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "positive regulation of glutamate uptake involved in transmission of nerve impulse", "id": "GO:0051951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051951", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "reactive gliosis", "id": "GO:0150103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150103", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "myoblast fate specification", "id": "GO:0048626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048626", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "regulation of synapse pruning", "id": "GO:1905806", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905806", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 17, "go_terms": [ { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "laminin binding", "id": "GO:0043236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043236", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "cell adhesion molecule binding", "id": "GO:0050839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050839", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "fibronectin binding", "id": "GO:0001968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001968", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "integrin binding involved in cell-matrix adhesion", "id": "GO:0098640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098640", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "protein tyrosine kinase binding", "id": "GO:1990782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990782", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "collagen binding involved in cell-matrix adhesion", "id": "GO:0098639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098639", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P05556", "url": "https://www.uniprot.org/uniprot/P05556" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "integrin beta-1 N-glycosylated 1 (human)", "definition": "An integrin beta-1 (human) that has been N-glycosylated at the residue equivalent to Asn-212 of the amino acid sequence represented by UniProtKB:P05556-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P05556-1, Asn-212, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053565", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053565" } ] }, { "name": "integrin beta-1 N-glycosylated 2 (human)", "definition": "An integrin beta-1 (human) that has been N-glycosylated at the residue equivalent to Asn-212 of the amino acid sequence represented by UniProtKB:P05556-1, in which the glycan composition is represented by GlyTouCan:G43769HG. Example: UniProtKB:P05556-1, Asn-212, MOD:00160~GNO:G43769HG. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053566", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053566" } ] }, { "name": "integrin beta-1 N-glycosylated 3 (human)", "definition": "An integrin beta-1 (human) that has been N-glycosylated at the residue equivalent to Asn-669 of the amino acid sequence represented by UniProtKB:P05556-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P05556-1, Asn-669, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053567", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053567" } ] }, { "name": "integrin beta-1 N-glycosylated 4 (human)", "definition": "An integrin beta-1 (human) that has been N-glycosylated at the residue equivalent to Asn-97 of the amino acid sequence represented by UniProtKB:P05556-1, in which the glycan composition is represented by GlyTouCan:G25987BV. Example: UniProtKB:P05556-1, Asn-97, MOD:00160~GNO:G25987BV. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000053568", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053568" } ] } ], "site_annotation": [ { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" }, { "start_pos": 406, "end_pos": 408, "annotation": "n_glycosylation_sequon" }, { "start_pos": 417, "end_pos": 419, "annotation": "n_glycosylation_sequon" }, { "start_pos": 481, "end_pos": 483, "annotation": "n_glycosylation_sequon" }, { "start_pos": 50, "end_pos": 52, "annotation": "n_glycosylation_sequon" }, { "start_pos": 520, "end_pos": 522, "annotation": "n_glycosylation_sequon" }, { "start_pos": 584, "end_pos": 586, "annotation": "n_glycosylation_sequon" }, { "start_pos": 669, "end_pos": 671, "annotation": "n_glycosylation_sequon" }, { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 44, 50, 94, 97, 212, 269, 363, 406, 417, 481, 520, 584, 669 ], "o_linked_sites": [ 96, 99, 102, 191, 214, 389, 394, 586, 588, 593, 596, 597, 598, 602 ], "snv_sites": [ 33, 52, 94, 97, 99, 197, 214, 224, 307, 363, 377, 394, 417, 419, 522, 547, 584, 588, 593, 596, 597, 669, 774 ], "glycation_sites": [], "phosphorylation_sites": [ 224, 226, 327, 333, 777, 783, 785, 788, 789, 795 ], "sequon_annotation_sites": [ { "start_pos": 212, "end_pos": 214 }, { "start_pos": 269, "end_pos": 271 }, { "start_pos": 363, "end_pos": 365 }, { "start_pos": 406, "end_pos": 408 }, { "start_pos": 417, "end_pos": 419 }, { "start_pos": 481, "end_pos": 483 }, { "start_pos": 50, "end_pos": 52 }, { "start_pos": 520, "end_pos": 522 }, { "start_pos": 584, "end_pos": 586 }, { "start_pos": 669, "end_pos": 671 }, { "start_pos": 94, "end_pos": 96 }, { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 158 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 91 }, { "field": "n_linked_glycan_sites", "count": 20 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 145 }, { "field": "total_sites", "count": 20 }, { "field": "n_linked_glycans", "count": 91 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 23 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 22 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 898 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }