{ "uniprot_canonical_ac": "P05090-1", "uniprot_ac": "P05090", "uniprot_id": "APOD_HUMAN", "mass": { "chemical_mass": 21276.0, "monoisotopic_mass": 21276.0 }, "refseq": { "ac": "NP_001638", "name": "apolipoprotein D precursor", "summary": "This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, "gene_names": [ { "name": "APOD", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05090", "id": "P05090" }, { "name": "APOD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638", "id": "NP_001638" } ], "protein_names": [ { "name": "Apolipoprotein D", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05090" }, { "name": "Apo-D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05090" }, { "name": "ApoD", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05090" }, { "name": "apo-D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638", "id": "NP_001638" }, { "name": "apolipoprotein D precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638", "id": "NP_001638" } ], "function": [ { "annotation": "APOD acts on fibroblast-like synoviocyte and chondrocyte to alleviate the process of osteoarthritis in vitro.", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, { "database": "PubMed", "id": "37728985", "url": "https://glygen.org/publication/PubMed/37728985" } ] }, { "annotation": "APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#function" } ] }, { "annotation": "Apolipoprotein D-mediated preservation of lysosomal function promotes cell survival and delays motor impairment in Niemann-Pick type A disease.", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, { "database": "PubMed", "id": "32798728", "url": "https://glygen.org/publication/PubMed/32798728" } ] }, { "annotation": "Enrichment of apolipoprotein A-IV and apolipoprotein D in the HDL proteome is associated with HDL functions in diabetic kidney disease without dialysis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, { "database": "PubMed", "id": "32921312", "url": "https://glygen.org/publication/PubMed/32921312" } ] }, { "annotation": "Identification of Apolipoprotein D as a Dermal Fibroblast Marker of Human Aging for Development of Skin Rejuvenation Therapy.", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, { "database": "PubMed", "id": "36571249", "url": "https://glygen.org/publication/PubMed/36571249" } ] }, { "annotation": "Neuroprotective Effect of Apolipoprotein D in Cuprizone-Induced Cell Line Models: A Potential Therapeutic Approach for Multiple Sclerosis and Demyelinating Diseases. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" }, { "database": "PubMed", "id": "33514021", "url": "https://glygen.org/publication/PubMed/33514021" } ] }, { "annotation": "This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs770211419", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770211419" }, { "id": "rs770211419", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770211419" }, { "id": "rs770211419", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770211419#frequency_tab" }, { "id": "rs770211419", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770211419" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 67, "end_pos": 67, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->NYA); o-glyco-site-loss (S->A).", "chr_id": "3", "chr_pos": "195573896", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S67", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749474201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749474201" }, { "id": "rs749474201", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749474201" }, { "id": "rs749474201", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749474201" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 100, "end_pos": 100, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "3", "chr_pos": "195571312", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T100", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1404646336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1404646336" }, { "id": "rs1404646336", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1404646336#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 108, "end_pos": 108, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KFS->NFS).", "chr_id": "3", "chr_pos": "195571287", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K108", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1263839447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1263839447" }, { "id": "rs1263839447", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1263839447#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 129, "end_pos": 129, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYA->NYS).", "chr_id": "3", "chr_pos": "195569085", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A129", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05090", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05090" }, { "id": "rs1368578637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368578637" }, { "id": "rs1368578637", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368578637" }, { "id": "rs1368578637", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1368578637#frequency_tab" }, { "id": "rs1368578637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1368578637" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 156, "end_pos": 156, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "3", "chr_pos": "195569004", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P156", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P05090", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05090" }, { "id": "rs754030446", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754030446" }, { "id": "rs754030446", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754030446" }, { "id": "rs754030446", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754030446" }, { "id": "rs754030446", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754030446#frequency_tab" }, { "id": "rs754030446", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754030446" }, { "id": "21720365", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21720365" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 172, "end_pos": 172, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNI->NNT).", "chr_id": "3", "chr_pos": "195568955", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "I172", "disease": [ { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs1577602196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577602196" }, { "id": "rs1577602196", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1577602196" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 98, "end_pos": 98, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "3", "chr_pos": "195571318", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N98", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "88.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "86.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "98.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "92.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "92.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "84.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "72.53", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05090" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "common_name": "Human" } ], "gene": [ { "name": "APOD", "url": "https://www.uniprot.org/uniprot/P05090", "locus": { "chromosome": "3", "start_pos": 195568705, "end_pos": 195584033, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000189058", "url": "https://www.ensembl.org/id/ENSG00000189058" } ] } } ], "crossref": [ { "id": "ENSG00000189058", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000189058", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05090", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05090", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd19437", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19437", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "APOD", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APOD", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "347", "url": "https://www.ncbi.nlm.nih.gov/gene/347", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "612", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=612", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "C9JF17", "url": "https://www.ebi.ac.uk/intact/interactors/id:C9JF17*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P05090", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05090*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012674", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012674", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022272", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022272", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026222", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026222", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:347", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:347", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107740", "url": "http://www.omim.org/entry/107740", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05090", "url": "https://www.nextprot.org/entry/NX_P05090", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P05090", "url": "https://oglcnac.org/atlas/detail/P05090", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P05090", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05090", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "VWSCYEF", "url": "https://omabrowser.org/oma/group/VWSCYEF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3783962at2759", "url": "http://www.orthodb.org/?query=3783962at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10612", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10612", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10612:SF34", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10612:SF34", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46254", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46254", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46254:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46254:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2HZQ", "url": "https://www.rcsb.org/structure/2HZQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HZR", "url": "https://www.rcsb.org/structure/2HZR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08212", "url": "http://pfam.xfam.org/family/PF08212", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05090", "url": "https://pharos.nih.gov/targets/P05090", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053423", "url": "https://proconsortium.org/app/entry/PR:000053423", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053424", "url": "https://proconsortium.org/app/entry/PR:000053424", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053425", "url": "https://proconsortium.org/app/entry/PR:000053425", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053426", "url": "https://proconsortium.org/app/entry/PR:000053426", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053427", "url": "https://proconsortium.org/app/entry/PR:000053427", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053428", "url": "https://proconsortium.org/app/entry/PR:000053428", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053429", "url": "https://proconsortium.org/app/entry/PR:000053429", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053430", "url": "https://proconsortium.org/app/entry/PR:000053430", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053431", "url": "https://proconsortium.org/app/entry/PR:000053431", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053432", "url": "https://proconsortium.org/app/entry/PR:000053432", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053433", "url": "https://proconsortium.org/app/entry/PR:000053433", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053434", "url": "https://proconsortium.org/app/entry/PR:000053434", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053435", "url": "https://proconsortium.org/app/entry/PR:000053435", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053436", "url": "https://proconsortium.org/app/entry/PR:000053436", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053437", "url": "https://proconsortium.org/app/entry/PR:000053437", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053438", "url": "https://proconsortium.org/app/entry/PR:000053438", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053439", "url": "https://proconsortium.org/app/entry/PR:000053439", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053440", "url": "https://proconsortium.org/app/entry/PR:000053440", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053441", "url": "https://proconsortium.org/app/entry/PR:000053441", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053442", "url": "https://proconsortium.org/app/entry/PR:000053442", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053443", "url": "https://proconsortium.org/app/entry/PR:000053443", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053444", "url": "https://proconsortium.org/app/entry/PR:000053444", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053445", "url": "https://proconsortium.org/app/entry/PR:000053445", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053446", "url": "https://proconsortium.org/app/entry/PR:000053446", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053447", "url": "https://proconsortium.org/app/entry/PR:000053447", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053448", "url": "https://proconsortium.org/app/entry/PR:000053448", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053449", "url": "https://proconsortium.org/app/entry/PR:000053449", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P05090", "url": "http://purl.obolibrary.org/obo/PR_P05090", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P05090", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "C9JF17", "url": "https://www.uniprot.org/uniprot/C9JF17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JF17-1", "url": "https://www.uniprot.org/uniprot/C9JF17-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JX71", "url": "https://www.uniprot.org/uniprot/C9JX71", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JX71-1", "url": "https://www.uniprot.org/uniprot/C9JX71-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBT9", "url": "https://www.uniprot.org/uniprot/F8WBT9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBT9-1", "url": "https://www.uniprot.org/uniprot/F8WBT9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05090-1", "url": "https://www.uniprot.org/uniprot/P05090-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS", "length": 189, "header": "sp|P05090-1|APOD_HUMAN Isoform 1 of Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1 CANONICAL=P05090-1" }, "isoforms": [ { "isoform_ac": "C9JF17-1", "url": "", "sequence": { "sequence": "MFKQLSCISLPSSCDYSSRSLLQPPSPKMVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPK", "length": 215, "header": "tr|C9JF17-1|C9JF17_HUMAN Computationally mapped isoform of Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1 CANONICAL=P05090-1" }, "locus": { "chromosome": "3", "start_pos": 195582666, "end_pos": 195568909, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000421243.5", "url": "https://www.ensembl.org/id/ENST00000421243.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000415235.1", "url": "https://www.ensembl.org/id/ENSP00000415235.1" } ] } }, { "isoform_ac": "C9JX71-1", "url": "", "sequence": { "sequence": "MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWIL", "length": 149, "header": "tr|C9JX71-1|C9JX71_HUMAN Computationally mapped isoform of Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1 CANONICAL=P05090-1" }, "locus": { "chromosome": "3", "start_pos": 195579461, "end_pos": 195569023, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000453131.1", "url": "https://www.ensembl.org/id/ENST00000453131.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000393076.1", "url": "https://www.ensembl.org/id/ENSP00000393076.1" } ] } }, { "isoform_ac": "F8WBT9-1", "url": "", "sequence": { "sequence": "MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKTESHFVTQGGVQHHHLGSLQPPPPGFKQFSCLSLPSSWDYSISEDGTKLRRSQQPLRMDAASRPTTH", "length": 108, "header": "tr|F8WBT9-1|F8WBT9_HUMAN Computationally mapped isoform of Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1 CANONICAL=P05090-1" }, "locus": { "chromosome": "3", "start_pos": 195579461, "end_pos": 195573893, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000458447.5", "url": "https://www.ensembl.org/id/ENST00000458447.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391597.1", "url": "https://www.ensembl.org/id/ENSP00000391597.1" } ] } }, { "isoform_ac": "P05090-1", "url": "", "sequence": { "sequence": "MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS", "length": 189, "header": "sp|P05090-1|APOD_HUMAN Isoform 1 of Apolipoprotein D OS=Homo sapiens OX=9606 GN=APOD PE=1 SV=1 CANONICAL=P05090-1" }, "locus": { "chromosome": "3", "start_pos": 195579461, "end_pos": 195568903, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000343267.8", "url": "https://www.ensembl.org/id/ENST00000343267.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000345179.3", "url": "https://www.ensembl.org/id/ENSP00000345179.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P05090@N65", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N65" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P05090@N65", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N65" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10019LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G13694XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G13728QT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P05090@N65", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N65" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P05090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "7918467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7918467" }, { "id": "7613477", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7613477" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 67, "start_aa": "Ser", "end_pos": 67, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser67", "evidence": [ { "id": "P05090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05090" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "P05090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P05090" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G03461SC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G06330RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G31433PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G44753VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G49739MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G68833MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G71560PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G73686WG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82592ZH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G86408JD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G88061BX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89205CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P05090@N98", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P05090@N98" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "P05090", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "P05090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "7918467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7918467" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "7613477", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7613477" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "22171320", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22171320" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.", "journal": "Nat. Genet.", "date": "1999", "authors": "Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "10391209", "url": "https://glygen.org/publication/PubMed/10391209" } ] }, { "title": "Identification of the major intestinal fatty acid transport protein.", "journal": "Molecular cell", "date": "1999", "authors": "Stahl A, Hirsch DJ, Gimeno RE, Punreddy S, Ge P, Watson N, Patel S, Kotler M, Raimondi A, Tartaglia LA, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "10518211", "url": "https://glygen.org/publication/PubMed/10518211" } ] }, { "title": "Sterol-dependent transactivation of the ABC1 promoter by the liver X receptor/retinoid X receptor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Costet P, Luo Y, Wang N, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "10858438", "url": "https://glygen.org/publication/PubMed/10858438" } ] }, { "title": "LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Laffitte BA, Repa JJ, Joseph SB, Wilpitz DC, Kast HR, Mangelsdorf DJ, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11149950", "url": "https://glygen.org/publication/PubMed/11149950" } ] }, { "title": "Characterization of the human ABCG1 gene: liver X receptor activates an internal promoter that produces a novel transcript encoding an alternative form of the protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kennedy MA, Venkateswaran A, Tarr PT, Xenarios I, Kudoh J, Shimizu N, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11500512", "url": "https://glygen.org/publication/PubMed/11500512" } ] }, { "title": "Autoregulation of the human liver X receptor alpha promoter.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Laffitte BA, Joseph SB, Walczak R, Pei L, Wilpitz DC, Collins JL, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11604492", "url": "https://glygen.org/publication/PubMed/11604492" } ] }, { "title": "Induction of human liver X receptor alpha gene expression via an autoregulatory loop mechanism.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Li Y, Bolten C, Bhat BG, Woodring-Dietz J, Li S, Prayaga SK, Xia C, Lala DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11875109", "url": "https://glygen.org/publication/PubMed/11875109" } ] }, { "title": "Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mak PA, Laffitte BA, Desrumaux C, Joseph SB, Curtiss LK, Mangelsdorf DJ, Tontonoz P, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12032151", "url": "https://glygen.org/publication/PubMed/12032151" } ] }, { "title": "Comparative genome analysis of potential regulatory elements in the ABCG5-ABCG8 gene cluster.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Remaley AT, Bark S, Walts AD, Freeman L, Shulenin S, Annilo T, Elgin E, Rhodes HE, Joyce C, Dean M, Santamarina-Fojo S, Brewer HB Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12150943", "url": "https://glygen.org/publication/PubMed/12150943" } ] }, { "title": "FATP1 channels exogenous FA into 1,2,3-triacyl-sn-glycerol and down-regulates sphingomyelin and cholesterol metabolism in growing 293 cells.", "journal": "Journal of lipid research", "date": "2002", "authors": "Hatch GM, Smith AJ, Xu FY, Hall AM, Bernlohr DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "12235169", "url": "https://glygen.org/publication/PubMed/12235169" } ] }, { "title": "Identification of PLTP as an LXR target gene and apoE as an FXR target gene reveals overlapping targets for the two nuclear receptors.", "journal": "Journal of lipid research", "date": "2002", "authors": "Mak PA, Kast-Woelbern HR, Anisfeld AM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12454263", "url": "https://glygen.org/publication/PubMed/12454263" } ] }, { "title": "Characterization of a heart-specific fatty acid transport protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gimeno RE, Ortegon AM, Patel S, Punreddy S, Ge P, Sun Y, Lodish HF, Stahl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "12556534", "url": "https://glygen.org/publication/PubMed/12556534" } ] }, { "title": "The phospholipid transfer protein gene is a liver X receptor target expressed by macrophages in atherosclerotic lesions.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Laffitte BA, Joseph SB, Chen M, Castrillo A, Repa J, Wilpitz D, Mangelsdorf D, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12612088", "url": "https://glygen.org/publication/PubMed/12612088" } ] }, { "title": "Liver X receptors are regulators of adipocyte gene expression but not differentiation: identification of apoD as a direct target.", "journal": "Journal of lipid research", "date": "2004", "authors": "Hummasti S, Laffitte BA, Watson MA, Galardi C, Chao LC, Ramamurthy L, Moore JT, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14703507", "url": "https://glygen.org/publication/PubMed/14703507" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Role of p160 coactivator complex in the activation of liver X receptor.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "Huuskonen J, Fielding PE, Fielding CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14764426", "url": "https://glygen.org/publication/PubMed/14764426" } ] }, { "title": "ADP-ribosylation factor (ARF)-like 7 (ARL7) is induced by cholesterol loading and participates in apolipoprotein AI-dependent cholesterol export.", "journal": "FEBS letters", "date": "2004", "authors": "Engel T, Lueken A, Bode G, Hobohm U, Lorkowski S, Schlueter B, Rust S, Cullen P, Pech M, Assmann G, Seedorf U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "15147902", "url": "https://glygen.org/publication/PubMed/15147902" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Lipocalins - a family portrait.", "journal": "Journal of plant physiology", "date": "2006", "authors": "Grzyb J, Latowski D, Strzalka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "16504339", "url": "https://glygen.org/publication/PubMed/16504339" } ] }, { "title": "Selective up-regulation of LXR-regulated genes ABCA1, ABCG1, and APOE in macrophages through increased endogenous synthesis of 24(S),25-epoxycholesterol.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Beyea MM, Heslop CL, Sawyez CG, Edwards JY, Markle JG, Hegele RA, Huff MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "17186944", "url": "https://glygen.org/publication/PubMed/17186944" } ] }, { "title": "Direct interaction of nuclear liver X receptor-beta with ABCA1 modulates cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hozoji M, Munehira Y, Ikeda Y, Makishima M, Matsuo M, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "18782758", "url": "https://glygen.org/publication/PubMed/18782758" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.", "journal": "Molecular cell", "date": "2009", "authors": "Jakobsson T, Venteclef N, Toresson G, Damdimopoulos AE, Ehrlund A, Lou X, Sanyal S, Steffensen KR, Gustafsson JA, Treuter E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "19481530", "url": "https://glygen.org/publication/PubMed/19481530" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" }, { "database": "UniCarbKB", "id": "P05090", "url": "" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Apolipoprotein D in lipid metabolism and its functional implication in atherosclerosis and aging.", "journal": "Aging", "date": "2009", "authors": "Perdomo G, Henry Dong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "19946382", "url": "https://glygen.org/publication/PubMed/19946382" } ] }, { "title": "A role of apolipoprotein D in triglyceride metabolism.", "journal": "Journal of lipid research", "date": "2010", "authors": "Perdomo G, Kim DH, Zhang T, Qu S, Thomas EA, Toledo FG, Slusher S, Fan Y, Kelley DE, Dong HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "20124557", "url": "https://glygen.org/publication/PubMed/20124557" } ] }, { "title": "MicroRNA-33 and the SREBP host genes cooperate to control cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Najafi-Shoushtari SH, Kristo F, Li Y, Shioda T, Cohen DE, Gerszten RE, Naar AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466882", "url": "https://glygen.org/publication/PubMed/20466882" } ] }, { "title": "MiR-33 contributes to the regulation of cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Rayner KJ, Suarez Y, Davalos A, Parathath S, Fitzgerald ML, Tamehiro N, Fisher EA, Moore KJ, Fernandez-Hernando C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466885", "url": "https://glygen.org/publication/PubMed/20466885" } ] }, { "title": "LXRalpha regulates human CETP expression in vitro and in transgenic mice.", "journal": "Atherosclerosis", "date": "2010", "authors": "Honzumi S, Shima A, Hiroshima A, Koieyama T, Ubukata N, Terasaka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20494359", "url": "https://glygen.org/publication/PubMed/20494359" } ] }, { "title": "miR-33 links SREBP-2 induction to repression of sterol transporters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Marquart TJ, Allen RM, Ory DS, Baldan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20566875", "url": "https://glygen.org/publication/PubMed/20566875" } ] }, { "title": "Is apolipoprotein D a mammalian bilin-binding protein?", "journal": "New Biol.", "date": "1990", "authors": "Peitsch M C, Boguski M S", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "2083249", "url": "https://glygen.org/publication/PubMed/2083249" } ] }, { "title": "MicroRNA-33 encoded by an intron of sterol regulatory element-binding protein 2 (Srebp2) regulates HDL in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Horie T, Ono K, Horiguchi M, Nishi H, Nakamura T, Nagao K, Kinoshita M, Kuwabara Y, Marusawa H, Iwanaga Y, Hasegawa K, Yokode M, Kimura T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20855588", "url": "https://glygen.org/publication/PubMed/20855588" } ] }, { "title": "Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.", "journal": "Journal of lipid research", "date": "2011", "authors": "Hong C, Walczak R, Dhamko H, Bradley MN, Marathe C, Boyadjian R, Salazar JV, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21187453", "url": "https://glygen.org/publication/PubMed/21187453" } ] }, { "title": "MicroRNA hsa-miR-613 targets the human LXRalpha gene and mediates a feedback loop of LXRalpha autoregulation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Ou Z, Wada T, Gramignoli R, Li S, Strom SC, Huang M, Xie W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21310851", "url": "https://glygen.org/publication/PubMed/21310851" } ] }, { "title": "Liver X receptor beta (LXRbeta) interacts directly with ATP-binding cassette A1 (ABCA1) to promote high density lipoprotein formation during acute cholesterol accumulation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Hozoji-Inada M, Munehira Y, Nagao K, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21507939", "url": "https://glygen.org/publication/PubMed/21507939" } ] }, { "title": "Integrated genomic analyses of ovarian carcinoma.", "journal": "Nature", "date": "2011", "authors": "Bell D, Berchuck A, Birrer M, Chien J, Cramer D, Dao F, Dhir R, DiSaia P, Gabra H, Glenn P, Godwin A, Gross J, Hartmann L, Huang M, Huntsman D, Iacocca M, Imielinski M, Kalloger S, Karlan B, Levine D, Mills G, Morrison C, Mutch D, Olvera N, Orsulic S, Park K, Petrelli N, Rabeno B, Rader J, Sikic B, Smith-McCune K, Sood A, Bowtell D, Penny R, Testa J, Chang K, Dinh H, Drummond J, Fowler G, Gunaratne P, Hawes A, Kovar C, Lewis L, Morgan M, Newsham I, Santibanez J, Reid J, Trevino L, Wu Y-, Wang M, Muzny D, Wheeler D, Gibbs R, Getz G, Lawrence M, Cibulskis K, Sivachenko A, Sougnez C, Voet D, Wilkinson J, Bloom T, Ardlie K, Fennell T, Baldwin J, Gabriel S, Lander E, Ding LL, Fulton R, Koboldt D, McLellan M, Wylie T, Walker J, O'Laughlin M, Dooling D, Fulton L, Abbott R, Dees N, Zhang Q, Kandoth C, Wendl M, Schierding W, Shen D, Harris C, Schmidt H, Kalicki J, Delehaunty K, Fronick C, Demeter R, Cook L, Wallis J, Lin L, Magrini V, Hodges J, Eldred J, Smith S, Pohl C, Vandin F, Raphael B, Weinstock G, Mardis E, Wilson R, Meyerson M, Winckler W, Getz G, Verhaak R, Carter S, Mermel C, Saksena G, Nguyen H, Onofrio R, Lawrence M, Hubbard D, Gupta S, Crenshaw A, Ramos A, Ardlie K, Chin L, Protopopov A, Zhang J, Kim T, Perna I, Xiao Y, Zhang H, Ren G, Sathiamoorthy N, Park R, Lee E, Park P, Kucherlapati R, Absher M, Waite L, Sherlock G, Brooks J, Li J, Xu J, Myers R, Laird PW, Cope L, Herman J, Shen H, Weisenberger D, Noushmehr H, Pan F, Triche T Jr, Berman B, Van Den Berg D, Buckley J, Baylin S, Spellman P, Purdom E, Neuvial P, Bengtsson H, Jakkula L, Durinck S, Han J, Dorton S, Marr H, Choi Y, Wang V, Wang N, Ngai J, Conboy J, Parvin B, Feiler H, Speed T, Gray J, Levine A, Socci N, Liang Y, Taylor B, Schultz N, Borsu L, Lash A, Brennan C, Viale A, Sander C, Ladanyi M, Hoadley K, Meng S, Du Y, Shi Y, Li L, Turman Y, Zang D, Helms E, Balu S, Zhou X, Wu J, Topal M, Hayes D, Perou C, Getz G, Voet D, Saksena G, Zhang J, Zhang H, Wu C, Shukla S, Cibulskis K, Lawrence M, Sivachenko A, Jing R, Park R, Liu Y, Park P, Noble M, Chin L, Carter H, Kim D, Karchin R, Spellman P, Purdom E, Neuvial P, Bengtsson H, Durinck S, Han J, Korkola J, Heiser L, Cho R, Hu Z, Parvin B, Speed T, Gray J, Schultz N, Cerami E, Taylor B, Olshen A, Reva B, Antipin Y, Shen R, Mankoo P, Sheridan R, Ciriello G, Chang W, Bernanke J, Borsu L, Levine D, Ladanyi M, Sander C, Haussler D, Benz C, Stuart J, Benz S, Sanborn J, Vaske C, Zhu J, Szeto C, Scott G, Yau C, Hoadley K, Du Y, Balu S, Hayes D, Perou C, Wilkerson M, Zhang N, Akbani R, Baggerly K, Yung W, Mills G, Weinstein J, Penny R, Shelton T, Grimm D, Hatfield M, Morris S, Yena P, Rhodes P, Sherman M, Paulauskis J, Millis S, Kahn A, Greene J, Sfeir R, Jensen M, Chen J, Whitmore J, Alonso S, Jordan J, Chu A, Zhang J, Barker A, Compton C, Eley G, Ferguson M, Fielding P, Gerhard D, Myles R, Schaefer C, Mills Shaw K, Vaught J, Vockley J, Good P, Guyer M, Ozenberger B, Peterson J, Thomson E", "evidence": [ { "database": "dbSNP", "id": "rs754030446", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754030446" } ], "reference": [ { "type": "PubMed", "id": "21720365", "url": "https://glygen.org/publication/PubMed/21720365" } ] }, { "title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" }, { "database": "UniCarbKB", "id": "P05090", "url": "" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] }, { "title": "Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease.", "journal": "Biochem. J.", "date": "1990", "authors": "Balbin M, Freije JM, Fueyo A, Sanchez LM, Lopez-Otin C", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "2244881", "url": "https://glygen.org/publication/PubMed/2244881" } ] }, { "title": "Liver X receptor biology and pharmacology: new pathways, challenges and opportunities.", "journal": "Trends in pharmacological sciences", "date": "2012", "authors": "Jakobsson T, Treuter E, Gustafsson JA, Steffensen KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "22541735", "url": "https://glygen.org/publication/PubMed/22541735" } ] }, { "title": "MiR-26 controls LXR-dependent cholesterol efflux by targeting ABCA1 and ARL7.", "journal": "FEBS letters", "date": "2012", "authors": "Sun D, Zhang J, Xie J, Wei W, Chen M, Zhao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "22673513", "url": "https://glygen.org/publication/PubMed/22673513" } ] }, { "title": "MicroRNA-613 represses lipogenesis in HepG2 cells by downregulating LXRalpha.", "journal": "Lipids in health and disease", "date": "2013", "authors": "Zhong D, Zhang Y, Zeng YJ, Gao M, Wu GZ, Hu CJ, Huang G, He FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23496987", "url": "https://glygen.org/publication/PubMed/23496987" } ] }, { "title": "MicroRNA-144 regulates hepatic ATP binding cassette transporter A1 and plasma high-density lipoprotein after activation of the nuclear receptor farnesoid X receptor.", "journal": "Circulation research", "date": "2013", "authors": "de Aguiar Vallim TQ, Tarling EJ, Kim T, Civelek M, Baldan A, Esau C, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23519696", "url": "https://glygen.org/publication/PubMed/23519696" } ] }, { "title": "Cooperative transcriptional activation of ATP-binding cassette sterol transporters ABCG5 and ABCG8 genes by nuclear receptors including Liver-X-Receptor.", "journal": "BMB reports", "date": "2013", "authors": "Back SS, Kim J, Choi D, Lee ES, Choi SY, Han K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23790976", "url": "https://glygen.org/publication/PubMed/23790976" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Human apolipoprotein D gene: gene sequence, chromosome localization, and homology to the alpha 2u-globulin superfamily.", "journal": "DNA", "date": "1987", "authors": "Drayna D T, McLean J W, Wion K L, Trent J M, Drabkin H A, Lawn R M", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "2439269", "url": "https://glygen.org/publication/PubMed/2439269" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "Serum CETP status is independently associated with reduction rates in LDL-C in pitavastatin-treated diabetic patients and possible involvement of LXR in its association.", "journal": "Lipids in health and disease", "date": "2016", "authors": "Shimada A, Kimura H, Oida K, Kanehara H, Bando Y, Sakamoto S, Wakasugi T, Saga T, Ito Y, Kamiyama K, Mikami D, Iwano M, Hirano T, Yoshida H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "26984517", "url": "https://glygen.org/publication/PubMed/26984517" } ] }, { "title": "EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2017", "authors": "Nelson JK, Koenis DS, Scheij S, Cook EC, Moeton M, Santos A, Lobaccaro JA, Baron S, Zelcer N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28082258", "url": "https://glygen.org/publication/PubMed/28082258" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P05090", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05090" }, { "database": "O-GlcNAc Atlas", "id": "P05090", "url": "https://oglcnac.org/atlas/detail/P05090" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Activation of liver X receptor suppresses angiogenesis via induction of ApoD.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2017", "authors": "Lai CJ, Cheng HC, Lin CY, Huang SH, Chen TH, Chung CJ, Chang CH, Wang HD, Chuu CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28842423", "url": "https://glygen.org/publication/PubMed/28842423" } ] }, { "title": "Critical Role of the Human ATP-Binding Cassette G1 Transporter in Cardiometabolic Diseases.", "journal": "International journal of molecular sciences", "date": "2017", "authors": "Hardy LM, Frisdal E, Le Goff W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28869506", "url": "https://glygen.org/publication/PubMed/28869506" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P05090", "url": "" }, { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Epigenetic regulation of genes involved in the reverse cholesterol transport through interaction with miRNAs.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2018", "authors": "Zaiou M, Rihn BH, Bakillah A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "29772548", "url": "https://glygen.org/publication/PubMed/29772548" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "677", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Apolipoprotein D-mediated preservation of lysosomal function promotes cell survival and delays motor impairment in Niemann-Pick type A disease.", "journal": "Neurobiology of disease", "date": "2020", "authors": "Pascua-Maestro R, Corraliza-Gomez M, Fadrique-Rojo C, Ledesma MD, Schuchman EH, Sanchez D, Ganfornina MD", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ], "reference": [ { "type": "PubMed", "id": "32798728", "url": "https://glygen.org/publication/PubMed/32798728" } ] }, { "title": "Enrichment of apolipoprotein A-IV and apolipoprotein D in the HDL proteome is associated with HDL functions in diabetic kidney disease without dialysis.", "journal": "Lipids in health and disease", "date": "2020", "authors": "Santana MFM, Lira ALA, Pinto RS, Minanni CA, Silva ARM, Sawada MIBAC, Nakandakare ER, Correa-Giannella MLC, Queiroz MS, Ronsein GE, Passarelli M", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ], "reference": [ { "type": "PubMed", "id": "32921312", "url": "https://glygen.org/publication/PubMed/32921312" } ] }, { "title": "Neuroprotective Effect of Apolipoprotein D in Cuprizone-Induced Cell Line Models: A Potential Therapeutic Approach for Multiple Sclerosis and Demyelinating Diseases.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Martinez-Pinilla E, Rubio-Sardon N, Pelaez R, Garcia-Alvarez E, Del Valle E, Tolivia J, Larrayoz IM, Navarro A", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ], "reference": [ { "type": "PubMed", "id": "33514021", "url": "https://glygen.org/publication/PubMed/33514021" } ] }, { "title": "Cloning and expression of human apolipoprotein D cDNA.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Drayna D, Fielding C, McLean J, Baer B, Castro G, Chen E, Comstock L, Henzel W, Kohr W, Rhee L, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" }, { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "3453108", "url": "https://glygen.org/publication/PubMed/3453108" } ] }, { "title": "Identification of Apolipoprotein D as a dermal fibroblast marker of human aging for development of skin rejuvenation therapy.", "journal": "Rejuvenation research", "date": "2022-12-26", "authors": "Takaya Kento, Asou Toru, Kishi Kazuo", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ], "reference": [ { "type": "PubMed", "id": "36571249", "url": "https://glygen.org/publication/PubMed/36571249" } ] }, { "title": "APOD acts on fibroblast-like synoviocyte and chondrocyte to alleviate the process of osteoarthritis in vitro.", "journal": "Journal of orthopaedic research : official publication of the Orthopaedic Research Society", "date": "2024-02", "authors": "Xu Wenbo, Gu Shoubin, Zhang Gang, Wang Ren, Lv Songcen, Yan Jinglong, Qin Yong", "evidence": [ { "database": "RefSeq", "id": "NP_001638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001638" } ], "reference": [ { "type": "PubMed", "id": "37728985", "url": "https://glygen.org/publication/PubMed/37728985" } ] }, { "title": "Site-specific detection and structural characterization of the glycosylation of human plasma proteins lecithin:cholesterol acyltransferase and apolipoprotein D using HPLC/electrospray mass spectrometry and sequential glycosidase digestion.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Schindler PA, Settineri CA, Collet X, Fielding CJ, Burlingame AL", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "7613477", "url": "https://glygen.org/publication/PubMed/7613477" } ] }, { "title": "Structure and sequence relationships in the lipocalins and related proteins.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Flower DR, North AC, Attwood TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "7684291", "url": "https://glygen.org/publication/PubMed/7684291" } ] }, { "title": "Structure of human apolipoprotein D: locations of the intermolecular and intramolecular disulfide links.", "journal": "Biochemistry", "date": "1994", "authors": "Yang CY, Gu ZW, Blanco-Vaca F, Gaskell SJ, Yang M, Massey JB, Gotto AM Jr, Pownall HJ", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090#ptm_processing" }, { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" }, { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "7918467", "url": "https://glygen.org/publication/PubMed/7918467" } ] }, { "title": "The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA, both species encoding members of the lipocalin superfamily.", "journal": "Exp. Eye Res.", "date": "1995", "authors": "Holzfeind P, Merschak P, Dieplinger H, Redl B", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "reference": [ { "type": "PubMed", "id": "8549691", "url": "https://glygen.org/publication/PubMed/8549691" } ] }, { "title": "Tissue distribution and cDNA cloning of a human fatty acid transport protein (hsFATP4).", "journal": "Biochimica et biophysica acta", "date": "1998", "authors": "Fitscher BA, Riedel HD, Young KC, Stremmel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-804914", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914" } ], "reference": [ { "type": "PubMed", "id": "9878842", "url": "https://glygen.org/publication/PubMed/9878842" } ] } ], "pathway": [ { "id": "hsa:347", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:347", "resource": "KEGG Pathway" }, { "id": "R-HSA-804914", "name": "Transport of fatty acids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-804914", "resource": "Reactome", "description": "Transport of fatty acids" }, { "id": "R-HSA-9029569", "name": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "resource": "Reactome", "description": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux" } ], "orthologs": [ { "uniprot_canonical_ac": "P23593-1", "protein_name": "Apolipoprotein D", "gene_name": "Apod", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MATMLLLLATLAGLFTTTEGQSFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPVSFEKGNCIQANYSLMENGNIKVLNKELRPDGTLNQVEGEAKQSNMSEPAKLEVQFFSLMPPAPYWILATDYESYALVYSCTTFFWFFHVDYVWILGRNPYLPPETITYLKYILTSNDIDIAKITTKDQANCPDFL", "length": 189 }, "evidence": [ { "id": "45926717", "url": "http://www.informatics.jax.org/homology/45926717", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P51910-1", "protein_name": "Apolipoprotein D", "gene_name": "Apod", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL", "length": 189 }, "evidence": [ { "id": "45926717", "url": "http://www.informatics.jax.org/homology/45926717", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 18, "go_terms": [ { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "glucose metabolic process", "id": "GO:0006006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006006", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of focal adhesion assembly", "id": "GO:0051895", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051895", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "response to reactive oxygen species", "id": "GO:0000302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000302", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of platelet-derived growth factor receptor signaling pathway", "id": "GO:0010642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010642", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "peripheral nervous system axon regeneration", "id": "GO:0014012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014012", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "tissue regeneration", "id": "GO:0042246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042246", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of protein import into nucleus", "id": "GO:0042308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042308", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of smooth muscle cell proliferation", "id": "GO:0048662", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048662", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "response to axon injury", "id": "GO:0048678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048678", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of lipoprotein lipid oxidation", "id": "GO:0060588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060588", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of monocyte chemotactic protein-1 production", "id": "GO:0071638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071638", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of cytokine production involved in inflammatory response", "id": "GO:1900016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900016", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of smooth muscle cell-matrix adhesion", "id": "GO:2000098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000098", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "negative regulation of T cell migration", "id": "GO:2000405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000405", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "lipid transporter activity", "id": "GO:0005319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005319", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "cholesterol binding", "id": "GO:0015485", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015485", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" }, { "name": "cytosolic ribosome", "id": "GO:0022626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022626", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "apolipoprotein D N-glycosylated 1 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G60033FS. Example: UniProtKB:P05090-1, Asn-65, MOD:00160~GNO:G60033FS. [PRO:DNx, PMID:22171320]", "evidence": [ { "id": "PR:000053423", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053423" } ] }, { "name": "apolipoprotein D N-glycosylated 2 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053424", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053424" } ] }, { "name": "apolipoprotein D N-glycosylated 3 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G05428EU. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G05428EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053425", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053425" } ] }, { "name": "apolipoprotein D N-glycosylated 4 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053426", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053426" } ] }, { "name": "apolipoprotein D N-glycosylated 5 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G10339FR. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G10339FR. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053427", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053427" } ] }, { "name": "apolipoprotein D N-glycosylated 6 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053428", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053428" } ] }, { "name": "apolipoprotein D N-glycosylated 7 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053429", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053429" } ] }, { "name": "apolipoprotein D N-glycosylated 8 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053430", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053430" } ] }, { "name": "apolipoprotein D N-glycosylated 9 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G32926LW. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G32926LW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053431", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053431" } ] }, { "name": "apolipoprotein D N-glycosylated 10 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G39446WN. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G39446WN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053432", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053432" } ] }, { "name": "apolipoprotein D N-glycosylated 11 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053433", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053433" } ] }, { "name": "apolipoprotein D N-glycosylated 12 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G41044JW. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G41044JW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053434", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053434" } ] }, { "name": "apolipoprotein D N-glycosylated 13 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G43669FQ. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G43669FQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053435", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053435" } ] }, { "name": "apolipoprotein D N-glycosylated 14 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G44211QA. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G44211QA. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053436", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053436" } ] }, { "name": "apolipoprotein D N-glycosylated 15 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G44753VC. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G44753VC. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053437", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053437" } ] }, { "name": "apolipoprotein D N-glycosylated 16 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G49739MP. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G49739MP. [PRO:DNx, PMID:22171320, PMID:29671580]", "evidence": [ { "id": "PR:000053438", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053438" } ] }, { "name": "apolipoprotein D N-glycosylated 17 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G57776ZU. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G57776ZU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053439", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053439" } ] }, { "name": "apolipoprotein D N-glycosylated 18 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053440", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053440" } ] }, { "name": "apolipoprotein D N-glycosylated 19 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G60033FS. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G60033FS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053441", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053441" } ] }, { "name": "apolipoprotein D N-glycosylated 20 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G72791KH. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G72791KH. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053442", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053442" } ] }, { "name": "apolipoprotein D N-glycosylated 21 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G73686WG. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G73686WG. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053443", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053443" } ] }, { "name": "apolipoprotein D N-glycosylated 22 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053444", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053444" } ] }, { "name": "apolipoprotein D N-glycosylated 23 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053445", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053445" } ] }, { "name": "apolipoprotein D N-glycosylated 24 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053446", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053446" } ] }, { "name": "apolipoprotein D N-glycosylated 25 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053447", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053447" } ] }, { "name": "apolipoprotein D N-glycosylated 26 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053448", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053448" } ] }, { "name": "apolipoprotein D N-glycosylated 27 (human)", "definition": "An apolipoprotein D (human) that has been N-glycosylated at the residue equivalent to Asn-98 of the amino acid sequence represented by UniProtKB:P05090-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P05090-1, Asn-98, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053449", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053449" } ] } ], "site_annotation": [ { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylatd. N-glycan heterogeneity at Asn-65: Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); at Asn-98: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major), dHex1Hex6HexNAc5 (minor) and dHex1Hex7HexNAc6 (minor).", "evidence": [ { "database": "UniProtKB", "id": "P05090", "url": "https://www.uniprot.org/uniprot/P05090" }, { "database": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "7918467", "url": "https://glygen.org/publication/PubMed/7918467" }, { "database": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "7613477", "url": "https://glygen.org/publication/PubMed/7613477" }, { "database": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" }, { "database": "PubMed", "id": "22171320", "url": "https://glygen.org/publication/PubMed/22171320" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 65, 98 ], "o_linked_sites": [ 67 ], "snv_sites": [ 67, 98, 100, 108, 129, 156, 172 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 65, "end_pos": 67 }, { "start_pos": 98, "end_pos": 100 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 154 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 116 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 152 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 116 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }