{ "uniprot_canonical_ac": "P05067-1", "uniprot_ac": "P05067", "uniprot_id": "A4_HUMAN", "mass": { "chemical_mass": 86943.0, "monoisotopic_mass": 86943.0 }, "refseq": { "ac": "NP_000475", "name": "amyloid-beta precursor protein isoform a precursor", "summary": "This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, "gene_names": [ { "name": "APP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P05067", "id": "P05067" }, { "name": "A4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05067", "id": "P05067" }, { "name": "AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475", "id": "NP_000475" }, { "name": "AD1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P05067", "id": "P05067" }, { "name": "APP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475", "id": "NP_000475" } ], "protein_names": [ { "name": "Amyloid-beta precursor protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P05067" }, { "name": "ABPP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AICD-50", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AICD-57", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AICD-59", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AID(50)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AID(57)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "AID(59)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "APPI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "APP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Alpha-CTF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Alpha-secretase C-terminal fragment", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Alzheimer disease amyloid A4 protein homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Alzheimer disease amyloid protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid intracellular domain 50", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid intracellular domain 57", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid intracellular domain 59", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid precursor protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid-beta (A4) precursor protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Amyloid-beta A4 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Beta-APP40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Beta-APP42", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Beta-CTF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Beta-secretase C-terminal fragment", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "CVAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Cerebral vascular amyloid peptide", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Gamma-CTF(50)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Gamma-CTF(57)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Gamma-CTF(59)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "PN-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "PreA4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "Protease nexin-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P05067" }, { "name": "amyloid-beta precursor protein isoform a precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475", "id": "NP_000475" }, { "name": "peptidase nexin-II; cerebral vascular amyloid peptide; protease nexin-II; amyloid beta A4 protein; beta-amyloid peptide; alzheimer disease amyloid protein; beta-amyloid peptide(1-40); beta-amyloid peptide(1-42); amyloid precursor protein; beta-amyloid precursor protein; testicular tissue protein Li 2; amyloid beta (A4) precursor protein; alzheimer disease amyloid A4 protein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475", "id": "NP_000475" } ], "function": [ { "annotation": "Age of onset predicted by Abeta profiling in a novel PSEN1 (I180F) mutation.", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, { "database": "PubMed", "id": "38103630", "url": "https://glygen.org/publication/PubMed/38103630" } ] }, { "annotation": "Alzheimer's disease-associated amyloid beta-protein peptides display antimicrobial activity against C. albicans, E. coli, S. epidermidis, S. pneumoniae, S. aureus, L. monocytogenes, E. faecalis, and S. agalactiae. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, { "database": "PubMed", "id": "20209079", "url": "https://glygen.org/publication/PubMed/20209079" } ] }, { "annotation": "Amyloid-beta peptides are lipophilic metal chelators with metal-reducing activity. Bind transient metals such as copper, zinc and iron. In vitro, can reduce Cu(2+) and Fe(3+) to Cu(+) and Fe(2+), respectively. Amyloid-beta protein 42 is a more effective reductant than amyloid-beta protein 40. Amyloid-beta peptides bind to lipoproteins and apolipoproteins E and J in the CSF and to HDL particles in plasma, inhibiting metal-catalyzed oxidation of lipoproteins. APP42-beta may activate mononuclear phagocytes in the brain and elicit inflammatory responses. Promotes both tau aggregation and TPK II-mediated phosphorylation. Interaction with overexpressed HADH2 leads to oxidative stress and neurotoxicity. Also binds GPC1 in lipid rafts.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#function" } ] }, { "annotation": "Appicans elicit adhesion of neural cells to the extracellular matrix and may regulate neurite outgrowth in the brain.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#function" } ] }, { "annotation": "Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis.", "evidence": [ { "database": "UniProtKB", "id": "H7C0V9", "url": "https://www.uniprot.org/uniprot/H7C0V9#function" }, { "database": "UniProtKB", "id": "RU367156", "url": "https://www.uniprot.org/uniprot/RU367156#function" }, { "database": "UniProtKB", "id": "E9PG40", "url": "https://www.uniprot.org/uniprot/E9PG40#function" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#function" }, { "database": "PubMed", "id": "23011729", "url": "https://glygen.org/publication/PubMed/23011729" }, { "database": "UniProtKB", "id": "P12023", "url": "https://www.uniprot.org/uniprot/P12023#function" }, { "database": "PubMed", "id": "17062754", "url": "https://glygen.org/publication/PubMed/17062754" }, { "database": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" }, { "database": "UniProtKB", "id": "H7C2L2", "url": "https://www.uniprot.org/uniprot/H7C2L2#function" }, { "database": "UniProtKB", "id": "A0A0A0MRG2", "url": "https://www.uniprot.org/uniprot/A0A0A0MRG2#function" } ] }, { "annotation": "Interaction Between Arteriosclerosis and Amyloid-beta on Cognitive Function.", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, { "database": "PubMed", "id": "38217596", "url": "https://glygen.org/publication/PubMed/38217596" } ] }, { "annotation": "N-APP binds TNFRSF21 triggering caspase activation and degeneration of both neuronal cell bodies (via caspase-3) and axons (via caspase-6).", "evidence": [ { "database": "UniProtKB", "id": "E9PG40", "url": "https://www.uniprot.org/uniprot/E9PG40#function" }, { "database": "UniProtKB", "id": "ARBA00003551", "url": "https://www.uniprot.org/uniprot/ARBA00003551#function" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#function" } ] }, { "annotation": "Potentially Pathogenic SORL1 Mutations Observed in Autosomal-Dominant Cases of Alzheimer's Disease Do Not Modulate APP Physiopathological Processing. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, { "database": "PubMed", "id": "38132122", "url": "https://glygen.org/publication/PubMed/38132122" } ] }, { "annotation": "Proteolytic cleavage of amyloid precursor protein by ADAM10 promotes proliferation and migration via activating MAPKs pathway in tongue squamous cell carcinoma in vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" }, { "database": "PubMed", "id": "38158671", "url": "https://glygen.org/publication/PubMed/38158671" } ] }, { "annotation": "The gamma-CTF peptides as well as the caspase-cleaved peptides, including C31, are potent enhancers of neuronal apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "E9PG40", "url": "https://www.uniprot.org/uniprot/E9PG40#function" }, { "database": "UniProtKB", "id": "ARBA00002651", "url": "https://www.uniprot.org/uniprot/ARBA00002651#function" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#function" } ] }, { "annotation": "This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ] } ], "disease": [ { "disease_id": "DOID:0070028", "recommended_name": { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "APP-related cerebral amyloid angiopathy", "description": "A cerebral amyloid angiopathy that has_material_basis_in an autosomal dominant mutation of APP on chromosome 21q21.3." }, "synonyms": [ { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Cerebral Amyloid Angiopathy, App-Related, Dutch Variant", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Cerebral Amyloid Angiopathy, App-Related, Flemish Variant", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Amyloidosis, Cerebroarterial, App-Related", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "HCHWAD", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Cerebral Amyloid Angiopathy, App-Related, Arctic Variant", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Cerebral Amyloid Angiopathy, App-Related, Italian Variant", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Cerebral Amyloid Angiopathy, App-Related, Iowa Variant", "description": "" }, { "id": "DOID:0070028", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070028", "name": "Amyloidosis, Hereditary, With Cerebral Hemorrhage, Dutch Variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related", "description": "A cerebral amyloid angiopathy that has material basis in an autosomal dominant mutation of APP on chromosome 21q21.3." }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "HCHWAD", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "amyloidosis, Cerebroarterial, APP-related", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, Dutch, Italian, Iowa, Flemish, Arctic variants", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "APP-related cerebral amyloid angiopathy", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "amyloidosis, hereditary, with cerebral hemorrhage, Dutch variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related, Arctic variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related, Dutch variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related, Flemish variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related, Iowa variant", "description": "" }, { "id": "MONDO:0011583", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011583", "name": "cerebral amyloid angiopathy, APP-related, Italian variant", "description": "" }, { "id": "MIM:605714", "resource": "MIM", "url": "https://www.omim.org/entry/605714", "name": "Cerebral amyloid angiopathy, APP-related", "description": "Cerebral amyloid angiopathy, APP-related" } ], "evidence": [ { "id": "605714", "database": "MIM", "url": "https://www.omim.org/entry/605714" } ] }, { "disease_id": "DOID:0080348", "recommended_name": { "id": "DOID:0080348", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080348", "name": "Alzheimer's disease 1", "description": "An Alzheimer's disease that has_material_basis_in mutation heterozygous mutation in the APP gene, which encodes the amyloid precursor protein, on chromosome 21q21." }, "synonyms": [ { "id": "DOID:0080348", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080348", "name": "Alzheimer's disease 1, early onset", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease type 1", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "early-onset familial form of Alzheimer disease", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease 1, familial", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "AD", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "AD1", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease 1", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease, early-onset, with cerebral amyloid angiopathy", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease, familial, 1", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease, late-onset, susceptibility to", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease, protection against", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "Alzheimer disease, susceptibility to", "description": "" }, { "id": "MONDO:0007088", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007088", "name": "presenile and senile dementia", "description": "" }, { "id": "MIM:104300", "resource": "MIM", "url": "https://www.omim.org/entry/104300", "name": "Alzheimer disease 1", "description": "Alzheimer disease 1" } ], "evidence": [ { "id": "104300", "database": "MIM", "url": "https://www.omim.org/entry/104300" } ] } ], "snv": [ { "evidence": [ { "id": "rs527890624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527890624" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 280, "end_pos": 280, "sequence_org": "T", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->null).", "chr_id": "21", "chr_pos": "26021867TGG", "ref_nt": "]", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T280", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05067", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05067" } ], "glycoeffect": [], "start_pos": 556, "end_pos": 556, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "21", "chr_pos": "25954611", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "E556", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P05067", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05067" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 571, "end_pos": 571, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NYS->KYS).", "chr_id": "21", "chr_pos": "25911937", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "N571", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs200088099", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200088099" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 600, "end_pos": 600, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "21", "chr_pos": "25911851", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T600", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P05067", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05067" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 652, "end_pos": 652, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "21", "chr_pos": "25905033", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T652", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 108, "end_pos": 108, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of the copper binding site in the GFLD subdomain; when associated with A-110.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" } ] }, { "start_pos": 110, "end_pos": 110, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of the copper binding site in the GFLD subdomain; when associated with A-108.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" } ] }, { "start_pos": 137, "end_pos": 137, "sequence_org": "H", "sequence_mut": "N", "comment": "Binds copper. Forms dimer.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 141, "end_pos": 141, "sequence_org": "M", "sequence_mut": "T", "comment": "Binds copper. Forms dimer.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 144, "end_pos": 144, "sequence_org": "C", "sequence_mut": "S", "comment": "Binds copper. No dimer formation. No copper reducing activity.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10461923", "url": "https://glygen.org/publication/PubMed/10461923" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 147, "end_pos": 147, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of a copper binding site; when associated with A-151.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" } ] }, { "start_pos": 147, "end_pos": 147, "sequence_org": "H", "sequence_mut": "A", "comment": "Some decrease in copper reducing activity.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 147, "end_pos": 147, "sequence_org": "H", "sequence_mut": "N", "comment": "Binds copper. Forms dimer.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 147, "end_pos": 147, "sequence_org": "H", "sequence_mut": "Y", "comment": "Greatly reduced copper-mediated low-density lipoprotein oxidation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 147, "end_pos": 149, "sequence_org": "HLH", "sequence_mut": "ALA", "comment": "50% decrease in copper reducing activity.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10461923", "url": "https://glygen.org/publication/PubMed/10461923" } ] }, { "start_pos": 151, "end_pos": 151, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of a copper binding site; when associated with A-147.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" } ] }, { "start_pos": 151, "end_pos": 151, "sequence_org": "H", "sequence_mut": "K", "comment": "Greatly reduced copper-mediated low-density lipoprotein oxidation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 151, "end_pos": 151, "sequence_org": "H", "sequence_mut": "N", "comment": "Binds copper. Forms dimer.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" }, { "database": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "start_pos": 198, "end_pos": 198, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduced casein kinase phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" }, { "database": "PubMed", "id": "10806211", "url": "https://glygen.org/publication/PubMed/10806211" } ] }, { "start_pos": 206, "end_pos": 206, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced casein kinase phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" }, { "database": "PubMed", "id": "10806211", "url": "https://glygen.org/publication/PubMed/10806211" } ] }, { "start_pos": 499, "end_pos": 499, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduced affinity for heparin; when associated with A-503.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "15304215", "url": "https://glygen.org/publication/PubMed/15304215" } ] }, { "start_pos": 503, "end_pos": 503, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced affinity for heparin; when associated with A-499.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "15304215", "url": "https://glygen.org/publication/PubMed/15304215" } ] }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes chondroitin sulfate binding in L-APP733 isoform.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "7737970", "url": "https://glygen.org/publication/PubMed/7737970" } ] }, { "start_pos": 676, "end_pos": 676, "sequence_org": "R", "sequence_mut": "G", "comment": "60-70% zinc-induced amyloid-beta protein 28 aggregation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10413512", "url": "https://glygen.org/publication/PubMed/10413512" } ] }, { "start_pos": 681, "end_pos": 681, "sequence_org": "Y", "sequence_mut": "F", "comment": "60-70% zinc-induced amyloid-beta protein 28 aggregation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10413512", "url": "https://glygen.org/publication/PubMed/10413512" } ] }, { "start_pos": 684, "end_pos": 684, "sequence_org": "H", "sequence_mut": "R", "comment": "Only 23% zinc-induced amyloid-beta protein 28 aggregation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10413512", "url": "https://glygen.org/publication/PubMed/10413512" } ] }, { "start_pos": 695, "end_pos": 695, "sequence_org": "V", "sequence_mut": "C", "comment": "Causes formation of an artifactual disulfide bond with PSEN1.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "30630874", "url": "https://glygen.org/publication/PubMed/30630874" } ] }, { "start_pos": 704, "end_pos": 704, "sequence_org": "G", "sequence_mut": "V", "comment": "Reduced protein oxidation. No hippocampal neuron toxicity.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ] }, { "start_pos": 706, "end_pos": 706, "sequence_org": "M", "sequence_mut": "L", "comment": "Reduced lipid peroxidation inhibition.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "9168929", "url": "https://glygen.org/publication/PubMed/9168929" }, { "database": "PubMed", "id": "10535332", "url": "https://glygen.org/publication/PubMed/10535332" } ] }, { "start_pos": 706, "end_pos": 706, "sequence_org": "M", "sequence_mut": "V", "comment": "No free radical production. No hippocampal neuron toxicity.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "9168929", "url": "https://glygen.org/publication/PubMed/9168929" }, { "database": "PubMed", "id": "10535332", "url": "https://glygen.org/publication/PubMed/10535332" } ] }, { "start_pos": 717, "end_pos": 717, "sequence_org": "V", "sequence_mut": "C", "comment": "Unchanged amyloid-beta protein 42/total amyloid-beta ratio.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8886002", "url": "https://glygen.org/publication/PubMed/8886002" } ] }, { "start_pos": 717, "end_pos": 717, "sequence_org": "V", "sequence_mut": "K", "comment": "Decreased amyloid-beta protein 42/total amyloid-beta ratio.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8886002", "url": "https://glygen.org/publication/PubMed/8886002" } ] }, { "start_pos": 717, "end_pos": 717, "sequence_org": "V", "sequence_mut": "M", "comment": "Increased amyloid-beta protein 42/40 ratio. No change in apoptosis after caspase cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8886002", "url": "https://glygen.org/publication/PubMed/8886002" } ] }, { "start_pos": 717, "end_pos": 717, "sequence_org": "V", "sequence_mut": "S", "comment": "Unchanged amyloid-beta protein 42/total amyloid-beta ratio.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8886002", "url": "https://glygen.org/publication/PubMed/8886002" } ] }, { "start_pos": 728, "end_pos": 728, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on APBA1 nor APBB1 binding. Greatly reduces the binding to APPBP2. APP internalization unchanged. No change in amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "9843960", "url": "https://glygen.org/publication/PubMed/9843960" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" }, { "database": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" } ] }, { "start_pos": 739, "end_pos": 739, "sequence_org": "D", "sequence_mut": "A", "comment": "No cleavage by caspases during apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10742146", "url": "https://glygen.org/publication/PubMed/10742146" }, { "database": "PubMed", "id": "12214090", "url": "https://glygen.org/publication/PubMed/12214090" }, { "database": "PubMed", "id": "10319819", "url": "https://glygen.org/publication/PubMed/10319819" } ] }, { "start_pos": 739, "end_pos": 739, "sequence_org": "D", "sequence_mut": "N", "comment": "No effect on FADD-induced apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10742146", "url": "https://glygen.org/publication/PubMed/10742146" }, { "database": "PubMed", "id": "12214090", "url": "https://glygen.org/publication/PubMed/12214090" }, { "database": "PubMed", "id": "10319819", "url": "https://glygen.org/publication/PubMed/10319819" } ] }, { "start_pos": 743, "end_pos": 743, "sequence_org": "T", "sequence_mut": "A", "comment": "Greatly reduces the binding to SHC1 and APBB family members; no effect on NGF-stimulated neurite extension. Loss of phosphorylation by LRRK2.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11146006", "url": "https://glygen.org/publication/PubMed/11146006" }, { "database": "PubMed", "id": "10341243", "url": "https://glygen.org/publication/PubMed/10341243" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" }, { "database": "PubMed", "id": "11517218", "url": "https://glygen.org/publication/PubMed/11517218" }, { "database": "PubMed", "id": "28720718", "url": "https://glygen.org/publication/PubMed/28720718" } ] }, { "start_pos": 743, "end_pos": 743, "sequence_org": "T", "sequence_mut": "E", "comment": "Reduced NGF-stimulated neurite extension. No effect on APP maturation.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11146006", "url": "https://glygen.org/publication/PubMed/11146006" }, { "database": "PubMed", "id": "10341243", "url": "https://glygen.org/publication/PubMed/10341243" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" }, { "database": "PubMed", "id": "11517218", "url": "https://glygen.org/publication/PubMed/11517218" } ] }, { "start_pos": 756, "end_pos": 756, "sequence_org": "G", "sequence_mut": "A", "comment": "APP internalization unchanged. No change in amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" } ] }, { "start_pos": 757, "end_pos": 757, "sequence_org": "Y", "sequence_mut": "A", "comment": "Little APP internalization. Reduced amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" }, { "database": "PubMed", "id": "11724784", "url": "https://glygen.org/publication/PubMed/11724784" }, { "database": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" } ] }, { "start_pos": 757, "end_pos": 757, "sequence_org": "Y", "sequence_mut": "G", "comment": "Loss of binding to MAPK8IP1, APBA1, APBB1, APPBP2 and SHC1.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" }, { "database": "PubMed", "id": "11724784", "url": "https://glygen.org/publication/PubMed/11724784" }, { "database": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" } ] }, { "start_pos": 757, "end_pos": 762, "sequence_org": "YENPTY", "sequence_mut": "AENPTA", "comment": "No effect on C99 interaction with SORL1.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "16407538", "url": "https://glygen.org/publication/PubMed/16407538" } ] }, { "start_pos": 759, "end_pos": 759, "sequence_org": "N", "sequence_mut": "A", "comment": "No binding to APBA1, no effect on APBB1 binding. Little APP internalization. Reduced amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" }, { "database": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" } ] }, { "start_pos": 760, "end_pos": 760, "sequence_org": "P", "sequence_mut": "A", "comment": "Little APP internalization. Reduced amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" } ] }, { "start_pos": 762, "end_pos": 762, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of binding to APBA1 and APBB1. APP internalization unchanged. No change in amyloid-beta protein 42 secretion.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" }, { "database": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" } ] }, { "start_pos": 99, "end_pos": 102, "sequence_org": "KRGR", "sequence_mut": "NQGG", "comment": "Reduced heparin-binding.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8158260", "url": "https://glygen.org/publication/PubMed/8158260" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "93.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P05067" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "common_name": "Human" } ], "gene": [ { "name": "APP", "url": "https://www.uniprot.org/uniprot/P05067", "locus": { "chromosome": "21", "start_pos": 25880535, "end_pos": 26171128, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000142192", "url": "https://www.ensembl.org/id/ENSG00000142192" } ] } } ], "crossref": [ { "id": "ENSG00000142192", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000142192", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P05067", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P05067", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd22607", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22607", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2487", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2487", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "APP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "351", "url": "https://www.ncbi.nlm.nih.gov/gene/351", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "49", "url": "https://glyconnect.expasy.org/browser/proteins/49", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "620", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=620", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P05067", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05067*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002223", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002223", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013803", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013803", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019543", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019543", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019744", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019744", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019745", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019745", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020901", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020901", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024329", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024329", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036176", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036176", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036669", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036669", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036880", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036880", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:351", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:351", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "104300", "url": "http://www.omim.org/entry/104300", "database": "MIM", "categories": [ "Other" ] }, { "id": "104760", "url": "http://www.omim.org/entry/104760", "database": "MIM", "categories": [ "Other" ] }, { "id": "605714", "url": "http://www.omim.org/entry/605714", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P05067", "url": "https://www.nextprot.org/entry/NX_P05067", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "THRVQKC", "url": "https://omabrowser.org/oma/group/THRVQKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2907766at2759", "url": "http://www.orthodb.org/?query=2907766at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23103", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23103", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23103:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23103:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1AAP", "url": "https://www.rcsb.org/structure/1AAP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AMB", "url": "https://www.rcsb.org/structure/1AMB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AMC", "url": "https://www.rcsb.org/structure/1AMC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AML", "url": "https://www.rcsb.org/structure/1AML", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BA4", "url": "https://www.rcsb.org/structure/1BA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BA6", "url": "https://www.rcsb.org/structure/1BA6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BJB", "url": "https://www.rcsb.org/structure/1BJB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BJC", "url": "https://www.rcsb.org/structure/1BJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BRC", "url": "https://www.rcsb.org/structure/1BRC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CA0", "url": "https://www.rcsb.org/structure/1CA0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HZ3", "url": "https://www.rcsb.org/structure/1HZ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1IYT", "url": "https://www.rcsb.org/structure/1IYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MWP", "url": "https://www.rcsb.org/structure/1MWP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OWT", "url": "https://www.rcsb.org/structure/1OWT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QCM", "url": "https://www.rcsb.org/structure/1QCM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QWP", "url": "https://www.rcsb.org/structure/1QWP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QXC", "url": "https://www.rcsb.org/structure/1QXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1QYT", "url": "https://www.rcsb.org/structure/1QYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TAW", "url": "https://www.rcsb.org/structure/1TAW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TKN", "url": "https://www.rcsb.org/structure/1TKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1X11", "url": "https://www.rcsb.org/structure/1X11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Z0Q", "url": "https://www.rcsb.org/structure/1Z0Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZE7", "url": "https://www.rcsb.org/structure/1ZE7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZE9", "url": "https://www.rcsb.org/structure/1ZE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZJD", "url": "https://www.rcsb.org/structure/1ZJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BEG", "url": "https://www.rcsb.org/structure/2BEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BP4", "url": "https://www.rcsb.org/structure/2BP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FJZ", "url": "https://www.rcsb.org/structure/2FJZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FK1", "url": "https://www.rcsb.org/structure/2FK1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FK2", "url": "https://www.rcsb.org/structure/2FK2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FK3", "url": "https://www.rcsb.org/structure/2FK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FKL", "url": "https://www.rcsb.org/structure/2FKL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2FMA", "url": "https://www.rcsb.org/structure/2FMA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2G47", "url": "https://www.rcsb.org/structure/2G47", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2IPU", "url": "https://www.rcsb.org/structure/2IPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LFM", "url": "https://www.rcsb.org/structure/2LFM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LLM", "url": "https://www.rcsb.org/structure/2LLM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LMN", "url": "https://www.rcsb.org/structure/2LMN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LMO", "url": "https://www.rcsb.org/structure/2LMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LMP", "url": "https://www.rcsb.org/structure/2LMP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LMQ", "url": "https://www.rcsb.org/structure/2LMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LNQ", "url": "https://www.rcsb.org/structure/2LNQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LOH", "url": "https://www.rcsb.org/structure/2LOH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LP1", "url": "https://www.rcsb.org/structure/2LP1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LZ3", "url": "https://www.rcsb.org/structure/2LZ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LZ4", "url": "https://www.rcsb.org/structure/2LZ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M4J", "url": "https://www.rcsb.org/structure/2M4J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M9R", "url": "https://www.rcsb.org/structure/2M9R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M9S", "url": "https://www.rcsb.org/structure/2M9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MGT", "url": "https://www.rcsb.org/structure/2MGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MJ1", "url": "https://www.rcsb.org/structure/2MJ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MPZ", "url": "https://www.rcsb.org/structure/2MPZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MVX", "url": "https://www.rcsb.org/structure/2MVX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MXU", "url": "https://www.rcsb.org/structure/2MXU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NAO", "url": "https://www.rcsb.org/structure/2NAO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OTK", "url": "https://www.rcsb.org/structure/2OTK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2R0W", "url": "https://www.rcsb.org/structure/2R0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2WK3", "url": "https://www.rcsb.org/structure/2WK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y29", "url": "https://www.rcsb.org/structure/2Y29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y2A", "url": "https://www.rcsb.org/structure/2Y2A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y3J", "url": "https://www.rcsb.org/structure/2Y3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y3K", "url": "https://www.rcsb.org/structure/2Y3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2Y3L", "url": "https://www.rcsb.org/structure/2Y3L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3AYU", "url": "https://www.rcsb.org/structure/3AYU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BAE", "url": "https://www.rcsb.org/structure/3BAE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BKJ", "url": "https://www.rcsb.org/structure/3BKJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DXC", "url": "https://www.rcsb.org/structure/3DXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DXD", "url": "https://www.rcsb.org/structure/3DXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DXE", "url": "https://www.rcsb.org/structure/3DXE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GCI", "url": "https://www.rcsb.org/structure/3GCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IFL", "url": "https://www.rcsb.org/structure/3IFL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IFN", "url": "https://www.rcsb.org/structure/3IFN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IFO", "url": "https://www.rcsb.org/structure/3IFO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IFP", "url": "https://www.rcsb.org/structure/3IFP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JQ5", "url": "https://www.rcsb.org/structure/3JQ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JQL", "url": "https://www.rcsb.org/structure/3JQL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JTI", "url": "https://www.rcsb.org/structure/3JTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KTM", "url": "https://www.rcsb.org/structure/3KTM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L33", "url": "https://www.rcsb.org/structure/3L33", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L81", "url": "https://www.rcsb.org/structure/3L81", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MOQ", "url": "https://www.rcsb.org/structure/3MOQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MXC", "url": "https://www.rcsb.org/structure/3MXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MXY", "url": "https://www.rcsb.org/structure/3MXY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NYJ", "url": "https://www.rcsb.org/structure/3NYJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NYL", "url": "https://www.rcsb.org/structure/3NYL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OVJ", "url": "https://www.rcsb.org/structure/3OVJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OW9", "url": "https://www.rcsb.org/structure/3OW9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3PZZ", "url": "https://www.rcsb.org/structure/3PZZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3Q2X", "url": "https://www.rcsb.org/structure/3Q2X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SV1", "url": "https://www.rcsb.org/structure/3SV1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U0T", "url": "https://www.rcsb.org/structure/3U0T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UMH", "url": "https://www.rcsb.org/structure/3UMH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UMI", "url": "https://www.rcsb.org/structure/3UMI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UMK", "url": "https://www.rcsb.org/structure/3UMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HIX", "url": "https://www.rcsb.org/structure/4HIX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JFN", "url": "https://www.rcsb.org/structure/4JFN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4M1C", "url": "https://www.rcsb.org/structure/4M1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MDR", "url": "https://www.rcsb.org/structure/4MDR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MVI", "url": "https://www.rcsb.org/structure/4MVI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MVK", "url": "https://www.rcsb.org/structure/4MVK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MVL", "url": "https://www.rcsb.org/structure/4MVL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4NGE", "url": "https://www.rcsb.org/structure/4NGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OJF", "url": "https://www.rcsb.org/structure/4OJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ONF", "url": "https://www.rcsb.org/structure/4ONF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ONG", "url": "https://www.rcsb.org/structure/4ONG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PQD", "url": "https://www.rcsb.org/structure/4PQD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PWQ", "url": "https://www.rcsb.org/structure/4PWQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XXD", "url": "https://www.rcsb.org/structure/4XXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AEF", "url": "https://www.rcsb.org/structure/5AEF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AM8", "url": "https://www.rcsb.org/structure/5AM8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AMB", "url": "https://www.rcsb.org/structure/5AMB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BUO", "url": "https://www.rcsb.org/structure/5BUO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C67", "url": "https://www.rcsb.org/structure/5C67", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CSZ", "url": "https://www.rcsb.org/structure/5CSZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HOW", "url": "https://www.rcsb.org/structure/5HOW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HOX", "url": "https://www.rcsb.org/structure/5HOX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HOY", "url": "https://www.rcsb.org/structure/5HOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KK3", "url": "https://www.rcsb.org/structure/5KK3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LFY", "url": "https://www.rcsb.org/structure/5LFY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LV0", "url": "https://www.rcsb.org/structure/5LV0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MY4", "url": "https://www.rcsb.org/structure/5MY4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MYO", "url": "https://www.rcsb.org/structure/5MYO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5MYX", "url": "https://www.rcsb.org/structure/5MYX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ONP", "url": "https://www.rcsb.org/structure/5ONP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ONQ", "url": "https://www.rcsb.org/structure/5ONQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OQV", "url": "https://www.rcsb.org/structure/5OQV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TXD", "url": "https://www.rcsb.org/structure/5TXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VOS", "url": "https://www.rcsb.org/structure/5VOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VZY", "url": "https://www.rcsb.org/structure/5VZY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W3P", "url": "https://www.rcsb.org/structure/5W3P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CO3", "url": "https://www.rcsb.org/structure/6CO3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GFI", "url": "https://www.rcsb.org/structure/6GFI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HAR", "url": "https://www.rcsb.org/structure/6HAR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ITU", "url": "https://www.rcsb.org/structure/6ITU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6IYC", "url": "https://www.rcsb.org/structure/6IYC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NB9", "url": "https://www.rcsb.org/structure/6NB9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O4J", "url": "https://www.rcsb.org/structure/6O4J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OC9", "url": "https://www.rcsb.org/structure/6OC9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OIZ", "url": "https://www.rcsb.org/structure/6OIZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6RHY", "url": "https://www.rcsb.org/structure/6RHY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SHS", "url": "https://www.rcsb.org/structure/6SHS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SZF", "url": "https://www.rcsb.org/structure/6SZF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TI5", "url": "https://www.rcsb.org/structure/6TI5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TI6", "url": "https://www.rcsb.org/structure/6TI6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TI7", "url": "https://www.rcsb.org/structure/6TI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WXM", "url": "https://www.rcsb.org/structure/6WXM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XOV", "url": "https://www.rcsb.org/structure/6XOV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YHF", "url": "https://www.rcsb.org/structure/6YHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YHI", "url": "https://www.rcsb.org/structure/6YHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YHO", "url": "https://www.rcsb.org/structure/6YHO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YHP", "url": "https://www.rcsb.org/structure/6YHP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YHX", "url": "https://www.rcsb.org/structure/6YHX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7B3J", "url": "https://www.rcsb.org/structure/7B3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7B3K", "url": "https://www.rcsb.org/structure/7B3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E6P", "url": "https://www.rcsb.org/structure/7E6P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F29", "url": "https://www.rcsb.org/structure/7F29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JXN", "url": "https://www.rcsb.org/structure/7JXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JXO", "url": "https://www.rcsb.org/structure/7JXO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O1Q", "url": "https://www.rcsb.org/structure/7O1Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OW1", "url": "https://www.rcsb.org/structure/7OW1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OXN", "url": "https://www.rcsb.org/structure/7OXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q4B", "url": "https://www.rcsb.org/structure/7Q4B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q4M", "url": "https://www.rcsb.org/structure/7Q4M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RTZ", "url": "https://www.rcsb.org/structure/7RTZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7U4P", "url": "https://www.rcsb.org/structure/7U4P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WFY", "url": "https://www.rcsb.org/structure/7WFY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WVY", "url": "https://www.rcsb.org/structure/7WVY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y3J", "url": "https://www.rcsb.org/structure/7Y3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Y8Q", "url": "https://www.rcsb.org/structure/7Y8Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AZS", "url": "https://www.rcsb.org/structure/8AZS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AZT", "url": "https://www.rcsb.org/structure/8AZT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BFA", "url": "https://www.rcsb.org/structure/8BFA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BFB", "url": "https://www.rcsb.org/structure/8BFB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BFZ", "url": "https://www.rcsb.org/structure/8BFZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BG0", "url": "https://www.rcsb.org/structure/8BG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8C3H", "url": "https://www.rcsb.org/structure/8C3H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EZD", "url": "https://www.rcsb.org/structure/8EZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EZE", "url": "https://www.rcsb.org/structure/8EZE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00014", "url": "http://pfam.xfam.org/family/PF00014", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02177", "url": "http://pfam.xfam.org/family/PF02177", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03494", "url": "http://pfam.xfam.org/family/PF03494", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10515", "url": "http://pfam.xfam.org/family/PF10515", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12924", "url": "http://pfam.xfam.org/family/PF12924", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12925", "url": "http://pfam.xfam.org/family/PF12925", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P05067", "url": "https://pharos.nih.gov/targets/P05067", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053414", "url": "https://proconsortium.org/app/entry/PR:000053414", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053415", "url": "https://proconsortium.org/app/entry/PR:000053415", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053416", "url": "https://proconsortium.org/app/entry/PR:000053416", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053417", "url": "https://proconsortium.org/app/entry/PR:000053417", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053418", "url": "https://proconsortium.org/app/entry/PR:000053418", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053419", "url": "https://proconsortium.org/app/entry/PR:000053419", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053420", "url": "https://proconsortium.org/app/entry/PR:000053420", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053421", "url": "https://proconsortium.org/app/entry/PR:000053421", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053422", "url": "https://proconsortium.org/app/entry/PR:000053422", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P05067", "url": "http://purl.obolibrary.org/obo/PR_P05067", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-444473", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-444473", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P05067", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0A0MRG2", "url": "https://www.uniprot.org/uniprot/A0A0A0MRG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MRG2-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MRG2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PG40", "url": "https://www.uniprot.org/uniprot/E9PG40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PG40-1", "url": "https://www.uniprot.org/uniprot/E9PG40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C0V9", "url": "https://www.uniprot.org/uniprot/H7C0V9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C0V9-1", "url": "https://www.uniprot.org/uniprot/H7C0V9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C2L2", "url": "https://www.uniprot.org/uniprot/H7C2L2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C2L2-1", "url": "https://www.uniprot.org/uniprot/H7C2L2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-1", "url": "https://www.uniprot.org/uniprot/P05067-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-10", "url": "https://www.uniprot.org/uniprot/P05067-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-11", "url": "https://www.uniprot.org/uniprot/P05067-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-2", "url": "https://www.uniprot.org/uniprot/P05067-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-3", "url": "https://www.uniprot.org/uniprot/P05067-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-4", "url": "https://www.uniprot.org/uniprot/P05067-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-5", "url": "https://www.uniprot.org/uniprot/P05067-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-6", "url": "https://www.uniprot.org/uniprot/P05067-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-7", "url": "https://www.uniprot.org/uniprot/P05067-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-8", "url": "https://www.uniprot.org/uniprot/P05067-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P05067-9", "url": "https://www.uniprot.org/uniprot/P05067-9", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 770, "header": "sp|P05067-1|A4_HUMAN Isoform 1 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MRG2-1", "url": "", "sequence": { "sequence": "MFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 660, "header": "tr|A0A0A0MRG2-1|A4_HUMAN Computationally mapped isoform of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=1 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26112098, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359726.7", "url": "https://www.ensembl.org/id/ENST00000359726.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000352760.4", "url": "https://www.ensembl.org/id/ENSP00000352760.4" } ] } }, { "isoform_ac": "E9PG40-1", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 714, "header": "tr|E9PG40-1|E9PG40_HUMAN Computationally mapped isoform of Amyloid-beta A4 protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=1 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000439274.6", "url": "https://www.ensembl.org/id/ENST00000439274.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000398879.2", "url": "https://www.ensembl.org/id/ENSP00000398879.2" } ] } }, { "isoform_ac": "H7C0V9-1", "url": "", "sequence": { "sequence": "XLQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVGAVAHACNSSILGGQGGQMT", "length": 485, "header": "tr|H7C0V9-1|A4_HUMAN Computationally mapped isoform of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=1 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26090061, "end_pos": 25945915, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448850.5", "url": "https://www.ensembl.org/id/ENST00000448850.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000396923.1", "url": "https://www.ensembl.org/id/ENSP00000396923.1" } ] } }, { "isoform_ac": "H7C2L2-1", "url": "", "sequence": { "sequence": "XGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEA", "length": 181, "header": "tr|H7C2L2-1|H7C2L2_HUMAN Computationally mapped isoform of Amyloid-beta A4 protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=1 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26051032, "end_pos": 25975190, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000415997.1", "url": "https://www.ensembl.org/id/ENST00000415997.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000406539.1", "url": "https://www.ensembl.org/id/ENSP00000406539.1" } ] } }, { "isoform_ac": "P05067-1", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 770, "header": "sp|P05067-1|A4_HUMAN Isoform 1 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000346798.8", "url": "https://www.ensembl.org/id/ENST00000346798.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000284981.4", "url": "https://www.ensembl.org/id/ENSP00000284981.4" } ] } }, { "isoform_ac": "P05067-10", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 639, "header": "sp|P05067-10|A4_HUMAN Isoform 10 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000354192.7", "url": "https://www.ensembl.org/id/ENST00000354192.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000346129.3", "url": "https://www.ensembl.org/id/ENSP00000346129.3" } ] } }, { "isoform_ac": "P05067-11", "url": "", "sequence": { "sequence": "MDQLEDLLVLFINYVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 746, "header": "sp|P05067-11|A4_HUMAN Isoform 11 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26140194, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000440126.7", "url": "https://www.ensembl.org/id/ENST00000440126.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000387483.2", "url": "https://www.ensembl.org/id/ENSP00000387483.2" } ] } }, { "isoform_ac": "P05067-2", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREKWYKEVHSGQARWLML", "length": 305, "header": "sp|P05067-2|A4_HUMAN Isoform 2 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": {} }, { "isoform_ac": "P05067-3", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 677, "header": "sp|P05067-3|A4_HUMAN Isoform 3 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": {} }, { "isoform_ac": "P05067-4", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 695, "header": "sp|P05067-4|A4_HUMAN Isoform 4 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000348990.9", "url": "https://www.ensembl.org/id/ENST00000348990.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000345463.5", "url": "https://www.ensembl.org/id/ENSP00000345463.5" } ] } }, { "isoform_ac": "P05067-5", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 696, "header": "sp|P05067-5|A4_HUMAN Isoform 5 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": {} }, { "isoform_ac": "P05067-6", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 714, "header": "sp|P05067-6|A4_HUMAN Isoform 6 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": {} }, { "isoform_ac": "P05067-7", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 733, "header": "sp|P05067-7|A4_HUMAN Isoform 7 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": {} }, { "isoform_ac": "P05067-8", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 751, "header": "sp|P05067-8|A4_HUMAN Isoform 8 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000357903.7", "url": "https://www.ensembl.org/id/ENST00000357903.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000350578.3", "url": "https://www.ensembl.org/id/ENSP00000350578.3" } ] } }, { "isoform_ac": "P05067-9", "url": "", "sequence": { "sequence": "MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 752, "header": "sp|P05067-9|A4_HUMAN Isoform 9 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3 CANONICAL=P05067-1" }, "locus": { "chromosome": "21", "start_pos": 26170620, "end_pos": 25881673, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000358918.7", "url": "https://www.ensembl.org/id/ENST00000358918.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000351796.3", "url": "https://www.ensembl.org/id/ENSP00000351796.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 107, "start_aa": "Thr", "end_pos": 107, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr107", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "THPHFVIPYR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 107, "start_aa": "Thr", "end_pos": 116, "end_aa": "Arg", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 22, "start_aa": "Thr", "end_pos": 22, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr22", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 276, "start_aa": "Thr", "end_pos": 276, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr276", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 279, "start_aa": "Thr", "end_pos": 279, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr279", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 280, "start_aa": "Thr", "end_pos": 280, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr280", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 352, "start_aa": "Thr", "end_pos": 352, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr352", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TTQEPLAR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 352, "start_aa": "Thr", "end_pos": 359, "end_aa": "Arg", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TTQEPLARDPVK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 352, "start_aa": "Thr", "end_pos": 363, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 353, "start_aa": "Thr", "end_pos": 353, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr353", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "DPVKLPTTAASTPDAVDK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 360, "start_aa": "Asp", "end_pos": 377, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 360, "start_aa": "Asp", "end_pos": 393, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LPTTAASTPDAVDK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 364, "start_aa": "Leu", "end_pos": 377, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "LPTTAASTPDAVDKYLETPGDENEHAHFQK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 364, "start_aa": "Leu", "end_pos": 393, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 366, "start_aa": "Thr", "end_pos": 366, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr366", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 366, "start_aa": "Thr", "end_pos": 366, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr366", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 366, "start_aa": "Thr", "end_pos": 366, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr366", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 366, "start_aa": "Thr", "end_pos": 366, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr366", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 367, "start_aa": "Thr", "end_pos": 367, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr367", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 367, "start_aa": "Thr", "end_pos": 367, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr367", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 370, "start_aa": "Ser", "end_pos": 370, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser370", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 370, "start_aa": "Ser", "end_pos": 370, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser370", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 371, "start_aa": "Thr", "end_pos": 371, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr371", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 371, "start_aa": "Thr", "end_pos": 371, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr371", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "Y", "relation": "attached", "comment": "", "start_pos": 378, "start_aa": "Tyr", "end_pos": 378, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr378", "evidence": [ { "id": "GLY_000268", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000268" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "YLETPGDENEHAHFQK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 378, "start_aa": "Tyr", "end_pos": 393, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 381, "start_aa": "Thr", "end_pos": 381, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr381", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 571, "start_aa": "Asn", "end_pos": 571, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn571", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ISYGNDALMPSLTETK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 586, "start_aa": "Ile", "end_pos": 601, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 600, "start_aa": "Thr", "end_pos": 600, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr600", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 633, "start_aa": "Thr", "end_pos": 633, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr633", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 633, "start_aa": "Thr", "end_pos": 633, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr633", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "GLTTRPGSGLTNIK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 649, "start_aa": "Gly", "end_pos": 662, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "GLTTRPGSGLTNIKTEEISEVK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 649, "start_aa": "Gly", "end_pos": 670, "end_aa": "Lys", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 651, "start_aa": "Thr", "end_pos": 651, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr651", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 651, "start_aa": "Thr", "end_pos": 651, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr651", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 651, "start_aa": "Thr", "end_pos": 652, "end_aa": "Thr", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 652, "start_aa": "Thr", "end_pos": 652, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr652", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 652, "start_aa": "Thr", "end_pos": 652, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr652", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 652, "start_aa": "Thr", "end_pos": 652, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr652", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 656, "start_aa": "Ser", "end_pos": 656, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser656", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine; in L-APP isoforms", "start_pos": 656, "start_aa": "Ser", "end_pos": 656, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser656", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 659, "start_aa": "Thr", "end_pos": 659, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr659", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 659, "start_aa": "Thr", "end_pos": 659, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr659", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "Other", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (HexNAc...) threonine; partial Other", "start_pos": 659, "start_aa": "Thr", "end_pos": 659, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr659", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 663, "start_aa": "Thr", "end_pos": 663, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr663", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 663, "start_aa": "Thr", "end_pos": 663, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr663", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 667, "start_aa": "Ser", "end_pos": 667, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser667", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine; partial O-GalNAcylation", "start_pos": 667, "start_aa": "Ser", "end_pos": 667, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser667", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "21712440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21712440" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 679, "start_aa": "Ser", "end_pos": 679, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser679", "evidence": [ { "id": "P05067", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "Other", "site_category": "reported", "site_seq": "Y", "relation": "attached", "comment": "O-linked (HexNAc...) tyrosine; partial Other", "start_pos": 681, "start_aa": "Tyr", "end_pos": 681, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr681", "evidence": [ { "id": "P05067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "id": "22576872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22576872" } ] }, { "glytoucan_ac": "G00666EC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "49", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/49" }, { "id": "7763244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7763244" } ] }, { "glytoucan_ac": "G35107SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "49", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/49" }, { "id": "7763244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7763244" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "49", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/49" }, { "id": "7763244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7763244" } ] }, { "glytoucan_ac": "G59277TZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "49", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/49" }, { "id": "7763244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7763244" } ] } ], "phosphorylation": [ { "start_pos": 198, "end_pos": 198, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" } ], "site_lbl": "Ser198" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK1", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" } ], "site_lbl": "Ser206" }, { "start_pos": 441, "end_pos": 441, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "18702456", "url": "https://glygen.org/publication/PubMed/18702456" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser441" }, { "start_pos": 497, "end_pos": 497, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "site_lbl": "Tyr497" }, { "start_pos": 729, "end_pos": 729, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "site_lbl": "Thr729" }, { "start_pos": 730, "end_pos": 730, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by APP-kinase I", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "site_lbl": "Ser730" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "14970211", "url": "https://glygen.org/publication/PubMed/14970211" }, { "database": "PubMed", "id": "12917434", "url": "https://glygen.org/publication/PubMed/12917434" }, { "database": "PubMed", "id": "24610780", "url": "https://glygen.org/publication/PubMed/24610780" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "14970211", "url": "https://glygen.org/publication/PubMed/14970211" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "10936190", "url": "https://glygen.org/publication/PubMed/10936190" }, { "database": "PubMed", "id": "15178331", "url": "https://glygen.org/publication/PubMed/15178331" }, { "database": "PubMed", "id": "8764598", "url": "https://glygen.org/publication/PubMed/8764598" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "14970211", "url": "https://glygen.org/publication/PubMed/14970211" }, { "database": "PubMed", "id": "24610780", "url": "https://glygen.org/publication/PubMed/24610780" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "Q00535-1", "kinase_gene_name": "CDK5", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "10936190", "url": "https://glygen.org/publication/PubMed/10936190" }, { "database": "PubMed", "id": "15178331", "url": "https://glygen.org/publication/PubMed/15178331" }, { "database": "PubMed", "id": "8764598", "url": "https://glygen.org/publication/PubMed/8764598" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "Q96SN8-1", "kinase_gene_name": "CDK5RAP2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "15178331", "url": "https://glygen.org/publication/PubMed/15178331" } ], "site_lbl": "Thr743" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK5 and MAPK10", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "9109675", "url": "https://glygen.org/publication/PubMed/9109675" }, { "database": "phospho.ELM", "id": "P05067", "url": "http://phospho.elm.eu.org/byAccession/P05067.html" }, { "database": "PubMed", "id": "8764598", "url": "https://glygen.org/publication/PubMed/8764598" }, { "database": "PubMed", "id": "28720718", "url": "https://glygen.org/publication/PubMed/28720718" }, { "database": "PubMed", "id": "8131745", "url": "https://glygen.org/publication/PubMed/8131745" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Thr743" }, { "start_pos": 757, "end_pos": 757, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "11279131", "url": "https://glygen.org/publication/PubMed/11279131" } ], "site_lbl": "Tyr757" }, { "start_pos": 757, "end_pos": 757, "kinase_uniprot_canonical_ac": "P04629-1", "kinase_gene_name": "NTRK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "21849536", "url": "https://glygen.org/publication/PubMed/21849536" } ], "site_lbl": "Tyr757" }, { "start_pos": 757, "end_pos": 757, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "11279131", "url": "https://glygen.org/publication/PubMed/11279131" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "IntAct", "id": "P05067", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05067*" }, { "database": "phospho.ELM", "id": "P05067", "url": "http://phospho.elm.eu.org/byAccession/P05067.html" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr757" }, { "start_pos": 762, "end_pos": 762, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P05067", "url": "http://phospho.elm.eu.org/byAccession/P05067.html" } ], "site_lbl": "Tyr762" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P05067", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P05067", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "Molecular cloning of human Fe65L2 and its interaction with the Alzheimer's beta-amyloid precursor protein.", "journal": "Neurosci. Lett.", "date": "1999", "authors": "Tanahashi H, Tabira T", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10081969", "url": "https://glygen.org/publication/PubMed/10081969" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "Unusual phenotypic alteration of beta amyloid precursor protein (betaAPP) maturation by a new Val-715 --> Met betaAPP-770 mutation responsible for probable early-onset Alzheimer's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Ancolio K, Dumanchin C, Barelli H, Warter JM, Brice A, Campion D, Frebourg T, Checler F", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10097173", "url": "https://glygen.org/publication/PubMed/10097173" } ] }, { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "Crystal structure of the N-terminal, growth factor-like domain of Alzheimer amyloid precursor protein.", "journal": "Nat. Struct. Biol.", "date": "1999", "authors": "Rossjohn J, Cappai R, Feil S C, Henry A, McKinstry W J, Galatis D, Hesse L, Multhaup G, Beyreuther K, Masters C L, Parker M W", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10201399", "url": "https://glygen.org/publication/PubMed/10201399" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Involvement of caspases in proteolytic cleavage of Alzheimer's amyloid-beta precursor protein and amyloidogenic A beta peptide formation.", "journal": "Cell", "date": "1999", "authors": "Gervais FG, Xu D, Robertson GS, Vaillancourt JP, Zhu Y, Huang J, LeBlanc A, Smith D, Rigby M, Shearman MS, Clarke EE, Zheng H, Van Der Ploeg LH, Ruffolo SC, Thornberry NA, Xanthoudakis S, Zamboni RJ, Roy S, Nicholson DW", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10319819", "url": "https://glygen.org/publication/PubMed/10319819" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Role of phosphorylation of Alzheimer's amyloid precursor protein during neuronal differentiation.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Ando K, Oishi M, Takeda S, Iijima K, Isohara T, Nairn AC, Kirino Y, Greengard P, Suzuki T", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10341243", "url": "https://glygen.org/publication/PubMed/10341243" } ] }, { "title": "Mutagenesis identifies new signals for beta-amyloid precursor protein endocytosis, turnover, and the generation of secreted fragments, including Abeta42.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Perez RG, Soriano S, Hayes JD, Ostaszewski B, Xia W, Selkoe DJ, Chen X, Stokin GB, Koo EH", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10383380", "url": "https://glygen.org/publication/PubMed/10383380" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Functional organization of clathrin in coats: combining electron cryomicroscopy and X-ray crystallography.", "journal": "Molecular cell", "date": "1999", "authors": "Musacchio A, Smith CJ, Roseman AM, Harrison SC, Kirchhausen T, Pearse BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "10394364", "url": "https://glygen.org/publication/PubMed/10394364" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "Histidine-13 is a crucial residue in the zinc ion-induced aggregation of the A beta peptide of Alzheimer's disease.", "journal": "Biochemistry", "date": "1999", "authors": "Liu ST, Howlett G, Barrow CJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10413512", "url": "https://glygen.org/publication/PubMed/10413512" } ] }, { "title": "Characterization of a fourth adaptor-related protein complex.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Hirst J, Bright NA, Rous B, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "10436028", "url": "https://glygen.org/publication/PubMed/10436028" } ] }, { "title": "Cysteine 144 is a key residue in the copper reduction by the beta-amyloid precursor protein.", "journal": "Journal of neurochemistry", "date": "1999", "authors": "Ruiz FH, Gonzalez M, Bodini M, Opazo C, Inestrosa NC", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10461923", "url": "https://glygen.org/publication/PubMed/10461923" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kislinger T, Fu C, Huber B, Qu W, Taguchi A, Du Yan S, Hofmann M, Yan SF, Pischetsrieder M, Stern D, Schmidt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "10531386", "url": "https://glygen.org/publication/PubMed/10531386" } ] }, { "title": "Methionine residue 35 is important in amyloid beta-peptide-associated free radical oxidative stress.", "journal": "Brain research bulletin", "date": "1999", "authors": "Varadarajan S, Yatin S, Kanski J, Jahanshahi F, Butterfield DA", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10535332", "url": "https://glygen.org/publication/PubMed/10535332" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration.", "journal": "Nature", "date": "1999", "authors": "Patrick GN, Zukerberg L, Nikolic M, de la Monte S, Dikkes P, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10604467", "url": "https://glygen.org/publication/PubMed/10604467" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "High prevalence of pathogenic mutations in patients with early-onset dementia detected by sequence analyses of four different genes.", "journal": "American journal of human genetics", "date": "2000", "authors": "Finckh U, Muller-Thomsen T, Mann U, Eggers C, Marksteiner J, Meins W, Binetti G, Alberici A, Hock C, Nitsch RM, Gal A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10631141", "url": "https://glygen.org/publication/PubMed/10631141" } ] }, { "title": "The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Strobl S, Fernandez-Catalan C, Braun M, Huber R, Masumoto H, Nakagawa K, Irie A, Sorimachi H, Bourenkow G, Bartunik H, Suzuki K, Bode W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10639123", "url": "https://glygen.org/publication/PubMed/10639123" } ] }, { "title": "Identification of a novel aspartic protease (Asp 2) as beta-secretase.", "journal": "Molecular and cellular neurosciences", "date": "1999", "authors": "Hussain I, Powell D, Howlett DR, Tew DG, Meek TD, Chapman C, Gloger IS, Murphy KE, Southan CD, Ryan DM, Smith TS, Simmons DL, Walsh FS, Dingwall C, Christie G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10656250", "url": "https://glygen.org/publication/PubMed/10656250" } ] }, { "title": "Novel Leu723Pro amyloid precursor protein mutation increases amyloid beta42(43) peptide levels and induces apoptosis.", "journal": "Annals of neurology", "date": "2000", "authors": "Kwok JB, Li QX, Hallupp M, Whyte S, Ames D, Beyreuther K, Masters CL, Schofield PR", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10665499", "url": "https://glygen.org/publication/PubMed/10665499" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "Human aspartic protease memapsin 2 cleaves the beta-secretase site of beta-amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Lin X, Koelsch G, Wu S, Downs D, Dashti A, Tang J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10677483", "url": "https://glygen.org/publication/PubMed/10677483" } ] }, { "title": "Beta-amyloid(1-42) binds to alpha7 nicotinic acetylcholine receptor with high affinity. Implications for Alzheimer's disease pathology.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Wang H Y, Lee D H, D'Andrea M R, Peterson P A, Shank R P, Reitz A B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10681545", "url": "https://glygen.org/publication/PubMed/10681545" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.", "journal": "Oncogene", "date": "2000", "authors": "Gil J, Alcami J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "10723127", "url": "https://glygen.org/publication/PubMed/10723127" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "A second cytotoxic proteolytic peptide derived from amyloid beta-protein precursor.", "journal": "Nature medicine", "date": "2000", "authors": "Lu DC, Rabizadeh S, Chandra S, Shayya RF, Ellerby LM, Ye X, Salvesen GS, Koo EH, Bredesen DE", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10742146", "url": "https://glygen.org/publication/PubMed/10742146" } ] }, { "title": "Phosphorylation of the beta-amyloid precursor protein at the cell surface by ectocasein kinases 1 and 2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Walter J, Schindzielorz A, Hartung B, Haass C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10806211", "url": "https://glygen.org/publication/PubMed/10806211" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Lipidation of apolipoprotein E influences its isoform-specific interaction with Alzheimer's amyloid beta peptides.", "journal": "Biochem. J.", "date": "2000", "authors": "Tokuda T, Calero M, Matsubara E, Vidal R, Kumar A, Permanne B, Zlokovic B, Smith J D, Ladu M J, Rostagno A, Frangione B, Ghiso J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10816430", "url": "https://glygen.org/publication/PubMed/10816430" } ] }, { "title": "Substitutions at codon 22 of Alzheimer's Abeta peptide induce diverse conformational changes and apoptotic effects in human cerebral endothelial cells.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Miravalle L, Tokuda T, Chiarle R, Giaccone G, Bugiani O, Tagliavini F, Frangione B, Ghiso J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10821838", "url": "https://glygen.org/publication/PubMed/10821838" } ] }, { "title": "Neurotoxicity induces cleavage of p35 to p25 by calpain.", "journal": "Nature", "date": "2000", "authors": "Lee MS, Kwon YT, Li M, Peng J, Friedlander RM, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10830966", "url": "https://glygen.org/publication/PubMed/10830966" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Early-onset Alzheimer disease caused by a new mutation (V717L) in the amyloid precursor protein gene.", "journal": "Archives of neurology", "date": "2000", "authors": "Murrell JR, Hake AM, Quaid KA, Farlow MR, Ghetti B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10867787", "url": "https://glygen.org/publication/PubMed/10867787" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "Neuron-specific phosphorylation of Alzheimer's beta-amyloid precursor protein by cyclin-dependent kinase 5.", "journal": "Journal of neurochemistry", "date": "2000", "authors": "Iijima K, Ando K, Takeda S, Satoh Y, Seki T, Itohara S, Greengard P, Kirino Y, Nairn AC, Suzuki T", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "10936190", "url": "https://glygen.org/publication/PubMed/10936190" } ] }, { "title": "The Alzheimer's peptide a beta adopts a collapsed coil structure in water.", "journal": "J. Struct. Biol.", "date": "2000", "authors": "Zhang S, Iwata K, Lachenmann M J, Peng J W, Li S, Stimson E R, Lu Y, Felix A M, Maggio J E, Lee J P", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10940221", "url": "https://glygen.org/publication/PubMed/10940221" } ] }, { "title": "Solution structures in aqueous SDS micelles of two amyloid beta peptides of Abeta(1-28) mutated at the alpha-secretase cleavage site.", "journal": "J. Struct. Biol.", "date": "2000", "authors": "Poulsen S A, Watson A A, Fairlie D P, Craik D J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "10940222", "url": "https://glygen.org/publication/PubMed/10940222" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Nonfibrillar diffuse amyloid deposition due to a gamma(42)-secretase site mutation points to an essential role for N-truncated A beta(42) in Alzheimer's disease.", "journal": "Human molecular genetics", "date": "2000", "authors": "Kumar-Singh S, De Jonghe C, Cruts M, Kleinert R, Wang R, Mercken M, De Strooper B, Vanderstichele H, Lofgren A, Vanderhoeven I, Backhovens H, Vanmechelen E, Kroisel PM, Van Broeckhoven C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11063718", "url": "https://glygen.org/publication/PubMed/11063718" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Signal-binding specificity of the mu4 subunit of the adaptor protein complex AP-4.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Aguilar RC, Boehm M, Gorshkova I, Crouch RJ, Tomita K, Saito T, Ohno H, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11139587", "url": "https://glygen.org/publication/PubMed/11139587" } ] }, { "title": "Phosphorylation of thr(668) in the cytoplasmic domain of the Alzheimer's disease amyloid precursor protein by stress-activated protein kinase 1b (Jun N-terminal kinase-3).", "journal": "Journal of neurochemistry", "date": "2001", "authors": "Standen CL, Brownlees J, Grierson AJ, Kesavapany S, Lau KF, McLoughlin DM, Miller CC", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11146006", "url": "https://glygen.org/publication/PubMed/11146006" } ] }, { "title": "Nucleotide receptors: an emerging family of regulatory molecules in blood cells.", "journal": "Blood", "date": "2001", "authors": "Di Virgilio F, Chiozzi P, Ferrari D, Falzoni S, Sanz JM, Morelli A, Torboli M, Bolognesi G, Baricordi OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "11157473", "url": "https://glygen.org/publication/PubMed/11157473" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Fibulin-1 binds the amino-terminal head of beta-amyloid precursor protein and modulates its physiological function.", "journal": "J. Neurochem.", "date": "2001", "authors": "Ohsawa I, Takamura C, Kohsaka S", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11238726", "url": "https://glygen.org/publication/PubMed/11238726" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Alzheimer's disease amyloid-beta binds copper and zinc to generate an allosterically ordered structure containing superoxide dismutase-like subunits.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Curtain CC, Ali F, Volitakis I, Cherny RA, Norton RS, Beyreuther K, Barrow CJ, Masters CL, Bush AI, Barnham KJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11274207", "url": "https://glygen.org/publication/PubMed/11274207" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "Beta-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Kajkowski EM, Lo CF, Ning X, Walker S, Sofia HJ, Wang W, Edris W, Chanda P, Wagner E, Vile S, Ryan K, McHendry-Rinde B, Smith SC, Wood A, Rhodes KJ, Kennedy JD, Bard J, Jacobsen JS, Ozenberger BA", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11278849", "url": "https://glygen.org/publication/PubMed/11278849" } ] }, { "title": "The beta-amyloid precursor protein APP is tyrosine-phosphorylated in cells expressing a constitutively active form of the Abl protoncogene.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zambrano N, Bruni P, Minopoli G, Mosca R, Molino D, Russo C, Schettini G, Sudol M, Russo T", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "11279131", "url": "https://glygen.org/publication/PubMed/11279131" } ] }, { "title": "In vitro studies of amyloid beta-protein fibril assembly and toxicity provide clues to the aetiology of Flemish variant (Ala692-->Gly) Alzheimer's disease.", "journal": "The Biochemical journal", "date": "2001", "authors": "Walsh DM, Hartley DM, Condron MM, Selkoe DJ, Teplow DB", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11311152", "url": "https://glygen.org/publication/PubMed/11311152" } ] }, { "title": "Differential assembly of rat purinergic P2X7 receptor in immune cells of the brain and periphery.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kim M, Spelta V, Sim J, North RA, Surprenant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "11313357", "url": "https://glygen.org/publication/PubMed/11313357" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Hepatitis B virus large envelope protein interacts with gamma2-adaptin, a clathrin adaptor-related protein.", "journal": "Journal of virology", "date": "2001", "authors": "Hartmann-Stuhler C, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11333915", "url": "https://glygen.org/publication/PubMed/11333915" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Novel amyloid precursor protein mutation in an Iowa family with dementia and severe cerebral amyloid angiopathy.", "journal": "Annals of neurology", "date": "2001", "authors": "Grabowski TJ, Cho HS, Vonsattel JP, Rebeck GW, Greenberg SM", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11409420", "url": "https://glygen.org/publication/PubMed/11409420" } ] }, { "title": "Homodimerization of amyloid precursor protein and its implication in the amyloidogenic pathway of Alzheimer's disease.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Scheuermann S, Hambsch B, Hesse L, Stumm J, Schmidt C, Beher D, Bayer T A, Beyreuther K, Multhaup G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11438549", "url": "https://glygen.org/publication/PubMed/11438549" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "Interaction between pyrin and the apoptotic speck protein (ASC) modulates ASC-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Richards N, Schaner P, Diaz A, Stuckey J, Shelden E, Wadhwa A, Gumucio DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "11498534", "url": "https://glygen.org/publication/PubMed/11498534" } ] }, { "title": "Phosphorylation-dependent regulation of the interaction of amyloid precursor protein with Fe65 affects the production of beta-amyloid.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ando K, Iijima KI, Elliott JI, Kirino Y, Suzuki T", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11517218", "url": "https://glygen.org/publication/PubMed/11517218" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "The 'Arctic' APP mutation (E693G) causes Alzheimer's disease by enhanced Abeta protofibril formation.", "journal": "Nature neuroscience", "date": "2001", "authors": "Nilsberth C, Westlind-Danielsson A, Eckman CB, Condron MM, Axelman K, Forsell C, Stenh C, Luthman J, Teplow DB, Younkin SG, Naslund J, Lannfelt L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11528419", "url": "https://glygen.org/publication/PubMed/11528419" } ] }, { "title": "The intracellular domain of the beta-amyloid precursor protein is stabilized by Fe65 and translocates to the nucleus in a notch-like manner.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Kimberly WT, Zheng JB, Guenette SY, Selkoe DJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11544248", "url": "https://glygen.org/publication/PubMed/11544248" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Angiotensin-converting enzyme degrades Alzheimer amyloid beta-peptide (A beta ); retards A beta aggregation, deposition, fibril formation; and inhibits cytotoxicity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hu J, Igarashi A, Kamata M, Nakagawa H", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11604391", "url": "https://glygen.org/publication/PubMed/11604391" } ] }, { "title": "Generation of high curvature membranes mediated by direct endophilin bilayer interactions.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Farsad K, Ringstad N, Takei K, Floyd SR, Rose K, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11604418", "url": "https://glygen.org/publication/PubMed/11604418" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "Beta amyloid peptide (Abeta42) is internalized via the G-protein-coupled receptor FPRL1 and forms fibrillar aggregates in macrophages.", "journal": "FASEB J.", "date": "2001", "authors": "Yazawa H, Yu Z X, Takeda , Le Y, Gong W, Ferrans V J, Oppenheim J J, Li C C, Wang J M", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11689470", "url": "https://glygen.org/publication/PubMed/11689470" } ] }, { "title": "GGAs: roles of the different domains and comparison with AP-1 and clathrin.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Hirst J, Lindsay MR, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11694590", "url": "https://glygen.org/publication/PubMed/11694590" } ] }, { "title": "Jun NH2-terminal kinase (JNK) interacting protein 1 (JIP1) binds the cytoplasmic domain of the Alzheimer's beta-amyloid precursor protein (APP).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Scheinfeld MH, Roncarati R, Vito P, Lopez PA, Abdallah M, D'Adamio L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11724784", "url": "https://glygen.org/publication/PubMed/11724784" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "Alzheimer's amyloid-beta as a preventive antioxidant for brain lipoproteins.", "journal": "Cell. Mol. Neurobiol.", "date": "2001", "authors": "Kontush A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11775062", "url": "https://glygen.org/publication/PubMed/11775062" } ] }, { "title": "Contrasting, species-dependent modulation of copper-mediated neurotoxicity by the Alzheimer's disease amyloid precursor protein.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "White AR, Multhaup G, Galatis D, McKinstry WJ, Parker MW, Pipkorn R, Beyreuther K, Masters CL, Cappai R", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11784781", "url": "https://glygen.org/publication/PubMed/11784781" } ] }, { "title": "PYPAF1, a PYRIN-containing Apaf1-like protein that assembles with ASC and regulates activation of NF-kappa B.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Manji GA, Wang L, Geddes BJ, Brown M, Merriam S, Al-Garawi A, Mak S, Lora JM, Briskin M, Jurman M, Cao J, DiStefano PS, Bertin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "11786556", "url": "https://glygen.org/publication/PubMed/11786556" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "A novel epsilon-cleavage within the transmembrane domain of the Alzheimer amyloid precursor protein demonstrates homology with Notch processing.", "journal": "Biochemistry", "date": "2002", "authors": "Weidemann A, Eggert S, Reinhard FB, Vogel M, Paliga K, Baier G, Masters CL, Beyreuther K, Evin G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11851430", "url": "https://glygen.org/publication/PubMed/11851430" } ] }, { "title": "A novel human small subunit of calpains.", "journal": "The Biochemical journal", "date": "2002", "authors": "Schad E, Farkas A, Jekely G, Tompa P, Friedrich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "11853546", "url": "https://glygen.org/publication/PubMed/11853546" } ] }, { "title": "Tyrosine phosphorylation of the beta-amyloid precursor protein cytoplasmic tail promotes interaction with Shc.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Tarr PE, Roncarati R, Pelicci G, Pelicci PG, D'Adamio L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "Direct interaction of soluble human recombinant tau protein with Abeta 1-42 results in tau aggregation and hyperphosphorylation by tau protein kinase II.", "journal": "FEBS Lett.", "date": "2002", "authors": "Rank Kenneth B, Pauley Adele M, Bhattacharya Keshab, Wang Zhigang, Evans David B, Fleck Timothy J, Johnston Jennifer A, Sharma Satish K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "11943163", "url": "https://glygen.org/publication/PubMed/11943163" } ] }, { "title": "The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Srinivasula SM, Poyet JL, Razmara M, Datta P, Zhang Z, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "11967258", "url": "https://glygen.org/publication/PubMed/11967258" } ] }, { "title": "Regulated transport of the glucose transporter GLUT4.", "journal": "Nature reviews. Molecular cell biology", "date": "2002", "authors": "Bryant NJ, Govers R, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "11994746", "url": "https://glygen.org/publication/PubMed/11994746" } ] }, { "title": "The galvanization of beta-amyloid in Alzheimer's disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Bush Ashley I, Tanzi Rudolph E", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12032279", "url": "https://glygen.org/publication/PubMed/12032279" } ] }, { "title": "An Iranian family with Alzheimer's disease caused by a novel APP mutation (Thr714Ala).", "journal": "Neurology", "date": "2002", "authors": "Pasalar P, Najmabadi H, Noorian AR, Moghimi B, Jannati A, Soltanzadeh A, Krefft T, Crook R, Hardy J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12034808", "url": "https://glygen.org/publication/PubMed/12034808" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "A cell biological perspective on Alzheimer's disease.", "journal": "Annu. Rev. Cell Dev. Biol.", "date": "2002", "authors": "Annaert Wim, De Strooper Bart", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12142279", "url": "https://glygen.org/publication/PubMed/12142279" } ] }, { "title": "The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.", "journal": "Molecular cell", "date": "2002", "authors": "Martinon F, Burns K, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "12191486", "url": "https://glygen.org/publication/PubMed/12191486" } ] }, { "title": "Generation of an apoptotic intracellular peptide by gamma-secretase cleavage of Alzheimer's amyloid beta protein precursor.", "journal": "Journal of Alzheimer's disease : JAD", "date": "2000", "authors": "Passer B, Pellegrini L, Russo C, Siegel RM, Lenardo MJ, Schettini G, Bachmann M, Tabaton M, D'Adamio L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12214090", "url": "https://glygen.org/publication/PubMed/12214090" } ] }, { "title": "IKKalpha, IKKbeta, and NEMO/IKKgamma are each required for the NF-kappa B-mediated inflammatory response program.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Massa PE, Hanidu A, Peet GW, Aro P, Savitt A, Mische S, Li J, Marcu KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "12221085", "url": "https://glygen.org/publication/PubMed/12221085" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Inman KG, Yang R, Rustandi RR, Miller KE, Baldisseri DM, Weber DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12470955", "url": "https://glygen.org/publication/PubMed/12470955" } ] }, { "title": "Structure of the Alzheimer's disease amyloid precursor protein copper binding domain. A regulator of neuronal copper homeostasis.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Barnham Kevin J, McKinstry William J, Multhaup Gerd, Galatis Denise, Morton Craig J, Curtain Cyril C, Williamson Nicholas A, White Anthony R, Hinds Mark G, Norton Raymond S, Beyreuther Konrad, Masters Colin L, Parker Michael W, Cappai Roberto", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12611883", "url": "https://glygen.org/publication/PubMed/12611883" } ] }, { "title": "Regulation of cryopyrin/Pypaf1 signaling by pyrin, the familial Mediterranean fever gene product.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Dowds TA, Masumoto J, Chen FF, Ogura Y, Inohara N, Nunez G", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "12615073", "url": "https://glygen.org/publication/PubMed/12615073" } ] }, { "title": "Hemorrhagic stroke associated with the Iowa amyloid precursor protein mutation.", "journal": "Neurology", "date": "2003", "authors": "Greenberg SM, Shin Y, Grabowski TJ, Cooper GE, Rebeck GW, Iglesias S, Chapon F, Tournier-Lasserve E, Baron JC", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12654973", "url": "https://glygen.org/publication/PubMed/12654973" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "Identification of a novel alternative splicing isoform of human amyloid precursor protein gene, APP639.", "journal": "Eur. J. Neurosci.", "date": "2003", "authors": "Tang Ke, Wang Chen, Shen Chengyong, Sheng Shuli, Ravid Rivka, Jing Naihe", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "12859342", "url": "https://glygen.org/publication/PubMed/12859342" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Amyloid beta protein precursor is phosphorylated by JNK-1 independent of, yet facilitated by, JNK-interacting protein (JIP)-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Scheinfeld MH, Ghersi E, Davies P, D'Adamio L", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "12917434", "url": "https://glygen.org/publication/PubMed/12917434" } ] }, { "title": "The receptor for advanced glycation end-products (RAGE) directly binds to ERK by a D-domain-like docking site.", "journal": "FEBS letters", "date": "2003", "authors": "Ishihara K, Tsutsumi K, Kawane S, Nakajima M, Kasaoka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12935895", "url": "https://glygen.org/publication/PubMed/12935895" } ] }, { "title": "A pathogenic mutation for probable Alzheimer's disease in the APP gene at the N-terminus of beta-amyloid.", "journal": "Nature genetics", "date": "1992", "authors": "Mullan M, Crawford F, Axelman K, Houlden H, Lilius L, Winblad B, Lannfelt L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1302033", "url": "https://glygen.org/publication/PubMed/1302033" } ] }, { "title": "Presenile dementia and cerebral haemorrhage linked to a mutation at codon 692 of the beta-amyloid precursor protein gene.", "journal": "Nature genetics", "date": "1992", "authors": "Hendriks L, van Duijn CM, Cras P, Cruts M, Van Hul W, van Harskamp F, Warren A, McInnis MG, Antonarakis SE, Martin JJ, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1303239", "url": "https://glygen.org/publication/PubMed/1303239" } ] }, { "title": "More missense in amyloid gene.", "journal": "Nature genetics", "date": "1992", "authors": "Carter DA, Desmarais E, Bellis M, Campion D, Clerget-Darpoux F, Brice A, Agid Y, Jaillard-Serradt A, Mallet J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1303275", "url": "https://glygen.org/publication/PubMed/1303275" } ] }, { "title": "Mutation in codon 713 of the beta amyloid precursor protein gene presenting with schizophrenia.", "journal": "Nature genetics", "date": "1992", "authors": "Jones CT, Morris S, Yates CM, Moffoot A, Sharpe C, Brock DJ, St Clair D", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1307241", "url": "https://glygen.org/publication/PubMed/1307241" } ] }, { "title": "Framing beta-amyloid.", "journal": "Nat. Genet.", "date": "1992", "authors": "Hardy J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1363811", "url": "https://glygen.org/publication/PubMed/1363811" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Isolation of a cDNA that encodes a novel granulocyte N-formyl peptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Ye RD, Cavanagh SL, Quehenberger O, Prossnitz ER, Cochrane CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-444473", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-444473" } ], "reference": [ { "type": "PubMed", "id": "1374236", "url": "https://glygen.org/publication/PubMed/1374236" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Isolation and quantification of soluble Alzheimer's beta-peptide from biological fluids.", "journal": "Nature", "date": "1992", "authors": "Seubert P, Vigo-Pelfrey C, Esch F, Lee M, Dovey H, Davis D, Sinha S, Schlossmacher M, Whaley J, Swindlehurst C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1406936", "url": "https://glygen.org/publication/PubMed/1406936" } ] }, { "title": "Linkage and mutational analysis of familial Alzheimer disease kindreds for the APP gene region.", "journal": "American journal of human genetics", "date": "1992", "authors": "Kamino K, Orr HT, Payami H, Wijsman EM, Alonso ME, Pulst SM, Anderson L, O'dahl S, Nemens E, White JA, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1415269", "url": "https://glygen.org/publication/PubMed/1415269" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "Generation of the beta-amyloid peptide and the amyloid precursor protein C-terminal fragment gamma are potentiated by FE65L1.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Chang Y, Tesco G, Jeong WJ, Lindsley L, Eckman EA, Eckman CB, Tanzi RE, Guenette SY", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "14527950", "url": "https://glygen.org/publication/PubMed/14527950" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "Pyrin binds the PSTPIP1/CD2BP1 protein, defining familial Mediterranean fever and PAPA syndrome as disorders in the same pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Shoham NG, Centola M, Mansfield E, Hull KM, Wood G, Wise CA, Kastner DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "14595024", "url": "https://glygen.org/publication/PubMed/14595024" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Mutation of the beta-amyloid precursor protein in familial Alzheimer's disease increases beta-protein production.", "journal": "Nature", "date": "1992", "authors": "Citron M, Oltersdorf T, Haass C, McConlogue L, Hung AY, Seubert P, Vigo-Pelfrey C, Lieberburg I, Selkoe DJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1465129", "url": "https://glygen.org/publication/PubMed/1465129" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Human Sgt1 binds HSP90 through the CHORD-Sgt1 domain and not the tetratricopeptide repeat domain.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lee YT, Jacob J, Michowski W, Nowotny M, Kuznicki J, Chazin WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "14761955", "url": "https://glygen.org/publication/PubMed/14761955" } ] }, { "title": "Facilitation of stress-induced phosphorylation of beta-amyloid precursor protein family members by X11-like/Mint2 protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Taru H, Suzuki T", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "14970211", "url": "https://glygen.org/publication/PubMed/14970211" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Glypican-1 as an Abeta binding HSPG in the human brain: its localization in DIG domains and possible roles in the pathogenesis of Alzheimer's disease.", "journal": "FASEB J.", "date": "2004", "authors": "Watanabe Norifumi, Araki Wataru, Chui De-Hua, Makifuchi Takao, Ihara Yasuo, Tabira Takeshi", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15084524", "url": "https://glygen.org/publication/PubMed/15084524" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "Suppression of the caspase cleavage of beta-amyloid precursor protein by its cytoplasmic phosphorylation.", "journal": "FEBS letters", "date": "2004", "authors": "Taru H, Yoshikawa K, Suzuki T", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "15178331", "url": "https://glygen.org/publication/PubMed/15178331" } ] }, { "title": "Novel amyloid precursor protein gene missense mutation (D678N) in probable familial Alzheimer's disease.", "journal": "Journal of neurology, neurosurgery, and psychiatry", "date": "2004", "authors": "Wakutani Y, Watanabe K, Adachi Y, Wada-Isoe K, Urakami K, Ninomiya H, Saido TC, Hashimoto T, Iwatsubo T, Nakashima K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15201367", "url": "https://glygen.org/publication/PubMed/15201367" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain.", "journal": "Molecular cell", "date": "2004", "authors": "Wang Y, Ha Y", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15304215", "url": "https://glygen.org/publication/PubMed/15304215" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Amyloid-beta protein precursor (AbetaPP) intracellular domain-associated protein-1 proteins bind to AbetaPP and modulate its processing in an isoform-specific manner.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Ghersi E, Noviello C, D'Adamio L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15347684", "url": "https://glygen.org/publication/PubMed/15347684" } ] }, { "title": "A family with Alzheimer disease and strokes associated with A713T mutation of the APP gene.", "journal": "Neurology", "date": "2004", "authors": "Rossi G, Giaccone G, Maletta R, Morbin M, Capobianco R, Mangieri M, Giovagnoli AR, Bizzi A, Tomaino C, Perri M, Di Natale M, Tagliavini F, Bugiani O, Bruni AC", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15365148", "url": "https://glygen.org/publication/PubMed/15365148" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Calcium signals induced by amyloid beta peptide and their consequences in neurons and astrocytes in culture.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Abramov AY, Canevari L, Duchen MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "15590058", "url": "https://glygen.org/publication/PubMed/15590058" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "An African American family with early-onset Alzheimer disease and an APP (T714I) mutation.", "journal": "Neurology", "date": "2005", "authors": "Edwards-Lee T, Ringman JM, Chung J, Werner J, Morgan A, St George Hyslop P, Thompson P, Dutton R, Mlikotic A, Rogaeva E, Hardy J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "15668448", "url": "https://glygen.org/publication/PubMed/15668448" } ] }, { "title": "Small glutamine-rich tetratricopeptide repeat-containing protein is composed of three structural units with distinct functions.", "journal": "Archives of biochemistry and biophysics", "date": "2005", "authors": "Liou ST, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "15708368", "url": "https://glygen.org/publication/PubMed/15708368" } ] }, { "title": "Identification and differential expression of a novel alternative splice isoform of the beta A4 amyloid precursor protein (APP) mRNA in leukocytes and brain microglial cells.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "K\u00f6nig G, M\u00f6nning U, Czech C, Prior R, Banati R, Schreiter-Gasser U, Bauer J, Masters C L, Beyreuther K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1587857", "url": "https://glygen.org/publication/PubMed/1587857" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Amyloid beta-protein is degraded by cellular angiotensin-converting enzyme (ACE) and elevated by an ACE inhibitor.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hemming ML, Selkoe DJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "16154999", "url": "https://glygen.org/publication/PubMed/16154999" } ] }, { "title": "Depletion of GAK/auxilin 2 inhibits receptor-mediated endocytosis and recruitment of both clathrin and clathrin adaptors.", "journal": "Journal of cell science", "date": "2005", "authors": "Lee DW, Zhao X, Zhang F, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "16155256", "url": "https://glygen.org/publication/PubMed/16155256" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "A novel AbetaPP mutation exclusively associated with cerebral amyloid angiopathy.", "journal": "Annals of neurology", "date": "2005", "authors": "Obici L, Demarchi A, de Rosa G, Bellotti V, Marciano S, Donadei S, Arbustini E, Palladini G, Diegoli M, Genovese E, Ferrari G, Coverlizza S, Merlini G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "16178030", "url": "https://glygen.org/publication/PubMed/16178030" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Interaction of the cytosolic domains of sorLA/LR11 with the amyloid precursor protein (APP) and beta-secretase beta-site APP-cleaving enzyme.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006", "authors": "Spoelgen R, von Arnim CA, Thomas AV, Peltan ID, Koker M, Deng A, Irizarry MC, Andersen OM, Willnow TE, Hyman BT", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "16407538", "url": "https://glygen.org/publication/PubMed/16407538" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Two novel rat liver membrane proteins that bind advanced glycosylation endproducts: relationship to macrophage receptor for glucose-modified proteins.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "Yang Z, Makita Z, Horii Y, Brunelle S, Cerami A, Sehajpal P, Suthanthiran M, Vlassara H", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "1651976", "url": "https://glygen.org/publication/PubMed/1651976" } ] }, { "title": "The vertebrate phototransduction cascade: amplification and termination mechanisms.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2005", "authors": "Chen CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16634148", "url": "https://glygen.org/publication/PubMed/16634148" } ] }, { "title": "Segregation of a missense mutation in the amyloid precursor protein gene with familial Alzheimer's disease.", "journal": "Nature", "date": "1991", "authors": "Goate A, Chartier-Harlin MC, Mullan M, Brown J, Crawford F, Fidani L, Giuffra L, Haynes A, Irving N, James L, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1671712", "url": "https://glygen.org/publication/PubMed/1671712" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Human SGT interacts with Bag-6/Bat-3/Scythe and cells with reduced levels of either protein display persistence of few misaligned chromosomes and mitotic arrest.", "journal": "Experimental cell research", "date": "2006", "authors": "Winnefeld M, Grewenig A, Schnolzer M, Spring H, Knoch TA, Gan EC, Rommelaere J, Cziepluch C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "16777091", "url": "https://glygen.org/publication/PubMed/16777091" } ] }, { "title": "Mis-sense mutation Val----Ile in exon 17 of amyloid precursor protein gene in Japanese familial Alzheimer's disease.", "journal": "Lancet (London, England)", "date": "1991", "authors": "Naruse S, Igarashi S, Kobayashi H, Aoki K, Inuzuka T, Kaneko K, Shimizu T, Iihara K, Kojima T, Miyatake T, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1678058", "url": "https://glygen.org/publication/PubMed/1678058" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "BACE2, as a novel APP theta-secretase, is not responsible for the pathogenesis of Alzheimer's disease in Down syndrome.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Sun X, He G, Song W", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "16816112", "url": "https://glygen.org/publication/PubMed/16816112" } ] }, { "title": "Gamma-adaptin, a novel ubiquitin-interacting adaptor, and Nedd4 ubiquitin ligase control hepatitis B virus maturation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Rost M, Mann S, Lambert C, Doring T, Thome N, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "16867982", "url": "https://glygen.org/publication/PubMed/16867982" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor.", "journal": "The EMBO journal", "date": "2006", "authors": "Pelegrin P, Surprenant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "17036048", "url": "https://glygen.org/publication/PubMed/17036048" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.", "journal": "Nature", "date": "2006", "authors": "Shen Y, Joachimiak A, Rosner MR, Tang WJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17051221", "url": "https://glygen.org/publication/PubMed/17051221" } ] }, { "title": "A peptide zipcode sufficient for anterograde transport within amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-10-31", "authors": "Satpute-Krishnan Prasanna, DeGiorgis Joseph A, Conley Michael P, Jang Marcus, Bearer Elaine L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17062754", "url": "https://glygen.org/publication/PubMed/17062754" } ] }, { "title": "Comparative proteomics of clathrin-coated vesicles.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Borner GH, Harbour M, Hester S, Lilley KS, Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "17116749", "url": "https://glygen.org/publication/PubMed/17116749" } ] }, { "title": "Sequential NMR resonance assignment and structure determination of the Kunitz-type inhibitor domain of the Alzheimer's beta-amyloid precursor protein.", "journal": "Biochemistry", "date": "1991", "authors": "Heald S L, Tilton R F, Hammond L J, Lee A, Bayney R M, Kamarck M E, Ramabhadran T V, Dreyer R N, Davis G, Unterbeck A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1718421", "url": "https://glygen.org/publication/PubMed/1718421" } ] }, { "title": "Structural studies of the Alzheimer's amyloid precursor protein copper-binding domain reveal how it binds copper ions.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Kong GK, Adams JJ, Harris HH, Boas JF, Curtain CC, Galatis D, Masters CL, Barnham KJ, McKinstry WJ, Cappai R, Parker MW", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17239395", "url": "https://glygen.org/publication/PubMed/17239395" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Reconstituted NALP1 inflammasome reveals two-step mechanism of caspase-1 activation.", "journal": "Molecular cell", "date": "2007", "authors": "Faustin B, Lartigue L, Bruey JM, Luciano F, Sergienko E, Bailly-Maitre B, Volkmann N, Hanein D, Rouiller I, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "17349957", "url": "https://glygen.org/publication/PubMed/17349957" } ] }, { "title": "Identification of a targeting factor for posttranslational membrane protein insertion into the ER.", "journal": "Cell", "date": "2007", "authors": "Stefanovic S, Hegde RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "17382883", "url": "https://glygen.org/publication/PubMed/17382883" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "A crucial function of SGT1 and HSP90 in inflammasome activity links mammalian and plant innate immune responses.", "journal": "Nature immunology", "date": "2007", "authors": "Mayor A, Martinon F, De Smedt T, Petrilli V, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "17435760", "url": "https://glygen.org/publication/PubMed/17435760" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Regulation of the bioavailability of thioredoxin in the lens by a specific thioredoxin-binding protein (TBP-2).", "journal": "Experimental eye research", "date": "2007", "authors": "Liyanage NP, Fernando MR, Lou MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "17603038", "url": "https://glygen.org/publication/PubMed/17603038" } ] }, { "title": "NALP inflammasomes: a central role in innate immunity.", "journal": "Seminars in immunopathology", "date": "2007", "authors": "Martinon F, Gaide O, Petrilli V, Mayor A, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "17703304", "url": "https://glygen.org/publication/PubMed/17703304" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "SorLA/LR11 regulates processing of amyloid precursor protein via interaction with adaptors GGA and PACS-1.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Schmidt V, Sporbert A, Rohe M, Reimer T, Rehm A, Andersen OM, Willnow TE", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17855360", "url": "https://glygen.org/publication/PubMed/17855360" } ] }, { "title": "Molecular basis for passive immunotherapy of Alzheimer's disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Gardberg Anna S, Dice Lezlee T, Ou Susan, Rich Rebecca L, Helmbrecht Elizabeth, Ko Jan, Wetzel Ronald, Myszka David G, Patterson Paul H, Dealwis Chris", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17895381", "url": "https://glygen.org/publication/PubMed/17895381" } ] }, { "title": "Structure of Alzheimer's disease amyloid precursor protein copper-binding domain at atomic resolution.", "journal": "Acta Crystallogr. F", "date": "2007", "authors": "Kong Geoffrey Kwai-Wai, Adams Julian J, Cappai Roberto, Parker Michael W", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "17909280", "url": "https://glygen.org/publication/PubMed/17909280" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Rushe M, Silvian L, Bixler S, Chen LL, Cheung A, Bowes S, Cuervo H, Berkowitz S, Zheng T, Guckian K, Pellegrini M, Lugovskoy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "18462684", "url": "https://glygen.org/publication/PubMed/18462684" } ] }, { "title": "Regulation of FE65 nuclear translocation and function by amyloid beta-protein precursor in osmotically stressed cells.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Nakaya Tadashi, Kawai Tomoko, Suzuki Toshiharu", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "18468999", "url": "https://glygen.org/publication/PubMed/18468999" } ] }, { "title": "Distinct targeting pathways for the membrane insertion of tail-anchored (TA) proteins.", "journal": "Journal of cell science", "date": "2008", "authors": "Favaloro V, Spasic M, Schwappach B, Dobberstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "18477612", "url": "https://glygen.org/publication/PubMed/18477612" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Deregulated Cdk5 promotes oxidative stress and mitochondrial dysfunction.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Sun KH, de Pablo Y, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "18691386", "url": "https://glygen.org/publication/PubMed/18691386" } ] }, { "title": "Characterization of the human cerebrospinal fluid phosphoproteome by titanium dioxide affinity chromatography and mass spectrometry.", "journal": "Analytical chemistry", "date": "2008", "authors": "Bahl JM, Jensen SS, Larsen MR, Heegaard NH", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "18702456", "url": "https://glygen.org/publication/PubMed/18702456" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "The 717Val----Ile substitution in amyloid precursor protein is associated with familial Alzheimer's disease regardless of ethnic groups.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Yoshioka K, Miki T, Katsuya T, Ogihara T, Sakaki Y", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1908231", "url": "https://glygen.org/publication/PubMed/1908231" } ] }, { "title": "APP binds DR6 to trigger axon pruning and neuron death via distinct caspases.", "journal": "Nature", "date": "2009", "authors": "Nikolaev Anatoly, McLaughlin Todd, O'Leary Dennis D M, Tessier-Lavigne Marc", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "19225519", "url": "https://glygen.org/publication/PubMed/19225519" } ] }, { "title": "A mutation in the amyloid precursor protein associated with hereditary Alzheimer's disease.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Murrell J, Farlow M, Ghetti B, Benson MD", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1925564", "url": "https://glygen.org/publication/PubMed/1925564" } ] }, { "title": "BRI3 inhibits amyloid precursor protein processing in a mechanistically distinct manner from its homologue dementia gene BRI2.", "journal": "J. Biol. Chem.", "date": "2009", "authors": "Matsuda S, Matsuda Y, D'Adamio L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "19366692", "url": "https://glygen.org/publication/PubMed/19366692" } ] }, { "title": "Early-onset Alzheimer's disease caused by mutations at codon 717 of the beta-amyloid precursor protein gene.", "journal": "Nature", "date": "1991", "authors": "Chartier-Harlin MC, Crawford F, Houlden H, Warren A, Hughes D, Fidani L, Goate A, Rossor M, Roques P, Hardy J, et al.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1944558", "url": "https://glygen.org/publication/PubMed/1944558" } ] }, { "title": "Mutation in the AP4M1 gene provides a model for neuroaxonal injury in cerebral palsy.", "journal": "American journal of human genetics", "date": "2009", "authors": "Verkerk AJ, Schot R, Dumee B, Schellekens K, Swagemakers S, Bertoli-Avella AM, Lequin MH, Dudink J, Govaert P, van Zwol AL, Hirst J, Wessels MW, Catsman-Berrevoets C, Verheijen FW, de Graaff E, de Coo IF, Kros JM, Willemsen R, Willems PJ, van der Spek PJ, Mancini GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "19559397", "url": "https://glygen.org/publication/PubMed/19559397" } ] }, { "title": "Cutting edge: NF-kappaB activating pattern recognition and cytokine receptors license NLRP3 inflammasome activation by regulating NLRP3 expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Bauernfeind FG, Horvath G, Stutz A, Alnemri ES, MacDonald K, Speert D, Fernandes-Alnemri T, Wu J, Monks BG, Fitzgerald KA, Hornung V, Latz E", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "19570822", "url": "https://glygen.org/publication/PubMed/19570822" } ] }, { "title": "The clavesin family, neuron-specific lipid- and clathrin-binding Sec14 proteins regulating lysosomal morphology.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Katoh Y, Ritter B, Gaffry T, Blondeau F, Honing S, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "19651769", "url": "https://glygen.org/publication/PubMed/19651769" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "NEMO-binding domains of both IKKalpha and IKKbeta regulate IkappaB kinase complex assembly and classical NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Solt LA, Madge LA, May MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "19666475", "url": "https://glygen.org/publication/PubMed/19666475" } ] }, { "title": "Protease-specificity of Kunitz inhibitor domain of Alzheimer's disease amyloid protein precursor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1990", "authors": "Kido H, Fukutomi A, Schilling J, Wang Y, Cordell B, Katunuma N", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "1969731", "url": "https://glygen.org/publication/PubMed/1969731" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "RAGE-mediated signaling contributes to intraneuronal transport of amyloid-{beta} and neuronal dysfunction.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2009", "authors": "Takuma Kazuhiro, Fang Fang, Zhang Wensheng, Yan Shiqiang, Fukuzaki Emiko, Du Heng, Sosunov Alexander, McKhann Guy, Funatsu Yoko, Nakamichi Noritaka, Nagai Taku, Mizoguchi Hiroyuki, Ibi Daisuke, Hori Osamu, Ogawa Satoshi, Stern David M, Yamada Kiyofumi, Yan Shirley Shidu", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "19901339", "url": "https://glygen.org/publication/PubMed/19901339" } ] }, { "title": "Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Basi Guriqbal S, Feinberg Hadar, Oshidari Farshid, Anderson John, Barbour Robin, Baker Jeanne, Comery Thomas A, Diep Linnea, Gill Davinder, Johnson-Wood Kelly, Goel Amita, Grantcharova Katerina, Lee Mike, Li Jingzhi, Partridge Anthony, Griswold-Prenner Irene, Piot Nicolas, Walker Don, Widom Angela, Pangalos Menelas N, Seubert Peter, Jacobsen J Steven, Schenk Dale, Weis William I", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "19923222", "url": "https://glygen.org/publication/PubMed/19923222" } ] }, { "title": "Thioredoxin-interacting protein links oxidative stress to inflammasome activation.", "journal": "Nature immunology", "date": "2010", "authors": "Zhou R, Tardivel A, Thorens B, Choi I, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "20023662", "url": "https://glygen.org/publication/PubMed/20023662" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "The Alzheimer's disease-associated amyloid beta-protein is an antimicrobial peptide.", "journal": "PloS one", "date": "2010", "authors": "Soscia SJ, Kirby JE, Washicosky KJ, Tucker SM, Ingelsson M, Hyman B, Burton MA, Goldstein LE, Duong S, Tanzi RE, Moir RD", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ], "reference": [ { "type": "PubMed", "id": "20209079", "url": "https://glygen.org/publication/PubMed/20209079" } ] }, { "title": "Structure and biochemical analysis of the heparin-induced E1 dimer of the amyloid precursor protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2010", "authors": "Dahms Sven O, Hoefgen Sandra, Roeser Dirk, Schlott Bernhard, G\u00fchrs Karl-Heinz, Than Manuel E", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "20212142", "url": "https://glygen.org/publication/PubMed/20212142" } ] }, { "title": "Sorting of the Alzheimer's disease amyloid precursor protein mediated by the AP-4 complex.", "journal": "Developmental cell", "date": "2010", "authors": "Burgos PV, Mardones GA, Rojas AL, daSilva LL, Prabhu Y, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "20230749", "url": "https://glygen.org/publication/PubMed/20230749" } ] }, { "title": "The inflammasomes.", "journal": "Cell", "date": "2010", "authors": "Schroder K, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "20303873", "url": "https://glygen.org/publication/PubMed/20303873" } ] }, { "title": "Asna1/TRC40-mediated membrane insertion of tail-anchored proteins.", "journal": "Journal of cell science", "date": "2010", "authors": "Favaloro V, Vilardi F, Schlecht R, Mayer MP, Dobberstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "20375064", "url": "https://glygen.org/publication/PubMed/20375064" } ] }, { "title": "Clathrin-dependent APP endocytosis and Abeta secretion are highly sensitive to the level of plasma membrane cholesterol.", "journal": "Biochim. Biophys. Acta", "date": "2010", "authors": "Cossec Jack-Christophe, Simon Anne, Marquer Catherine, Moldrich Randal X, Leterrier Christophe, Rossier Jean, Duyckaerts Charles, Lenkei Zsolt, Potier Marie-Claude", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "20580937", "url": "https://glygen.org/publication/PubMed/20580937" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "A ribosome-associating factor chaperones tail-anchored membrane proteins.", "journal": "Nature", "date": "2010", "authors": "Mariappan M, Li X, Stefanovic S, Sharma A, Mateja A, Keenan RJ, Hegde RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "20676083", "url": "https://glygen.org/publication/PubMed/20676083" } ] }, { "title": "Hereditary cerebral hemorrhage with amyloidosis associated with the E693K mutation of APP.", "journal": "Archives of neurology", "date": "2010", "authors": "Bugiani O, Giaccone G, Rossi G, Mangieri M, Capobianco R, Morbin M, Mazzoleni G, Cupidi C, Marcon G, Giovagnoli A, Bizzi A, Di Fede G, Puoti G, Carella F, Salmaggi A, Romorini A, Patruno GM, Magoni M, Padovani A, Tagliavini F", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "20697050", "url": "https://glygen.org/publication/PubMed/20697050" } ] }, { "title": "gamma2-Adaptin is functioning in the late endosomal sorting pathway and interacts with ESCRT-I and -III subunits.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Doring T, Gotthardt K, Stieler J, Prange R", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "20708039", "url": "https://glygen.org/publication/PubMed/20708039" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "Gamma-secretase activating protein is a therapeutic target for Alzheimer's disease.", "journal": "Nature", "date": "2010", "authors": "He G, Luo W, Li P, Remmers C, Netzer WJ, Hendrick J, Bettayeb K, Flajolet M, Gorelick F, Wennogle LP, Greengard P", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "20811458", "url": "https://glygen.org/publication/PubMed/20811458" } ] }, { "title": "Genomic organization of the human amyloid beta-protein precursor gene.", "journal": "Gene", "date": "1990", "authors": "Yoshikai S, Sasaki H, Doh-ura K, Furuya H, Sakaki Y", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2110105", "url": "https://glygen.org/publication/PubMed/2110105" } ] }, { "title": "Mutation of the Alzheimer's disease amyloid gene in hereditary cerebral hemorrhage, Dutch type.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Levy E, Carman MD, Fernandez-Madrid IJ, Power MD, Lieberburg I, van Duinen SG, Bots GT, Luyendijk W, Frangione B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2111584", "url": "https://glygen.org/publication/PubMed/2111584" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "X-ray crystal structure of the protease inhibitor domain of Alzheimer's amyloid beta-protein precursor.", "journal": "Biochemistry", "date": "1990", "authors": "Hynes T R, Randal M, Kennedy L A, Eigenbrot C, Kossiakoff A A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2125487", "url": "https://glygen.org/publication/PubMed/2125487" } ] }, { "title": "WRB is the receptor for TRC40/Asna1-mediated insertion of tail-anchored proteins into the ER membrane.", "journal": "Journal of cell science", "date": "2011", "authors": "Vilardi F, Lorenz H, Dobberstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "21444755", "url": "https://glygen.org/publication/PubMed/21444755" } ] }, { "title": "A biochemical analysis of the constraints of tail-anchored protein biogenesis.", "journal": "The Biochemical journal", "date": "2011", "authors": "Leznicki P, Warwicker J, High S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "21466504", "url": "https://glygen.org/publication/PubMed/21466504" } ] }, { "title": "Synthesis and use of a novel N-formyl peptide derivative to isolate a human N-formyl peptide receptor cDNA.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Boulay F, Tardif M, Brouchon L, Vignais P", "evidence": [ { "database": "Reactome", "id": "R-HSA-444473", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-444473" } ], "reference": [ { "type": "PubMed", "id": "2161213", "url": "https://glygen.org/publication/PubMed/2161213" } ] }, { "title": "Adaptor protein complex 4 deficiency causes severe autosomal-recessive intellectual disability, progressive spastic paraplegia, shy character, and short stature.", "journal": "American journal of human genetics", "date": "2011", "authors": "Abou Jamra R, Philippe O, Raas-Rothschild A, Eck SH, Graf E, Buchert R, Borck G, Ekici A, Brockschmidt FF, Nothen MM, Munnich A, Strom TM, Reis A, Colleaux L", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "21620353", "url": "https://glygen.org/publication/PubMed/21620353" } ] }, { "title": "A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.", "journal": "Molecular cell", "date": "2011", "authors": "Wang Q, Liu Y, Soetandyo N, Baek K, Hegde R, Ye Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "21636303", "url": "https://glygen.org/publication/PubMed/21636303" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Site-specific characterization of threonine, serine, and tyrosine glycosylations of amyloid precursor protein/amyloid beta-peptides in human cerebrospinal fluid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Halim A, Brinkmalm G, Ruetschi U, Westman-Brinkmalm A, Portelius E, Zetterberg H, Blennow K, Larson G, Nilsson J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "21712440", "url": "https://glygen.org/publication/PubMed/21712440" } ] }, { "title": "Protein targeting and degradation are coupled for elimination of mislocalized proteins.", "journal": "Nature", "date": "2011", "authors": "Hessa T, Sharma A, Mariappan M, Eshleman HD, Gutierrez E, Hegde RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "21743475", "url": "https://glygen.org/publication/PubMed/21743475" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "ATP-induced pore formation in the plasma membrane of rat peritoneal mast cells.", "journal": "The Journal of general physiology", "date": "1990", "authors": "Tatham PE, Lindau M", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "2182768", "url": "https://glygen.org/publication/PubMed/2182768" } ] }, { "title": "APP is phosphorylated by TrkA and regulates NGF/TrkA signaling.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011", "authors": "Matrone C, Barbagallo AP, La Rosa LR, Florenzano F, Ciotti MT, Mercanti D, Chao MV, Calissano P, D'Adamio L", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "21849536", "url": "https://glygen.org/publication/PubMed/21849536" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "MRP14 (S100A9) protein interacts with Alzheimer beta-amyloid peptide and induces its fibrillization.", "journal": "PLoS ONE", "date": "2012", "authors": "Zhang Ce, Liu Yonggang, Gilthorpe Jonathan, van der Maarel Johan R C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "22457725", "url": "https://glygen.org/publication/PubMed/22457725" } ] }, { "title": "An online nano-LC-ESI-FTICR-MS method for comprehensive characterization of endogenous fragments from amyloid beta and amyloid precursor protein in human and cat cerebrospinal fluid.", "journal": "Journal of mass spectrometry : JMS", "date": "2012", "authors": "Brinkmalm G, Portelius E, Ohrfelt A, Mattsson N, Persson R, Gustavsson MK, Vite CH, Gobom J, Mansson JE, Nilsson J, Halim A, Larson G, Ruetschi U, Zetterberg H, Blennow K, Brinkmalm A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067#ptm_processing" }, { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "22576872", "url": "https://glygen.org/publication/PubMed/22576872" } ] }, { "title": "Dimeric structure of transmembrane domain of amyloid precursor protein in micellar environment.", "journal": "FEBS Lett.", "date": "2012", "authors": "Nadezhdin Kirill D, Bocharova Olga V, Bocharov Eduard V, Arseniev Alexander S", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "22584060", "url": "https://glygen.org/publication/PubMed/22584060" } ] }, { "title": "The amyloid precursor protein has a flexible transmembrane domain and binds cholesterol.", "journal": "Science", "date": "2012", "authors": "Barrett Paul J, Song Yuanli, Van Horn Wade D, Hustedt Eric J, Schafer Johanna M, Hadziselimovic Arina, Beel Andrew J, Sanders Charles R", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "22654059", "url": "https://glygen.org/publication/PubMed/22654059" } ] }, { "title": "Deregulated Cdk5 triggers aberrant activation of cell cycle kinases and phosphatases inducing neuronal death.", "journal": "Journal of cell science", "date": "2012", "authors": "Chang KH, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "22899714", "url": "https://glygen.org/publication/PubMed/22899714" } ] }, { "title": "Quantitative measurements and modeling of cargo-motor interactions during fast transport in the living axon.", "journal": "Physical biology", "date": "2012-10", "authors": "Seamster Pamela E, Loewenberg Michael, Pascal Jennifer, Chauviere Arnaud, Gonzales Aaron, Cristini Vittorio, Bearer Elaine L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "23011729", "url": "https://glygen.org/publication/PubMed/23011729" } ] }, { "title": "Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.", "journal": "Molecular cell", "date": "2012", "authors": "Yamamoto Y, Sakisaka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "23041287", "url": "https://glygen.org/publication/PubMed/23041287" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "SGTA antagonizes BAG6-mediated protein triage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Leznicki P, High S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "23129660", "url": "https://glygen.org/publication/PubMed/23129660" } ] }, { "title": "Structures of the Sgt2/SGTA dimerization domain with the Get5/UBL4A UBL domain reveal an interaction that forms a conserved dynamic interface.", "journal": "Cell reports", "date": "2012", "authors": "Chartron JW, VanderVelde DG, Clemons WM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "23142665", "url": "https://glygen.org/publication/PubMed/23142665" } ] }, { "title": "SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.", "journal": "Cell reports", "date": "2012", "authors": "Xu Y, Cai M, Yang Y, Huang L, Ye Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "23246001", "url": "https://glygen.org/publication/PubMed/23246001" } ] }, { "title": "The association of BAG6 with SGTA and tail-anchored proteins.", "journal": "PloS one", "date": "2013", "authors": "Leznicki P, Roebuck QP, Wunderley L, Clancy A, Krysztofinska EM, Isaacson RL, Warwicker J, Schwappach B, High S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "23533635", "url": "https://glygen.org/publication/PubMed/23533635" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P05067", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "Cutting edge: the NLRP3 inflammasome links complement-mediated inflammation and IL-1beta release.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013", "authors": "Laudisi F, Spreafico R, Evrard M, Hughes TR, Mandriani B, Kandasamy M, Morgan BP, Sivasankar B, Mortellaro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "23817414", "url": "https://glygen.org/publication/PubMed/23817414" } ] }, { "title": "C3a modulates IL-1beta secretion in human monocytes by regulating ATP efflux and subsequent NLRP3 inflammasome activation.", "journal": "Blood", "date": "2013", "authors": "Asgari E, Le Friec G, Yamamoto H, Perucha E, Sacks SS, Kohl J, Cook HT, Kemper C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "23878142", "url": "https://glygen.org/publication/PubMed/23878142" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "Rare coding variants in the phospholipase D3 gene confer risk for Alzheimer's disease.", "journal": "Nature", "date": "2014", "authors": "Cruchaga C, Karch CM, Jin SC, Benitez BA, Cai Y, Guerreiro R, Harari O, Norton J, Budde J, Bertelsen S, Jeng AT, Cooper B, Skorupa T, Carrell D, Levitch D, Hsu S, Choi J, Ryten M, Sassi C, Bras J, Gibbs RJ, Hernandez DG, Lupton MK, Powell J, Forabosco P, Ridge PG, Corcoran CD, Tschanz JT, Norton MC, Munger RG, Schmutz C, Leary M, Demirci FY, Bamne MN, Wang X, Lopez OL, Ganguli M, Medway C, Turton J, Lord J, Braae A, Barber I, Brown K, Pastor P, Lorenzo-Betancor O, Brkanac Z, Scott E, Topol E, Morgan K, Rogaeva E, Singleton A, Hardy J, Kamboh MI, George-Hyslop PS, Cairns N, Morris JC, Kauwe JSK, Goate AM", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "24336208", "url": "https://glygen.org/publication/PubMed/24336208" } ] }, { "title": "WRB and CAML are necessary and sufficient to mediate tail-anchored protein targeting to the ER membrane.", "journal": "PloS one", "date": "2014", "authors": "Vilardi F, Stephan M, Clancy A, Janshoff A, Schwappach B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "24392163", "url": "https://glygen.org/publication/PubMed/24392163" } ] }, { "title": "Lysosomal sorting of amyloid-beta by the SORLA receptor is impaired by a familial Alzheimer's disease mutation.", "journal": "Sci. Transl. Med.", "date": "2014", "authors": "Caglayan S, Takagi-Niidome S, Liao F, Carlo AS, Schmidt V, Burgert T, Kitago Y, Fuchtbauer EM, Fuchtbauer A, Holtzman DM, Takagi J, Willnow TE", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "24523320", "url": "https://glygen.org/publication/PubMed/24523320" } ] }, { "title": "Phosphorylation of amyloid precursor protein at threonine 668 is essential for its copper-responsive trafficking in SH-SY5Y neuroblastoma cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Acevedo KM, Opazo CM, Norrish D, Challis LM, Li QX, White AR, Bush AI, Camakaris J", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "24610780", "url": "https://glygen.org/publication/PubMed/24610780" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "The secreted form of the Alzheimer's amyloid precursor protein with the Kunitz domain is protease nexin-II.", "journal": "Nature", "date": "1989", "authors": "Oltersdorf T, Fritz L C, Schenk D B, Lieberburg I, Johnson-Wood K L, Beattie E C, Ward P J, Blacher R W, Dovey H F, Sinha S", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2506449", "url": "https://glygen.org/publication/PubMed/2506449" } ] }, { "title": "Amyloid precursor protein dimerization and synaptogenic function depend on copper binding to the growth factor-like domain.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2014", "authors": "Baumkotter F, Schmidt N, Vargas C, Schilling S, Weber R, Wagner K, Fiedler S, Klug W, Radzimanowski J, Nickolaus S, Keller S, Eggert S, Wild K, Kins S", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "25122912", "url": "https://glygen.org/publication/PubMed/25122912" } ] }, { "title": "Abeta promotes VDAC1 channel dephosphorylation in neuronal lipid rafts. Relevance to the mechanisms of neurotoxicity in Alzheimer's disease.", "journal": "Neuroscience", "date": "2014", "authors": "Fernandez-Echevarria C, D\u00edaz M, Ferrer I, Canerina-Amaro A, Marin R", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "25168729", "url": "https://glygen.org/publication/PubMed/25168729" } ] }, { "title": "SGTA regulates the cytosolic quality control of hydrophobic substrates.", "journal": "Journal of cell science", "date": "2014", "authors": "Wunderley L, Leznicki P, Payapilly A, High S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "25179605", "url": "https://glygen.org/publication/PubMed/25179605" } ] }, { "title": "Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina.", "journal": "Neuron", "date": "1989", "authors": "Lerea CL, Bunt-Milam AH, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2534964", "url": "https://glygen.org/publication/PubMed/2534964" } ] }, { "title": "Characterization of the 5'-end region and the first two exons of the beta-protein precursor gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "La Fauci G, Lahiri D K, Salton S R, Robakis N K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2538123", "url": "https://glygen.org/publication/PubMed/2538123" } ] }, { "title": "Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.", "journal": "PloS one", "date": "2014", "authors": "Darby JF, Krysztofinska EM, Simpson PJ, Simon AC, Leznicki P, Sriskandarajah N, Bishop DS, Hale LR, Alfano C, Conte MR, Martinez-Lumbreras S, Thapaliya A, High S, Isaacson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "25415308", "url": "https://glygen.org/publication/PubMed/25415308" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Mock JY, Chartron JW, Zaslaver M, Xu Y, Ye Y, Clemons WM Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "25535373", "url": "https://glygen.org/publication/PubMed/25535373" } ] }, { "title": "A novel mRNA of the A4 amyloid precursor gene coding for a possibly secreted protein.", "journal": "Science", "date": "1989", "authors": "de Sauvage F, Octave J N", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2569763", "url": "https://glygen.org/publication/PubMed/2569763" } ] }, { "title": "Structure of a BAG6 (Bcl-2-associated athanogene 6)-Ubl4a (ubiquitin-like protein 4a) complex reveals a novel binding interface that functions in tail-anchored protein biogenesis.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Kuwabara N, Minami R, Yokota N, Matsumoto H, Senda T, Kawahara H, Kato R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "25713138", "url": "https://glygen.org/publication/PubMed/25713138" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P05067", "url": "" }, { "database": "GlyGen", "id": "GLY_000268", "url": "https://data.glygen.org/GLY_000268" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "IL-1beta production is dependent on the activation of purinergic receptors and NLRP3 pathway in human macrophages.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2015", "authors": "Gicquel T, Robert S, Loyer P, Victoni T, Bodin A, Ribault C, Gleonnec F, Couillin I, Boichot E, Lagente V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "26116704", "url": "https://glygen.org/publication/PubMed/26116704" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "Identification, biogenesis, and localization of precursors of Alzheimer's disease A4 amyloid protein.", "journal": "Cell", "date": "1989", "authors": "Weidemann A, Konig G, Bunke D, Fischer P, Salbaum JM, Masters CL, Beyreuther K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2649245", "url": "https://glygen.org/publication/PubMed/2649245" } ] }, { "title": "Molecular mechanisms regulating NLRP3 inflammasome activation.", "journal": "Cellular & molecular immunology", "date": "2016", "authors": "Jo EK, Kim JK, Shin DM, Sasakawa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "26549800", "url": "https://glygen.org/publication/PubMed/26549800" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "Emery-Dreifuss muscular dystrophy mutations impair TRC40-mediated targeting of emerin to the inner nuclear membrane.", "journal": "Journal of cell science", "date": "2016", "authors": "Pfaff J, Rivera Monroy J, Jamieson C, Rajanala K, Vilardi F, Schwappach B, Kehlenbach RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "26675233", "url": "https://glygen.org/publication/PubMed/26675233" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Alzheimer's disease amyloid peptide is encoded by two exons and shows similarity to soybean trypsin inhibitor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Johnstone E M, Chaney M O, Moore R E, Ward K E, Norris F H, Little S P", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2675837", "url": "https://glygen.org/publication/PubMed/2675837" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Interplay of histidine residues of the Alzheimer's disease Abeta peptide governs its Zn-induced oligomerization.", "journal": "Sci. Rep.", "date": "2016", "authors": "Istrate AN, Kozin SA, Zhokhov SS, Mantsyzov AB, Kechko OI, Pastore A, Makarov AA, Polshakov VI", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "26898943", "url": "https://glygen.org/publication/PubMed/26898943" } ] }, { "title": "missing tag=TI", "journal": "missing tag=JT", "date": "missing", "authors": "author information missing", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "26962010", "url": "https://glygen.org/publication/PubMed/26962010" } ] }, { "title": "Structural and functional insights into the E3 ligase, RNF126.", "journal": "Scientific reports", "date": "2016", "authors": "Krysztofinska EM, Martinez-Lumbreras S, Thapaliya A, Evans NJ, High S, Isaacson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "27193484", "url": "https://glygen.org/publication/PubMed/27193484" } ] }, { "title": "Tail-anchored Protein Insertion in Mammals: FUNCTION AND RECIPROCAL INTERACTIONS OF THE TWO SUBUNITS OF THE TRC40 RECEPTOR.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Colombo SF, Cardani S, Maroli A, Vitiello A, Soffientini P, Crespi A, Bram RF, Benfante R, Borgese N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "27226539", "url": "https://glygen.org/publication/PubMed/27226539" } ] }, { "title": "Tryptophan-rich basic protein (WRB) mediates insertion of the tail-anchored protein otoferlin and is required for hair cell exocytosis and hearing.", "journal": "The EMBO journal", "date": "2016", "authors": "Vogl C, Panou I, Yamanbaeva G, Wichmann C, Mangosing SJ, Vilardi F, Indzhykulian AA, Pangrsic T, Santarelli R, Rodriguez-Ballesteros M, Weber T, Jung S, Cardenas E, Wu X, Wojcik SM, Kwan KY, Del Castillo I, Schwappach B, Strenzke N, Corey DP, Lin SY, Moser T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "27458190", "url": "https://glygen.org/publication/PubMed/27458190" } ] }, { "title": "Nucleotide sequence for a cDNA encoding the alpha subunit of retinal transducin (GNAT1) isolated from the human eye.", "journal": "Nucleic acids research", "date": "1989", "authors": "Van Dop C, Medynski DC, Apone LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2748346", "url": "https://glygen.org/publication/PubMed/2748346" } ] }, { "title": "Double phosphorylation-induced structural changes in the signal-receiving domain of IkappaBalpha in complex with NF-kappaB.", "journal": "Proteins", "date": "2017", "authors": "Yazdi S, Naumann M, Stein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "27701768", "url": "https://glygen.org/publication/PubMed/27701768" } ] }, { "title": "The PreA4(695) precursor protein of Alzheimer's disease A4 amyloid is encoded by 16 exons.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Lemaire H G, Salbaum J M, Multhaup G, Kang J, Bayney R M, Unterbeck A, Beyreuther K, M\u00fcller-Hill B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2783775", "url": "https://glygen.org/publication/PubMed/2783775" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Mechanistic basis for a molecular triage reaction.", "journal": "Science (New York, N.Y.)", "date": "2017", "authors": "Shao S, Rodrigo-Brenni MC, Kivlen MH, Hegde RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "28104892", "url": "https://glygen.org/publication/PubMed/28104892" } ] }, { "title": "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2834384", "url": "https://glygen.org/publication/PubMed/2834384" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "A Binuclear Zinc Interaction Fold Discovered in the Homodimer of Alzheimer's Amyloid-beta Fragment with Taiwanese Mutation D7H.", "journal": "Angew. Chem. Int. Ed. Engl.", "date": "2017", "authors": "Polshakov Vladimir I, Mantsyzov Alexey B, Kozin Sergey A, Adzhubei Alexei A, Zhokhov Sergey S, van Beek Wouter, Kulikova Alexandra A, Indeykina Maria I, Mitkevich Vladimir A, Makarov Alexander A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "28570778", "url": "https://glygen.org/publication/PubMed/28570778" } ] }, { "title": "Phosphorylation of amyloid precursor protein by mutant LRRK2 promotes AICD activity and neurotoxicity in Parkinson's disease.", "journal": "Science signaling", "date": "2017", "authors": "Chen ZC, Zhang W, Chua LL, Chai C, Li R, Lin L, Cao Z, Angeles DC, Stanton LW, Peng JH, Zhou ZD, Lim KL, Zeng L, Tan EK", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "28720718", "url": "https://glygen.org/publication/PubMed/28720718" } ] }, { "title": "The precursor of Alzheimer's disease amyloid A4 protein resembles a cell-surface receptor.", "journal": "Nature", "date": "1987", "authors": "Kang J, Lemaire H G, Unterbeck A, Salbaum J M, Masters C L, Grzeschik K H, Multhaup G, Beyreuther K, M\u00fcller-Hill B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2881207", "url": "https://glygen.org/publication/PubMed/2881207" } ] }, { "title": "Fibril structure of amyloid-beta(1-42) by cryo-electron microscopy.", "journal": "Science", "date": "2017", "authors": "Gremer Lothar, Sch\u00f6lzel Daniel, Schenk Carla, Reinartz Elke, Labahn J\u00f6rg, Ravelli Raimond B G, Tusche Markus, Lopez-Iglesias Carmen, Hoyer Wolfgang, Heise Henrike, Willbold Dieter, Schr\u00f6der Gunnar F", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "28882996", "url": "https://glygen.org/publication/PubMed/28882996" } ] }, { "title": "A new A4 amyloid mRNA contains a domain homologous to serine proteinase inhibitors.", "journal": "Nature", "date": "1988", "authors": "Ponte P, Gonzalez-DeWhitt P, Schilling J, Miller J, Hsu D, Greenberg B, Davis K, Wallace W, Lieberburg I, Fuller F", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2893289", "url": "https://glygen.org/publication/PubMed/2893289" } ] }, { "title": "Protease inhibitor domain encoded by an amyloid protein precursor mRNA associated with Alzheimer's disease.", "journal": "Nature", "date": "1988", "authors": "Tanzi R E, McClatchey A I, Lamperti E D, Villa-Komaroff L, Gusella J F, Neve R L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2893290", "url": "https://glygen.org/publication/PubMed/2893290" } ] }, { "title": "Novel precursor of Alzheimer's disease amyloid protein shows protease inhibitory activity.", "journal": "Nature", "date": "1988", "authors": "Kitaguchi N, Takahashi Y, Tokushima Y, Shiojiri S, Ito H", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2893291", "url": "https://glygen.org/publication/PubMed/2893291" } ] }, { "title": "Molecular cloning of amyloid cDNA derived from mRNA of the Alzheimer disease brain: coding and noncoding regions of the fetal precursor mRNA are expressed in the cortex.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Zain S B, Salim M, Chou W G, Sajdel-Sulkowska E M, Majocha R E, Marotta C A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2893379", "url": "https://glygen.org/publication/PubMed/2893379" } ] }, { "title": "Identification, transmembrane orientation and biogenesis of the amyloid A4 precursor of Alzheimer's disease.", "journal": "The EMBO journal", "date": "1988", "authors": "Dyrks T, Weidemann A, Multhaup G, Salbaum JM, Lemaire HG, Kang J, Muller-Hill B, Masters CL, Beyreuther K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2900137", "url": "https://glygen.org/publication/PubMed/2900137" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "The ER membrane protein complex is a transmembrane domain insertase.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Guna A, Volkmar N, Christianson JC, Hegde RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609523", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523" } ], "reference": [ { "type": "PubMed", "id": "29242231", "url": "https://glygen.org/publication/PubMed/29242231" } ] }, { "title": "Common fibrillar spines of amyloid-beta and human islet amyloid polypeptide revealed by microelectron diffraction and structure-based inhibitors.", "journal": "J. Biol. Chem.", "date": "2018", "authors": "Krotee Pascal, Griner Sarah L, Sawaya Michael R, Cascio Duilio, Rodriguez Jose A, Shi Dan, Philipp Stephan, Murray Kevin, Saelices Lorena, Lee Ji, Seidler Paul, Glabe Charles G, Jiang Lin, Gonen Tamir, Eisenberg David S", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "29282295", "url": "https://glygen.org/publication/PubMed/29282295" } ] }, { "title": "Amyloid beta protein gene: cDNA, mRNA distribution, and genetic linkage near the Alzheimer locus.", "journal": "Science", "date": "1987", "authors": "Tanzi R E, Gusella J F, Watkins P C, Bruns G A, St George-Hyslop P, Van Keuren M L, Patterson D, Pagan S, Kurnit D M, Neve R L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "2949367", "url": "https://glygen.org/publication/PubMed/2949367" } ] }, { "title": "Hsp90 inhibition as a means to inhibit activation of the NLRP3 inflammasome.", "journal": "Scientific reports", "date": "2018", "authors": "Piippo N, Korhonen E, Hytti M, Skottman H, Kinnunen K, Josifovska N, Petrovski G, Kaarniranta K, Kauppinen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "29712950", "url": "https://glygen.org/publication/PubMed/29712950" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "Molecular cloning and characterization of a cDNA encoding the cerebrovascular and the neuritic plaque amyloid peptides.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Robakis N K, Ramakrishna N, Wolfe G, Wisniewski H M", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "3035574", "url": "https://glygen.org/publication/PubMed/3035574" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P05067", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Recognition of the amyloid precursor protein by human gamma-secretase.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Zhou R, Yang G, Guo X, Zhou Q, Lei J, Shi Y", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "30630874", "url": "https://glygen.org/publication/PubMed/30630874" } ] }, { "title": "Disulfide engineering of human Kunitz-type serine protease inhibitors enhances proteolytic stability and target affinity toward mesotrypsin.", "journal": "J. Biol. Chem.", "date": "2019", "authors": "Cohen Itay, Coban Matt, Shahar Anat, Sankaran Banumathi, Hockla Alexandra, Lacham Shiran, Caulfield Thomas R, Radisky Evette S, Papo Niv", "evidence": [ { "database": "UniProtKB", "id": "H7C0V9", "url": "https://www.uniprot.org/uniprot/H7C0V9" } ], "reference": [ { "type": "PubMed", "id": "30700553", "url": "https://glygen.org/publication/PubMed/30700553" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "A cDNA specifying the human amyloid beta precursor protein (ABPP) encodes a 95-kDa polypeptide.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Mita S, Sadlock J, Herbert J, Schon E A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "3140222", "url": "https://glygen.org/publication/PubMed/3140222" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "Amyloid angiopathy of Alzheimer's disease: amino acid composition and partial sequence of a 4,200-dalton peptide isolated from cortical microvessels.", "journal": "J. Neurochem.", "date": "1987", "authors": "Pardridge W M, Vinters H V, Yang J, Eisenberg J, Choi T B, Tourtellotte W W, Huebner V, Shively J E", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "3312495", "url": "https://glygen.org/publication/PubMed/3312495" } ] }, { "title": "Purification of protease nexin II from human fibroblasts.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Van Nostrand W E, Cunningham D D", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "3597385", "url": "https://glygen.org/publication/PubMed/3597385" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Characterization and chromosomal localization of a cDNA encoding brain amyloid of Alzheimer's disease.", "journal": "Science", "date": "1987", "authors": "Goldgaber D, Lerman M I, McBride O W, Saffiotti U, Gajdusek D C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "3810169", "url": "https://glygen.org/publication/PubMed/3810169" } ] }, { "title": "Age of onset predicted by A\u03b2 profiling in a novel PSEN1 (I180F) mutation.", "journal": "Neuroscience letters", "date": "2024-01-18", "authors": "Robbie Leah, Fern\u00e1ndez Sara Guti\u00e9rrez, Montoya Lucy, Sagare Abhay, Barrera Lilibeth, Sheikh-Bahaei Nasim, Gutierrez Lucia Chavez, Ringman John M", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ], "reference": [ { "type": "PubMed", "id": "38103630", "url": "https://glygen.org/publication/PubMed/38103630" } ] }, { "title": "Potentially Pathogenic SORL1 Mutations Observed in Autosomal-Dominant Cases of Alzheimer's Disease Do Not Modulate APP Physiopathological Processing.", "journal": "Cells", "date": "2023-12-08", "authors": "Bauer Charlotte, Duplan Eric, Saint-George-Hyslop Peter, Checler Fr\u00e9d\u00e9ric", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ], "reference": [ { "type": "PubMed", "id": "38132122", "url": "https://glygen.org/publication/PubMed/38132122" } ] }, { "title": "Proteolytic cleavage of amyloid precursor protein by ADAM10 promotes proliferation and migration via activating MAPKs pathway in tongue squamous cell carcinoma in vitro.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2023-12-10", "authors": "Hong Yanqing, Wei Zhuliang, Wang Yunzhi", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ], "reference": [ { "type": "PubMed", "id": "38158671", "url": "https://glygen.org/publication/PubMed/38158671" } ] }, { "title": "Interaction Between Arteriosclerosis and Amyloid-\u03b2 on Cognitive Function.", "journal": "Journal of Alzheimer's disease : JAD", "date": "2024", "authors": "Frentz Ingeborg, van Arendonk Joyce, Leeuwis Anna E, Vernooij Meike W, van der Flier Wiesje M, Bos Daniel, De Deyn Peter Paul, Wolters Frank J, Ikram M Arfan", "evidence": [ { "database": "RefSeq", "id": "NP_000475", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000475" } ], "reference": [ { "type": "PubMed", "id": "38217596", "url": "https://glygen.org/publication/PubMed/38217596" } ] }, { "title": "ATP induces nucleotide permeability in rat mast cells.", "journal": "Nature", "date": "1979", "authors": "Cockcroft S, Gomperts BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "450099", "url": "https://glygen.org/publication/PubMed/450099" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Solution structure of residues 1-28 of the amyloid beta-peptide.", "journal": "Biochemistry", "date": "1994", "authors": "Talafous J, Marcinowski K J, Klopman G, Zagorski M G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "7516706", "url": "https://glygen.org/publication/PubMed/7516706" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Structure of amyloid A4-(1-40)-peptide of Alzheimer's disease.", "journal": "Eur. J. Biochem.", "date": "1995", "authors": "Sticht H, Bayer P, Willbold D, Dames S, Hilbich C, Beyreuther K, Frank R W, R\u00f6sch P", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "7588758", "url": "https://glygen.org/publication/PubMed/7588758" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Preference of calcium-dependent interactions between calmodulin-like domains of calpain and calpastatin subdomains.", "journal": "FEBS letters", "date": "1995", "authors": "Takano E, Ma H, Yang HQ, Maki M, Hatanaka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "7698360", "url": "https://glygen.org/publication/PubMed/7698360" } ] }, { "title": "The chondroitin sulfate attachment site of appican is formed by splicing out exon 15 of the amyloid precursor gene.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Pangalos MN, Efthimiopoulos S, Shioi J, Robakis NK", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "7737970", "url": "https://glygen.org/publication/PubMed/7737970" } ] }, { "title": "N-linked oligosaccharide of beta-amyloid precursor protein (beta APP) of C6 glioma cells: putative regulatory role in beta APP processing.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Saito F, Tani A, Miyatake T, Yanagisawa K", "evidence": [ { "database": "GlyConnect", "id": "49", "url": "https://glyconnect.expasy.org/browser/proteins/49" } ], "reference": [ { "type": "PubMed", "id": "7763244", "url": "https://glygen.org/publication/PubMed/7763244" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "The beta A4 amyloid precursor protein binding to copper.", "journal": "FEBS letters", "date": "1994", "authors": "Hesse L, Beher D, Masters CL, Multhaup G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "7913895", "url": "https://glygen.org/publication/PubMed/7913895" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Human taste cells express the G protein alpha-gustducin and neuron-specific enolase.", "journal": "Brain research. Molecular brain research", "date": "1994", "authors": "Takami S, Getchell TV, McLaughlin SK, Margolskee RF, Getchell ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8015379", "url": "https://glygen.org/publication/PubMed/8015379" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "The amino acid sequence of neuritic plaque amyloid from a familial Alzheimer's disease patient.", "journal": "Ann. Neurol.", "date": "1994", "authors": "Wisniewski T, Lalowski M, Levy E, Marques M R, Frangione B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8109908", "url": "https://glygen.org/publication/PubMed/8109908" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "Cell cycle-dependent regulation of the phosphorylation and metabolism of the Alzheimer amyloid precursor protein.", "journal": "The EMBO journal", "date": "1994", "authors": "Suzuki T, Oishi M, Marshak DR, Czernik AJ, Nairn AC, Greengard P", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "8131745", "url": "https://glygen.org/publication/PubMed/8131745" } ] }, { "title": "Novel amyloid precursor protein gene mutation (codon 665Asp) in a patient with late-onset Alzheimer's disease.", "journal": "Annals of neurology", "date": "1994", "authors": "Peacock ML, Murman DL, Sima AA, Warren JT Jr, Roses AD, Fink JK", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8154870", "url": "https://glygen.org/publication/PubMed/8154870" } ] }, { "title": "A heparin-binding domain in the amyloid protein precursor of Alzheimer's disease is involved in the regulation of neurite outgrowth.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1994", "authors": "Small DH, Nurcombe V, Reed G, Clarris H, Moir R, Beyreuther K, Masters CL", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8158260", "url": "https://glygen.org/publication/PubMed/8158260" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Characterization of beta-amyloid peptide from human cerebrospinal fluid.", "journal": "J. Neurochem.", "date": "1993", "authors": "Vigo-Pelfrey C, Lee D, Keim P, Lieberburg I, Schenk D B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8229004", "url": "https://glygen.org/publication/PubMed/8229004" } ] }, { "title": "Beta-amyloid-(1-42) is a major component of cerebrovascular amyloid deposits: implications for the pathology of Alzheimer disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Roher A E, Lowenson J D, Clarke S, Woods A S, Cotter R J, Gowing E, Ball M J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8248178", "url": "https://glygen.org/publication/PubMed/8248178" } ] }, { "title": "Characterization of amyloid fibril beta-peptide in familial Alzheimer's disease with APP717 mutations.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Liepnieks JJ, Ghetti B, Farlow M, Roses AD, Benson MD", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8267572", "url": "https://glygen.org/publication/PubMed/8267572" } ] }, { "title": "Clinical characteristics in a kindred with early-onset Alzheimer's disease and their linkage to a G-->T change at position 2149 of the amyloid precursor protein gene.", "journal": "Neurology", "date": "1994", "authors": "Farlow M, Murrell J, Ghetti B, Unverzagt F, Zeldenrust S, Benson M", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8290042", "url": "https://glygen.org/publication/PubMed/8290042" } ] }, { "title": "A novel zinc(II) binding site modulates the function of the beta A4 amyloid protein precursor of Alzheimer's disease.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Bush A I, Multhaup G, Moir R D, Williamson T G, Small D H, Rumble B, Pollwein P, Beyreuther K, Masters C L", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8344894", "url": "https://glygen.org/publication/PubMed/8344894" } ] }, { "title": "Alteration of clathrin light chain expression by transfection and gene disruption.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Acton SL, Wong DH, Parham P, Brodsky FM, Jackson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8374173", "url": "https://glygen.org/publication/PubMed/8374173" } ] }, { "title": "Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2).", "journal": "Genomics", "date": "1993", "authors": "Morris TA, Fong SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8406495", "url": "https://glygen.org/publication/PubMed/8406495" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Alzheimer amyloid protein precursor complexes with brain GTP-binding protein G(o).", "journal": "Nature", "date": "1993", "authors": "Nishimoto I, Okamoto T, Matsuura Y, Takahashi S, Okamoto T, Murayama Y, Ogata E", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8446172", "url": "https://glygen.org/publication/PubMed/8446172" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "A system for studying the effect(s) of familial Alzheimer disease mutations on the processing of the beta-amyloid peptide precursor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Denman RB, Rosenzcwaig R, Miller DL", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8476439", "url": "https://glygen.org/publication/PubMed/8476439" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "Identification of galectin-3 as a high-affinity binding protein for advanced glycation end products (AGE): a new member of the AGE-receptor complex.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "1995", "authors": "Vlassara H, Li YM, Imani F, Wojciechowicz D, Yang Z, Liu FT, Cerami A", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "8529130", "url": "https://glygen.org/publication/PubMed/8529130" } ] }, { "title": "Regulation of amyloid protein precursor (APP) binding to collagen and mapping of the binding sites on APP and collagen type I.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Beher D, Hesse L, Masters C L, Multhaup G", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8576160", "url": "https://glygen.org/publication/PubMed/8576160" } ] }, { "title": "A mutation in codon 717 of the amyloid precursor protein gene in an Australian family with Alzheimer's disease.", "journal": "Neuroscience letters", "date": "1995", "authors": "Brooks WS, Martins RN, De Voecht J, Nicholson GA, Schofield PR, Kwok JB, Fisher C, Yeung LU, Van Broeckhoven C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8577393", "url": "https://glygen.org/publication/PubMed/8577393" } ] }, { "title": "APP-BP1, a novel protein that binds to the carboxyl-terminal region of the amyloid precursor protein.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Chow N, Korenberg JR, Chen XN, Neve RL", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8626687", "url": "https://glygen.org/publication/PubMed/8626687" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Dynamin II binds to the trans-Golgi network.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Maier O, Knoblich M, Westermann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "8670264", "url": "https://glygen.org/publication/PubMed/8670264" } ] }, { "title": "In vitro phosphorylation of the cytoplasmic domain of the amyloid precursor protein by glycogen synthase kinase-3beta.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Aplin AE, Gibb GM, Jacobsen JS, Gallo JM, Anderton BH", "evidence": [ { "database": "iPTMnet", "id": "P05067-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067-1" } ], "reference": [ { "type": "PubMed", "id": "8764598", "url": "https://glygen.org/publication/PubMed/8764598" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Association of a novel human FE65-like protein with the cytoplasmic domain of the amyloid-beta precursor protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Gu\u00e9nette S Y, Chen J, Jondro P D, Tanzi R E", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8855266", "url": "https://glygen.org/publication/PubMed/8855266" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "Familial Alzheimer's disease-linked mutations at Val717 of amyloid precursor protein are specific for the increased secretion of A beta 42(43).", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Maruyama K, Tomita T, Shinozaki K, Kume H, Asada H, Saido TC, Ishiura S, Iwatsubo T, Obata K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8886002", "url": "https://glygen.org/publication/PubMed/8886002" } ] }, { "title": "The phosphotyrosine interaction domains of X11 and FE65 bind to distinct sites on the YENPTY motif of amyloid precursor protein.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Borg JP, Ooi J, Levy E, Margolis B", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8887653", "url": "https://glygen.org/publication/PubMed/8887653" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Three-dimensional structures of the amyloid beta peptide (25-35) in membrane-mimicking environment.", "journal": "Biochemistry", "date": "1996", "authors": "Kohno T, Kobayashi K, Maeda T, Sato K, Takashima A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "8973180", "url": "https://glygen.org/publication/PubMed/8973180" } ] }, { "title": "Ectodomain phosphorylation of beta-amyloid precursor protein at two distinct cellular locations.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Walter J, Capell A, Hung AY, Langen H, Schnolzer M, Thinakaran G, Sisodia SS, Selkoe DJ, Haass C", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Activation of the IkappaB alpha kinase complex by MEKK1, a kinase of the JNK pathway.", "journal": "Cell", "date": "1997", "authors": "Lee FS, Hagler J, Chen ZJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "9008162", "url": "https://glygen.org/publication/PubMed/9008162" } ] }, { "title": "Purinoceptor-operated cationic channels in human B lymphocytes.", "journal": "The Journal of physiology", "date": "1997", "authors": "Markwardt F, Lohn M, Bohm T, Klapperstuck M", "evidence": [ { "database": "Reactome", "id": "R-HSA-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456" } ], "reference": [ { "type": "PubMed", "id": "9023774", "url": "https://glygen.org/publication/PubMed/9023774" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "A novel method for making nested deletions and its application for sequencing of a 300 kb region of human APP locus.", "journal": "Nucleic Acids Res.", "date": "1997", "authors": "Hattori M, Tsukahara F, Furuhata Y, Tanahashi H, Hirose M, Saito M, Tsukuni S, Sakaki Y", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9108164", "url": "https://glygen.org/publication/PubMed/9108164" } ] }, { "title": "Phosphorylation of Alzheimer beta-amyloid precursor-like proteins.", "journal": "Biochemistry", "date": "1997", "authors": "Suzuki T, Ando K, Isohara T, Oishi M, Lim GS, Satoh Y, Wasco W, Tanzi RE, Nairn AC, Greengard P, Gandy SE, Kirino Y", "evidence": [ { "database": "iPTMnet", "id": "P05067", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05067" } ], "reference": [ { "type": "PubMed", "id": "9109675", "url": "https://glygen.org/publication/PubMed/9109675" } ] }, { "title": "Alzheimer's disease amyloid beta peptide 25-35 inhibits lipid peroxidation as a result of its membrane interactions.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Walter MF, Mason PE, Mason RP", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9168929", "url": "https://glygen.org/publication/PubMed/9168929" } ] }, { "title": "Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.", "journal": "Nature structural biology", "date": "1997", "authors": "Lin GD, Chattopadhyay D, Maki M, Wang KK, Carson M, Jin L, Yuen PW, Takano E, Hatanaka M, DeLucas LJ, Narayana SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "9228946", "url": "https://glygen.org/publication/PubMed/9228946" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Crystal structures of bovine chymotrypsin and trypsin complexed to the inhibitor domain of Alzheimer's amyloid beta-protein precursor (APPI) and basic pancreatic trypsin inhibitor (BPTI): engineering of inhibitors with altered specificities.", "journal": "Protein Sci.", "date": "1997", "authors": "Scheidig A J, Hynes T R, Pelletier L A, Wells J A, Kossiakoff A A", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9300481", "url": "https://glygen.org/publication/PubMed/9300481" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "A new pathogenic mutation in the APP gene (I716V) increases the relative proportion of A beta 42(43).", "journal": "Human molecular genetics", "date": "1997", "authors": "Eckman CB, Mehta ND, Crook R, Perez-tur J, Prihar G, Pfeiffer E, Graff-Radford N, Hinder P, Yager D, Zenk B, Refolo LM, Prada CM, Younkin SG, Hutton M, Hardy J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9328472", "url": "https://glygen.org/publication/PubMed/9328472" } ] }, { "title": "An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease.", "journal": "Nature", "date": "1997", "authors": "Yan SD, Fu J, Soto C, Chen X, Zhu H, Al-Mohanna F, Collison K, Zhu A, Stern E, Saido T, Tohyama M, Ogawa S, Roher A, Stern D", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9338779", "url": "https://glygen.org/publication/PubMed/9338779" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "Expression and analysis of heparin-binding regions of the amyloid precursor protein of Alzheimer's disease.", "journal": "FEBS Lett.", "date": "1997", "authors": "Mok S S, Sberna G, Heffernan D, Cappai R, Galatis D, Clarris H J, Sawyer W H, Beyreuther K, Masters C L, Small D H", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9357988", "url": "https://glygen.org/publication/PubMed/9357988" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Copper-binding amyloid precursor protein undergoes a site-specific fragmentation in the reduction of hydrogen peroxide.", "journal": "Biochemistry", "date": "1998", "authors": "Multhaup G, Ruppert T, Schlicksupp A, Hesse L, Bill E, Pipkorn R, Masters C L, Beyreuther K", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9585534", "url": "https://glygen.org/publication/PubMed/9585534" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "MEKK1 activates both IkappaB kinase alpha and IkappaB kinase beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Lee FS, Peters RT, Dang LC, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "9689078", "url": "https://glygen.org/publication/PubMed/9689078" } ] }, { "title": "Solution structure of amyloid beta-peptide(1-40) in a water-micelle environment. Is the membrane-spanning domain where we think it is?", "journal": "Biochemistry", "date": "1998", "authors": "Coles M, Bicknell W, Watson A A, Fairlie D P, Craik D J", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9693002", "url": "https://glygen.org/publication/PubMed/9693002" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "Identification and characterization of novel clathrin adaptor-related proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Takatsu H, Sakurai M, Shin HW, Murakami K, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-432720", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720" } ], "reference": [ { "type": "PubMed", "id": "9733768", "url": "https://glygen.org/publication/PubMed/9733768" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Presenile Alzheimer dementia characterized by amyloid angiopathy and large amyloid core type senile plaques in the APP 692Ala-->Gly mutation.", "journal": "Acta neuropathologica", "date": "1998", "authors": "Cras P, van Harskamp F, Hendriks L, Ceuterick C, van Duijn CM, Stefanko SZ, Hofman A, Kros JM, Van Broeckhoven C, Martin JJ", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9754958", "url": "https://glygen.org/publication/PubMed/9754958" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "PAT1, a microtubule-interacting protein, recognizes the basolateral sorting signal of amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Zheng P, Eastman J, Vande Pol S, Pimplikar SW", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9843960", "url": "https://glygen.org/publication/PubMed/9843960" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Structure of an IkappaBalpha/NF-kappaB complex.", "journal": "Cell", "date": "1998", "authors": "Jacobs MD, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "9865693", "url": "https://glygen.org/publication/PubMed/9865693" } ] }, { "title": "Interaction of a neuron-specific protein containing PDZ domains with Alzheimer's amyloid precursor protein.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Tomita S, Ozaki T, Taru H, Oguchi S, Takeda S, Yagi Y, Sakiyama S, Kirino Y, Suzuki T", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "reference": [ { "type": "PubMed", "id": "9890987", "url": "https://glygen.org/publication/PubMed/9890987" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:351", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:351", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-HSA-432720", "name": "Lysosome Vesicle Biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432720", "resource": "Reactome", "description": "Lysosome Vesicle Biogenesis" }, { "id": "R-HSA-444473", "name": "Formyl peptide receptors bind formyl peptides and many other ligands", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-444473", "resource": "Reactome", "description": "Formyl peptide receptors bind formyl peptides and many other ligands" }, { "id": "R-HSA-445989", "name": "TAK1-dependent IKK and NF-kappa-B activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "resource": "Reactome", "description": "TAK1-dependent IKK and NF-kappa-B activation" }, { "id": "R-HSA-844456", "name": "The NLRP3 inflammasome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-844456", "resource": "Reactome", "description": "The NLRP3 inflammasome" }, { "id": "R-HSA-879415", "name": "Advanced glycosylation endproduct receptor signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "resource": "Reactome", "description": "Advanced glycosylation endproduct receptor signaling" }, { "id": "R-HSA-8862803", "name": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "resource": "Reactome", "description": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-933542", "name": "TRAF6 mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "resource": "Reactome", "description": "TRAF6 mediated NF-kB activation" }, { "id": "R-HSA-9609523", "name": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609523", "resource": "Reactome", "description": "Insertion of tail-anchored proteins into the endoplasmic reticulum membrane" }, { "id": "R-HSA-9660826", "name": "Purinergic signaling in leishmaniasis infection", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826", "resource": "Reactome", "description": "Purinergic signaling in leishmaniasis infection" }, { "id": "R-HSA-977225", "name": "Amyloid fiber formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" } ], "orthologs": [ { "uniprot_canonical_ac": "P08592-1", "protein_name": "Amyloid-beta precursor protein", "gene_name": "App", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSIDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEAEDDEDVEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVSSQSLLKTTSEPLPQDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 770 }, "evidence": [ { "id": "45916688", "url": "http://www.informatics.jax.org/homology/45916688", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P12023-1", "protein_name": "Amyloid-beta precursor protein", "gene_name": "App", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN", "length": 770 }, "evidence": [ { "id": "45916688", "url": "http://www.informatics.jax.org/homology/45916688", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 41, "go_terms": [ { "name": "Golgi-associated vesicle", "id": "GO:0005798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005798", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "clathrin-coated pit", "id": "GO:0005905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005905", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "nuclear envelope lumen", "id": "GO:0005641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005641", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum", "id": "GO:0005790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005790", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cell-cell junction", "id": "GO:0005911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "COPII-coated ER to Golgi transport vesicle", "id": "GO:0030134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030134", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuromuscular junction", "id": "GO:0031594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031594", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "endosome lumen", "id": "GO:0031904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031904", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "trans-Golgi network membrane", "id": "GO:0032588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032588", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "ciliary rootlet", "id": "GO:0035253", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035253", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "dendritic spine", "id": "GO:0043197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "dendritic shaft", "id": "GO:0043198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043198", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "receptor complex", "id": "GO:0043235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "apical part of cell", "id": "GO:0045177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045177", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "spindle midzone", "id": "GO:0051233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051233", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "presynaptic active zone", "id": "GO:0048786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048786", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "synaptic vesicle", "id": "GO:0008021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008021", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "transition metal ion binding", "id": "GO:0046914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046914", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "signaling receptor activator activity", "id": "GO:0030546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030546", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "PTB domain binding", "id": "GO:0051425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051425", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 83, "go_terms": [ { "name": "endocytosis", "id": "GO:0006897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006897", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "microglial cell activation", "id": "GO:0001774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001774", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "suckling behavior", "id": "GO:0001967", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001967", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "astrocyte activation involved in immune response", "id": "GO:0002265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002265", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "mRNA polyadenylation", "id": "GO:0006378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006378", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of translation", "id": "GO:0006417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006417", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "intracellular copper ion homeostasis", "id": "GO:0006878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006878", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of epidermal growth factor-activated receptor activity", "id": "GO:0007176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007176", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "axonogenesis", "id": "GO:0007409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007409", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "learning or memory", "id": "GO:0007611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007611", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "learning", "id": "GO:0007612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007612", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "mating behavior", "id": "GO:0007617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007617", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "locomotory behavior", "id": "GO:0007626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007626", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "axo-dendritic transport", "id": "GO:0008088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008088", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "adult locomotory behavior", "id": "GO:0008344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008344", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "visual learning", "id": "GO:0008542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-threonine phosphorylation", "id": "GO:0010800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010800", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010971", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "microglia development", "id": "GO:0014005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014005", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "axon midline choice point recognition", "id": "GO:0016199", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016199", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuron remodeling", "id": "GO:0016322", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016322", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "dendrite development", "id": "GO:0016358", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016358", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "forebrain development", "id": "GO:0030900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030900", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of protein binding", "id": "GO:0032092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032092", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation", "id": "GO:0033138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033138", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "ionotropic glutamate receptor signaling pathway", "id": "GO:0035235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035235", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of multicellular organism growth", "id": "GO:0040014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040014", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "negative regulation of neuron differentiation", "id": "GO:0045665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045665", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of mitotic cell cycle", "id": "GO:0045931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045931", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "astrocyte activation", "id": "GO:0048143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048143", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of long-term neuronal synaptic plasticity", "id": "GO:0048169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048169", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "collateral sprouting in absence of injury", "id": "GO:0048669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048669", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of synapse structure or activity", "id": "GO:0050803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050803", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "synapse organization", "id": "GO:0050808", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050808", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuromuscular process controlling balance", "id": "GO:0050885", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050885", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cognition", "id": "GO:0050890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050890", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of DNA-binding transcription factor activity", "id": "GO:0051091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "synaptic assembly at neuromuscular junction", "id": "GO:0051124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051124", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of protein metabolic process", "id": "GO:0051247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051247", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuron apoptotic process", "id": "GO:0051402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051402", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum calcium ion homeostasis", "id": "GO:0051563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051563", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuron cellular homeostasis", "id": "GO:0070050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070050", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "modulation of excitatory postsynaptic potential", "id": "GO:0098815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098815", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "negative regulation of long-term synaptic potentiation", "id": "GO:1900272", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900272", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of long-term synaptic potentiation", "id": "GO:1900273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900273", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of non-canonical NF-kappaB signal transduction", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of amyloid fibril formation", "id": "GO:1905908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905908", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "amyloid fibril formation", "id": "GO:1990000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990000", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "neuron projection maintenance", "id": "GO:1990535", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990535", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of NMDA receptor activity", "id": "GO:2000310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000310", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of T cell migration", "id": "GO:2000406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000406", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "G2/M transition of mitotic cell cycle", "id": "GO:0000086", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000086", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of chemokine production", "id": "GO:0032722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050730", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of calcium-mediated signaling", "id": "GO:0050850", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050850", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of glycolytic process", "id": "GO:0045821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045821", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of Wnt signaling pathway", "id": "GO:0030111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030111", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "response to interleukin-1", "id": "GO:0070555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070555", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of spontaneous synaptic transmission", "id": "GO:0150003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150003", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "regulation of presynapse assembly", "id": "GO:1905606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905606", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" }, { "name": "cytoplasmic polyadenylation", "id": "GO:0180011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0180011", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "amyloid-beta precursor protein O-glycosylated 1 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Ser-370 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P05067-1, Ser-370, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053414", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053414" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 2 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-22 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P05067-1, Thr-22, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053415", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053415" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 3 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-366 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P05067-1, Thr-366, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053416", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053416" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 4 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-366 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P05067-1, Thr-366, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053417", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053417" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 5 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-366 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P05067-1, Thr-366, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053418", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053418" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 6 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-367 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P05067-1, Thr-367, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053419", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053419" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 7 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-371 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P05067-1, Thr-371, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053420", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053420" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 8 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-652 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P05067-1, Thr-652, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053421", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053421" } ] }, { "name": "amyloid-beta precursor protein O-glycosylated 9 (human)", "definition": "An amyloid-beta precursor protein (human) that has been O-glycosylated at the residue equivalent to Thr-659 of the amino acid sequence represented by UniProtKB:P05067-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P05067-1, Thr-659, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053422", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053422" } ] } ], "site_annotation": [ { "start_pos": 542, "end_pos": 544, "annotation": "n_glycosylation_sequon" }, { "start_pos": 571, "end_pos": 573, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated (PubMed:2900137). N- and O-glycosylated (PubMed:2649245). O-glycosylation on Ser and Thr residues with core 1 or possibly core 8 glycans. Partial tyrosine glycosylation (Tyr-681) is found on some minor, short amyloid-beta peptides (amyloid-beta 1-15, 1-16, 1-17, 1-18, 1-19 and 1-20) but not found on amyloid-beta protein 38, amyloid-beta protein 40 nor on amyloid-beta protein 42. Modification on a tyrosine is unusual and is more prevelant in AD patients. Glycans had Neu5AcHex(Neu5Ac)HexNAc-O-Tyr, Neu5AcNeu5AcHex(Neu5Ac)HexNAc-O-Tyr and O-AcNeu5AcNeu5AcHex(Neu5Ac)HexNAc-O-Tyr structures, where O-Ac is O-acetylation of Neu5Ac. Neu5AcNeu5Ac is most likely Neu5Ac 2,8Neu5Ac linked. O-glycosylations in the vicinity of the cleavage sites may influence the proteolytic processing. Appicans are L-APP isoforms with O-linked chondroitin sulfate.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "22576872", "url": "https://glygen.org/publication/PubMed/22576872" }, { "database": "PubMed", "id": "21712440", "url": "https://glygen.org/publication/PubMed/21712440" }, { "database": "PubMed", "id": "2900137", "url": "https://glygen.org/publication/PubMed/2900137" }, { "database": "PubMed", "id": "2649245", "url": "https://glygen.org/publication/PubMed/2649245" } ] }, { "annotation": "Phosphorylation in the C-terminal on tyrosine, threonine and serine residues is neuron-specific (PubMed:10341243). Phosphorylation can affect APP processing, neuronal differentiation and interaction with other proteins (PubMed:10341243). Phosphorylated on Thr-743 in neuronal cells by Cdc5 kinase and Mapk10, in dividing cells by Cdc2 kinase in a cell-cycle dependent manner with maximal levels at the G2/M phase and, in vitro, by GSK-3-beta (PubMed:8131745, PubMed:11146006). The Thr-743 phosphorylated form causes a conformational change which reduces binding of Fe65 family members (PubMed:11517218). In dopaminergic (DA) neurons, phosphorylation on Thr-743 by LRKK2 promotes the production and the nuclear translocation of the APP intracellular domain (AICD) which induces DA neuron apoptosis (PubMed:28720718). Phosphorylation on Tyr-757 is required for SHC binding (PubMed:11877420). Phosphorylated in the extracellular domain by casein kinases on both soluble and membrane-bound APP. This phosphorylation is inhibited by heparin (PubMed:8999878).", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "8999878", "url": "https://glygen.org/publication/PubMed/8999878" }, { "database": "PubMed", "id": "11146006", "url": "https://glygen.org/publication/PubMed/11146006" }, { "database": "PubMed", "id": "10341243", "url": "https://glygen.org/publication/PubMed/10341243" }, { "database": "PubMed", "id": "11877420", "url": "https://glygen.org/publication/PubMed/11877420" }, { "database": "PubMed", "id": "11517218", "url": "https://glygen.org/publication/PubMed/11517218" }, { "database": "PubMed", "id": "28720718", "url": "https://glygen.org/publication/PubMed/28720718" }, { "database": "PubMed", "id": "8131745", "url": "https://glygen.org/publication/PubMed/8131745" } ] }, { "annotation": "Proteolytically cleaved by caspases during neuronal apoptosis. Cleavage at Asp-739 by either CASP6, CASP8 or CASP9 results in the production of the neurotoxic C31 peptide and the increased production of amyloid-beta peptides.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10319819", "url": "https://glygen.org/publication/PubMed/10319819" } ] }, { "annotation": "Proteolytically processed under normal cellular conditions. Cleavage either by alpha-secretase, beta-secretase or theta-secretase leads to generation and extracellular release of soluble APP peptides, S-APP-alpha and S-APP-beta, and the retention of corresponding membrane-anchored C-terminal fragments, C80, C83 and C99. Subsequent processing of C80 and C83 by gamma-secretase yields P3 peptides. This is the major secretory pathway and is non-amyloidogenic. Alternatively, presenilin/nicastrin-mediated gamma-secretase processing of C99 releases the amyloid-beta proteins, amyloid-beta protein 40 and amyloid-beta protein 42, major components of amyloid plaques, and the cytotoxic C-terminal fragments, gamma-CTF(50), gamma-CTF(57) and gamma-CTF(59). PSEN1 cleavage is more efficient with C83 than with C99 as substrate (in vitro) (PubMed:30630874). Amyloid-beta protein 40 and Amyloid-beta protein 42 are cleaved by ACE (PubMed:11604391, PubMed:16154999). Many other minor amyloid-beta peptides, amyloid-beta 1-X peptides, are found in cerebral spinal fluid (CSF) including the amyloid-beta X-15 peptides, produced from the cleavage by alpha-secretase and all terminating at Gln-686.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "10656250", "url": "https://glygen.org/publication/PubMed/10656250" }, { "database": "PubMed", "id": "11604391", "url": "https://glygen.org/publication/PubMed/11604391" }, { "database": "PubMed", "id": "30630874", "url": "https://glygen.org/publication/PubMed/30630874" }, { "database": "PubMed", "id": "16154999", "url": "https://glygen.org/publication/PubMed/16154999" } ] }, { "annotation": "Sulfated on tyrosine residues.", "evidence": [ { "database": "UniProtKB", "id": "P05067", "url": "https://www.uniprot.org/uniprot/P05067" }, { "database": "PubMed", "id": "2649245", "url": "https://glygen.org/publication/PubMed/2649245" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 542, 571 ], "o_linked_sites": [ 22, 107, 276, 279, 280, 352, 353, 360, 364, 366, 367, 370, 371, 378, 381, 586, 600, 633, 649, 651, 652, 656, 659, 663, 667, 679, 681 ], "snv_sites": [ 280, 556, 571, 600, 652 ], "glycation_sites": [], "phosphorylation_sites": [ 198, 206, 441, 497, 729, 730, 743, 757, 762 ], "sequon_annotation_sites": [ { "start_pos": 542, "end_pos": 544 }, { "start_pos": 571, "end_pos": 573 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 56 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 31 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 45 }, { "field": "total_sites", "count": 22 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 22 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 492 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }