{ "uniprot_canonical_ac": "P04844-1", "uniprot_ac": "P04844", "uniprot_id": "RPN2_HUMAN", "mass": { "chemical_mass": 69284.0, "monoisotopic_mass": 69284.0 }, "refseq": { "ac": "NP_001129243", "name": "dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 isoform 2 precursor", "summary": "This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, "gene_names": [ { "name": "RPN2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04844", "id": "P04844" }, { "name": "RIBIIR; RPN-II; RPNII; SWP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243", "id": "NP_001129243" }, { "name": "RPN2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243", "id": "NP_001129243" } ], "protein_names": [ { "name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04844" }, { "name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04844" }, { "name": "RIBIIR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04844" }, { "name": "RPN-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04844" }, { "name": "Ribophorin II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04844" }, { "name": "Ribophorin-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04844" }, { "name": "dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; ribophorin-2; oligosaccharyltransferase complex subunit (non-catalytic)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243", "id": "NP_001129243" }, { "name": "dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243", "id": "NP_001129243" } ], "function": [ { "annotation": "Epigenetically-regulated RPN2 gene influences lymphocyte activation and is involved in pathogenesis of rheumatoid arthritis.", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, { "database": "PubMed", "id": "34740730", "url": "https://glygen.org/publication/PubMed/34740730" } ] }, { "annotation": "RPN2 in cancer: An overview. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, { "database": "PubMed", "id": "36621657", "url": "https://glygen.org/publication/PubMed/36621657" } ] }, { "annotation": "Ribophorin II promotes the epithelial-mesenchymal transition and aerobic glycolysis of laryngeal squamous cell carcinoma via regulating reactive oxygen species-mediated Phosphatidylinositol-3-Kinase/Protein Kinase B activation.", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, { "database": "PubMed", "id": "35156537", "url": "https://glygen.org/publication/PubMed/35156537" } ] }, { "annotation": "Sevoflurane represses the progression of glioma by the regulation of circ_0037655/miR-130a-5p/RPN2 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, { "database": "PubMed", "id": "35032276", "url": "https://glygen.org/publication/PubMed/35032276" } ] }, { "annotation": "Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5JYR7", "url": "https://www.uniprot.org/uniprot/Q5JYR7#function" }, { "database": "UniProtKB", "id": "RU366029", "url": "https://www.uniprot.org/uniprot/RU366029#function" }, { "database": "UniProtKB", "id": "Q5JYR4", "url": "https://www.uniprot.org/uniprot/Q5JYR4#function" }, { "database": "UniProtKB", "id": "Q5JYR3", "url": "https://www.uniprot.org/uniprot/Q5JYR3#function" }, { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844#function" }, { "database": "UniProtKB", "id": "F1PCT7", "url": "https://www.uniprot.org/uniprot/F1PCT7#function" }, { "database": "PubMed", "id": "31831667", "url": "https://glygen.org/publication/PubMed/31831667" }, { "database": "UniProtKB", "id": "H0Y5M1", "url": "https://www.uniprot.org/uniprot/H0Y5M1#function" }, { "database": "UniProtKB", "id": "A0A994J5J1", "url": "https://www.uniprot.org/uniprot/A0A994J5J1#function" } ] }, { "annotation": "The N(6)-methyladenosine-mediated lncRNA WEE2-AS1 promotes glioblastoma progression by stabilizing RPN2. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" }, { "database": "PubMed", "id": "36168628", "url": "https://glygen.org/publication/PubMed/36168628" } ] }, { "annotation": "This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1432272299", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1432272299" }, { "id": "rs1432272299", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1432272299#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 106, "end_pos": 106, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "20", "chr_pos": "37199063", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N106", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745715557", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745715557" }, { "id": "rs745715557", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745715557" }, { "id": "rs745715557", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745715557" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 108, "end_pos": 108, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEA).", "chr_id": "20", "chr_pos": "37199068", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T108", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371734476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371734476" }, { "id": "rs371734476", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371734476" }, { "id": "rs371734476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371734476#frequency_tab" }, { "id": "rs371734476", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371734476" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 312, "end_pos": 312, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "20", "chr_pos": "37210114", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S312", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371734476", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371734476" }, { "id": "rs371734476", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371734476" }, { "id": "rs371734476", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371734476#frequency_tab" }, { "id": "rs371734476", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371734476" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 312, "end_pos": 312, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "20", "chr_pos": "37210114", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S312", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04844", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04844" }, { "id": "rs1244440111", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244440111" }, { "id": "rs1244440111", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1244440111" }, { "id": "rs1244440111", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1244440111" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 340, "end_pos": 340, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KFS->NFS).", "chr_id": "20", "chr_pos": "37213793", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K340", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs746304941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746304941" }, { "id": "rs746304941", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746304941" }, { "id": "rs746304941", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746304941#frequency_tab" }, { "id": "rs746304941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746304941" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 340, "end_pos": 340, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVK->NVT).", "chr_id": "20", "chr_pos": "37213792", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K340", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1300042975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1300042975" }, { "id": "rs1300042975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1300042975" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 403, "end_pos": 403, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KGT->NGT).", "chr_id": "20", "chr_pos": "37225712", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K403", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04844", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04844" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 432, "end_pos": 432, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "H", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (HQT->NQT).", "chr_id": "20", "chr_pos": "37225797", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "H432", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1315648723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1315648723" }, { "id": "rs1315648723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1315648723" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 457, "end_pos": 457, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKN->NKS).", "chr_id": "20", "chr_pos": "37228620", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N457", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04844", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04844" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 521, "end_pos": 521, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "20", "chr_pos": "37230039", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T521", "disease": [ { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1307782660", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1307782660" }, { "id": "rs1307782660", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1307782660#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 521, "end_pos": 521, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "20", "chr_pos": "37230040", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T521", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767898174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767898174" }, { "id": "rs767898174", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767898174" }, { "id": "rs767898174", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767898174" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 54, "end_pos": 54, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "20", "chr_pos": "37184327", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S54", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775307113", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775307113" }, { "id": "rs775307113", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775307113" }, { "id": "rs775307113", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775307113" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 611, "end_pos": 611, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "20", "chr_pos": "37236658", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S611", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1327893629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1327893629" }, { "id": "rs1327893629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1327893629#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "20", "chr_pos": "37198419", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S77", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "96.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04844" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "common_name": "Human" } ], "gene": [ { "name": "RPN2", "url": "https://www.uniprot.org/uniprot/P04844", "locus": { "chromosome": "20", "start_pos": 37241619, "end_pos": 37178410, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000118705", "url": "https://www.ensembl.org/id/ENSG00000118705" } ] } } ], "crossref": [ { "id": "ENSG00000118705", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118705", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P04844", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04844", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.4.99.18", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.99.18&UniProtAcc=P04844", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "RPN2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RPN2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6185", "url": "https://www.ncbi.nlm.nih.gov/gene/6185", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1187", "url": "https://glyconnect.expasy.org/browser/proteins/1187", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "10382", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10382", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04844", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04844*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q5JYR7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q5JYR7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008814", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008814", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6185", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6185", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "180490", "url": "http://www.omim.org/entry/180490", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04844", "url": "https://www.nextprot.org/entry/NX_P04844", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P04844", "url": "https://oglcnac.org/atlas/detail/P04844", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DGVYKQK", "url": "https://omabrowser.org/oma/group/DGVYKQK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2877438at2759", "url": "http://www.orthodb.org/?query=2877438at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12640", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12640", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12640:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12640:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6S7O", "url": "https://www.rcsb.org/structure/6S7O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S7T", "url": "https://www.rcsb.org/structure/6S7T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8B6L", "url": "https://www.rcsb.org/structure/8B6L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05817", "url": "http://pfam.xfam.org/family/PF05817", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04844", "url": "https://pharos.nih.gov/targets/P04844", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04844", "url": "http://purl.obolibrary.org/obo/PR_P04844", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04844", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A994J5J1", "url": "https://www.uniprot.org/uniprot/A0A994J5J1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A994J5J1-1", "url": "https://www.uniprot.org/uniprot/A0A994J5J1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5M1", "url": "https://www.uniprot.org/uniprot/H0Y5M1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5M1-1", "url": "https://www.uniprot.org/uniprot/H0Y5M1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04844-1", "url": "https://www.uniprot.org/uniprot/P04844-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04844-2", "url": "https://www.uniprot.org/uniprot/P04844-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR3", "url": "https://www.uniprot.org/uniprot/Q5JYR3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR3-1", "url": "https://www.uniprot.org/uniprot/Q5JYR3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR4", "url": "https://www.uniprot.org/uniprot/Q5JYR4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR4-1", "url": "https://www.uniprot.org/uniprot/Q5JYR4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR7", "url": "https://www.uniprot.org/uniprot/Q5JYR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JYR7-1", "url": "https://www.uniprot.org/uniprot/Q5JYR7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTAH", "length": 631, "header": "sp|P04844-1|RPN2_HUMAN Isoform 1 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3 CANONICAL=P04844-1" }, "isoforms": [ { "isoform_ac": "A0A994J5J1-1", "url": "", "sequence": { "sequence": "MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRIAAEQSSRLAKYRTLRTLVPEERWKF", "length": 654, "header": "tr|A0A994J5J1-1|A0A994J5J1_HUMAN Computationally mapped isoform of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=1 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37241338, "end_pos": 37179357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000705448.1", "url": "https://www.ensembl.org/id/ENST00000705448.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516126.1", "url": "https://www.ensembl.org/id/ENSP00000516126.1" } ] } }, { "isoform_ac": "H0Y5M1-1", "url": "", "sequence": { "sequence": "XGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAEQHISSRRKMEILKTECQEKESRTIHSMRRKMEKKNFI", "length": 147, "header": "tr|H0Y5M1-1|H0Y5M1_HUMAN Computationally mapped isoform of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=1 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37241417, "end_pos": 37228678, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000456400.1", "url": "https://www.ensembl.org/id/ENST00000456400.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000399404.1", "url": "https://www.ensembl.org/id/ENSP00000399404.1" } ] } }, { "isoform_ac": "P04844-1", "url": "", "sequence": { "sequence": "MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTAH", "length": 631, "header": "sp|P04844-1|RPN2_HUMAN Isoform 1 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37241312, "end_pos": 37179357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000237530.11", "url": "https://www.ensembl.org/id/ENST00000237530.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000237530.6", "url": "https://www.ensembl.org/id/ENSP00000237530.6" } ] } }, { "isoform_ac": "P04844-2", "url": "", "sequence": { "sequence": "MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRIAAEQSSRLAKYRTLRTAH", "length": 615, "header": "sp|P04844-2|RPN2_HUMAN Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37241312, "end_pos": 37179357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373622.9", "url": "https://www.ensembl.org/id/ENST00000373622.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000362724.5", "url": "https://www.ensembl.org/id/ENSP00000362724.5" } ] } }, { "isoform_ac": "Q5JYR3-1", "url": "", "sequence": { "sequence": "ELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKRTAH", "length": 138, "header": "tr|Q5JYR3-1|RPN2_HUMAN Computationally mapped isoform of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=1 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37241312, "end_pos": 37228634, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437329.5", "url": "https://www.ensembl.org/id/ENST00000437329.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000409580.1", "url": "https://www.ensembl.org/id/ENSP00000409580.1" } ] } }, { "isoform_ac": "Q5JYR4-1", "url": "", "sequence": { "sequence": "MQRTVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKT", "length": 166, "header": "tr|Q5JYR4-1|RPN2_HUMAN Computationally mapped isoform of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=8 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37210148, "end_pos": 37184366, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000456102.5", "url": "https://www.ensembl.org/id/ENST00000456102.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000399137.1", "url": "https://www.ensembl.org/id/ENSP00000399137.1" } ] } }, { "isoform_ac": "Q5JYR7-1", "url": "", "sequence": { "sequence": "MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLARVWSTVLESRSLFSKRTVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPV", "length": 344, "header": "tr|Q5JYR7-1|RPN2_HUMAN Computationally mapped isoform of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=8 CANONICAL=P04844-1" }, "locus": { "chromosome": "20", "start_pos": 37210163, "end_pos": 37179357, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000373632.8", "url": "https://www.ensembl.org/id/ENST00000373632.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000362735.4", "url": "https://www.ensembl.org/id/ENSP00000362735.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "1187", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1187" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "P04844", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P04844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04844#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 227, "start_aa": "Ser", "end_pos": 227, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser227", "evidence": [ { "id": "P04844", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 312, "start_aa": "Ser", "end_pos": 312, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser312", "evidence": [ { "id": "P04844", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P04844", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04844" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 315, "start_aa": "Ser", "end_pos": 315, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser315", "evidence": [ { "id": "P04844", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04844" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 521, "start_aa": "Thr", "end_pos": 521, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr521", "evidence": [ { "id": "P04844", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 54, "start_aa": "Ser", "end_pos": 54, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser54", "evidence": [ { "id": "P04844", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P04844", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04844" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 77, "start_aa": "Ser", "end_pos": 77, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser77", "evidence": [ { "id": "P04844", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04844" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] } ], "phosphorylation": [ { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04844" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr157" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P04844", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Oligosaccharyltransferase is highly specific for the hydroxy amino acid in Asn-Xaa-Thr/Ser.", "journal": "FEBS letters", "date": "2001", "authors": "Breuer W, Klein RA, Hardt B, Bartoschek A, Bause E", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "11470266", "url": "https://glygen.org/publication/PubMed/11470266" } ] }, { "title": "Endoplasmic reticulum-bound ribosomes reside in stable association with the translocon following termination of protein synthesis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Potter MD, Nicchitta CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "11964406", "url": "https://glygen.org/publication/PubMed/11964406" } ] }, { "title": "H2, the minor subunit of the human asialoglycoprotein receptor, trafficks intracellularly and forms homo-oligomers, but does not bind asialo-orosomucoid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Saxena A, Yik JH, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12089159", "url": "https://glygen.org/publication/PubMed/12089159" } ] }, { "title": "Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Yik JH, Saxena A, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12171918", "url": "https://glygen.org/publication/PubMed/12171918" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Molecular cloning, gene organization and expression of the human UDP-GalNAc:Neu5Acalpha2-3Galbeta-R beta1,4-N-acetylgalactosaminyltransferase responsible for the biosynthesis of the blood group Sda/Cad antigen: evidence for an unusual extended cytoplasmic domain.", "journal": "The Biochemical journal", "date": "2003", "authors": "Montiel MD, Krzewinski-Recchi MA, Delannoy P, Harduin-Lepers A", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "12678917", "url": "https://glygen.org/publication/PubMed/12678917" } ] }, { "title": "Structure, function and evolution of the signal recognition particle.", "journal": "The EMBO journal", "date": "2003", "authors": "Nagai K, Oubridge C, Kuglstatter A, Menichelli E, Isel C, Jovine L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "12853463", "url": "https://glygen.org/publication/PubMed/12853463" } ] }, { "title": "Statistical analysis of the protein environment of N-glycosylation sites: implications for occupancy, structure, and folding.", "journal": "Glycobiology", "date": "2004", "authors": "Petrescu AJ, Milac AL, Petrescu SM, Dwek RA, Wormald MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "14514716", "url": "https://glygen.org/publication/PubMed/14514716" } ] }, { "title": "Molecular cloning of the human beta1,4 N-acetylgalactosaminyltransferase responsible for the biosynthesis of the Sd(a) histo-blood group antigen: the sequence predicts a very long cytoplasmic domain.", "journal": "Journal of biochemistry", "date": "2003", "authors": "Lo Presti L, Cabuy E, Chiricolo M, Dall'Olio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "14688233", "url": "https://glygen.org/publication/PubMed/14688233" } ] }, { "title": "An evolving view of the eukaryotic oligosaccharyltransferase.", "journal": "Glycobiology", "date": "2006", "authors": "Kelleher DJ, Gilmore R", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "16317064", "url": "https://glygen.org/publication/PubMed/16317064" } ] }, { "title": "Human autoantibodies against the 54 kDa protein of the signal recognition particle block function at multiple stages.", "journal": "Arthritis research & therapy", "date": "2006", "authors": "Romisch K, Miller FW, Dobberstein B, High S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "16469117", "url": "https://glygen.org/publication/PubMed/16469117" } ] }, { "title": "The expanding role of the ER translocon in membrane protein folding.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Skach WR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "18166647", "url": "https://glygen.org/publication/PubMed/18166647" } ] }, { "title": "SRP keeps polypeptides translocation-competent by slowing translation to match limiting ER-targeting sites.", "journal": "Cell", "date": "2008", "authors": "Lakkaraju AK, Mary C, Scherrer A, Johnson AE, Strub K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "18455985", "url": "https://glygen.org/publication/PubMed/18455985" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844#ptm_processing" }, { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Screening for OST deficiencies in unsolved CDG-I patients.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Vleugels W, Schollen E, Foulquier F, Matthijs G", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "19835842", "url": "https://glygen.org/publication/PubMed/19835842" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P04844-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04844-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Eukaryotic protein synthesis: still a mystery.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Merrick WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "20444697", "url": "https://glygen.org/publication/PubMed/20444697" } ] }, { "title": "Uromodulin facilitates neutrophil migration across renal epithelial monolayers.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2010", "authors": "Schmid M, Prajczer S, Gruber LN, Bertocchi C, Gandini R, Pfaller W, Jennings P, Joannidis M", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "20798515", "url": "https://glygen.org/publication/PubMed/20798515" } ] }, { "title": "Monitoring of S protein maturation in the endoplasmic reticulum by calnexin is important for the infectivity of severe acute respiratory syndrome coronavirus.", "journal": "Journal of virology", "date": "2012", "authors": "Fukushi M, Yoshinaka Y, Matsuoka Y, Hatakeyama S, Ishizaka Y, Kirikae T, Sasazuki T, Miyoshi-Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "22915798", "url": "https://glygen.org/publication/PubMed/22915798" } ] }, { "title": "OST4 is a subunit of the mammalian oligosaccharyltransferase required for efficient N-glycosylation.", "journal": "J. Cell Sci.", "date": "2013", "authors": "Dumax-Vorzet A, Roboti P, High S", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "23606741", "url": "https://glygen.org/publication/PubMed/23606741" } ] }, { "title": "The expanding roles of the Sd(a)/Cad carbohydrate antigen and its cognate glycosyltransferase B4GALNT2.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Dall'Olio F, Malagolini N, Chiricolo M, Trinchera M, Harduin-Lepers A", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "24112972", "url": "https://glygen.org/publication/PubMed/24112972" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.", "journal": "J. Cell Biol.", "date": "2014", "authors": "Cherepanova NA, Shrimal S, Gilmore R", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "25135935", "url": "https://glygen.org/publication/PubMed/25135935" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P04844", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "The H1 and H2 polypeptides associate to form the asialoglycoprotein receptor in human hepatoma cells.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Bischoff J, Libresco S, Shia MA, Lodish HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "2834401", "url": "https://glygen.org/publication/PubMed/2834401" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Removal of RTF2 from Stalled Replisomes Promotes Maintenance of Genome Integrity.", "journal": "Mol. Cell", "date": "2018", "authors": "Kottemann MC, Conti BA, Lach FP, Smogorzewska A", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "29290612", "url": "https://glygen.org/publication/PubMed/29290612" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" }, { "database": "O-GlcNAc Atlas", "id": "P04844", "url": "https://oglcnac.org/atlas/detail/P04844" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04844", "url": "" }, { "database": "GlyConnect", "id": "1187", "url": "https://glyconnect.expasy.org/browser/proteins/1187" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Human ribophorins I and II: the primary structure and membrane topology of two highly conserved rough endoplasmic reticulum-specific glycoproteins.", "journal": "EMBO J.", "date": "1987", "authors": "Crimaudo C, Hortsch M, Gausepohl H, Meyer DI", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "3034581", "url": "https://glygen.org/publication/PubMed/3034581" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.", "journal": "Science (New York, N.Y.)", "date": "2019-12-13", "authors": "Ram\u00edrez Ana S, Kowal Julia, Locher Kaspar P", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "reference": [ { "type": "PubMed", "id": "31831667", "url": "https://glygen.org/publication/PubMed/31831667" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2.", "journal": "Glycobiology", "date": "2020", "authors": "Shajahan A, Supekar NT, Gleinich AS, Azadi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "32363391", "url": "https://glygen.org/publication/PubMed/32363391" } ] }, { "title": "Site-specific glycan analysis of the SARS-CoV-2 spike.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Watanabe Y, Allen JD, Wrapp D, McLellan JS, Crispin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "32366695", "url": "https://glygen.org/publication/PubMed/32366695" } ] }, { "title": "Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: implications for vaccination and antibody therapeutics.", "journal": "Glycobiology", "date": "2020", "authors": "Zhou D, Tian X, Qi R, Peng C, Zhang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "32518941", "url": "https://glygen.org/publication/PubMed/32518941" } ] }, { "title": "N and O glycosylation of the SARS-CoV-2 spike protein.", "journal": "bioRxiv : the preprint server for biology", "date": "2020", "authors": "Sanda M, Morrison L, Goldman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "32676595", "url": "https://glygen.org/publication/PubMed/32676595" } ] }, { "title": "Spike glycoprotein and host cell determinants of SARS-CoV-2 entry and cytopathic effects.", "journal": "Journal of virology", "date": "2020", "authors": "Nguyen HT, Zhang S, Wang Q, Anang S, Wang J, Ding H, Kappes JC, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "33310888", "url": "https://glygen.org/publication/PubMed/33310888" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" }, { "database": "O-GlcNAc Atlas", "id": "P04844", "url": "https://oglcnac.org/atlas/detail/P04844" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Wu Z, Zhang Z, Wang X, Zhang J, Ren C, Li Y, Gao L, Liang X, Wang P, Ma C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "34117209", "url": "https://glygen.org/publication/PubMed/34117209" } ] }, { "title": "S-acylation of SARS-CoV-2 spike protein: Mechanistic dissection, in vitro reconstitution and role in viral infectivity.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Puthenveetil R, Lun CM, Murphy RE, Healy LB, Vilmen G, Christenson ET, Freed EO, Banerjee A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "34428449", "url": "https://glygen.org/publication/PubMed/34428449" } ] }, { "title": "Palmitoylation of SARS-CoV-2 S protein is critical for S-mediated syncytia formation and virus entry.", "journal": "Journal of medical virology", "date": "2022", "authors": "Li D, Liu Y, Lu Y, Gao S, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "34528721", "url": "https://glygen.org/publication/PubMed/34528721" } ] }, { "title": "S-acylation controls SARS-CoV-2 membrane lipid organization and enhances infectivity.", "journal": "Developmental cell", "date": "2021", "authors": "Mesquita FS, Abrami L, Sergeeva O, Turelli P, Qing E, Kunz B, Raclot C, Paz Montoya J, Abriata LA, Gallagher T, Dal Peraro M, Trono D, D'Angelo G, van der Goot FG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "34599882", "url": "https://glygen.org/publication/PubMed/34599882" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Epigenetically-regulated RPN2 gene influences lymphocyte activation and is involved in pathogenesis of rheumatoid arthritis.", "journal": "Gene", "date": "2022", "authors": "He P, Deng FY, Wang BH, Wu LF, Zhou X, Lei SF", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ], "reference": [ { "type": "PubMed", "id": "34740730", "url": "https://glygen.org/publication/PubMed/34740730" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P04844", "url": "https://oglcnac.org/atlas/detail/P04844" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "The interactions of ZDHHC5/GOLGA7 with SARS-CoV-2 spike (S) protein and their effects on S protein's subcellular localization, palmitoylation and pseudovirus entry.", "journal": "Virology journal", "date": "2021", "authors": "Zeng XT, Yu XX, Cheng W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "34961524", "url": "https://glygen.org/publication/PubMed/34961524" } ] }, { "title": "Sevoflurane represses the progression of glioma by the regulation of circ_0037655/miR-130a-5p/RPN2 axis.", "journal": "Metabolic brain disease", "date": "2022", "authors": "Zhu J, Xie B, Huang G, Li Y, Liu Z", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ], "reference": [ { "type": "PubMed", "id": "35032276", "url": "https://glygen.org/publication/PubMed/35032276" } ] }, { "title": "Ribophorin II promotes the epithelial-mesenchymal transition and aerobic glycolysis of laryngeal squamous cell carcinoma via regulating reactive oxygen species-mediated Phosphatidylinositol-3-Kinase/Protein Kinase B activation.", "journal": "Bioengineered", "date": "2022", "authors": "Zhou J, Zhang J, Zhang W, Ke Z, Lv Y, Zhang B, Liao Z", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ], "reference": [ { "type": "PubMed", "id": "35156537", "url": "https://glygen.org/publication/PubMed/35156537" } ] }, { "title": "The N(6)-methyladenosine-mediated lncRNA WEE2-AS1 promotes glioblastoma progression by stabilizing RPN2.", "journal": "Theranostics", "date": "2022", "authors": "Li B, Zhao R, Qiu W, Pan Z, Zhao S, Qi Y, Qiu J, Zhang S, Guo Q, Fan Y, Xu H, Li M, Li G, Xue H", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ], "reference": [ { "type": "PubMed", "id": "36168628", "url": "https://glygen.org/publication/PubMed/36168628" } ] }, { "title": "RPN2 in cancer: An overview.", "journal": "Gene", "date": "2023-03-20", "authors": "Han Zhengxuan, Wang You, Han Lei, Yang Chaogang", "evidence": [ { "database": "RefSeq", "id": "NP_001129243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129243" } ], "reference": [ { "type": "PubMed", "id": "36621657", "url": "https://glygen.org/publication/PubMed/36621657" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04844", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04844" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "The relationship between the N-acetylgalactosamine content and the blood group Sda activity of Tamm and Horsfall urinary glycoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1980", "authors": "Soh CP, Morgan WT, Watkins WM, Donald AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "6156677", "url": "https://glygen.org/publication/PubMed/6156677" } ] }, { "title": "Precipitin reaction between Sda-active human Tamm-Horsfall glycoprotein and anti-Sda-serum.", "journal": "Vox sanguinis", "date": "1982", "authors": "Serafini-Cessi F, Conte R", "evidence": [ { "database": "Reactome", "id": "R-HSA-446203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203" } ], "reference": [ { "type": "PubMed", "id": "7072193", "url": "https://glygen.org/publication/PubMed/7072193" } ] }, { "title": "Inhibition of alpha-glucosidase I of the glycoprotein-processing enzymes by 6-O-butanoyl castanospermine (MDL 28,574) and its consequences in human immunodeficiency virus-infected T cells.", "journal": "Antimicrobial agents and chemotherapy", "date": "1994", "authors": "Taylor DL, Kang MS, Brennan TM, Bridges CG, Sunkara PS, Tyms AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694548", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548" } ], "reference": [ { "type": "PubMed", "id": "7986008", "url": "https://glygen.org/publication/PubMed/7986008" } ] }, { "title": "The role of assembly in insulin's biosynthesis.", "journal": "Current opinion in structural biology", "date": "1998", "authors": "Dodson G, Steiner D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339" } ], "reference": [ { "type": "PubMed", "id": "9631292", "url": "https://glygen.org/publication/PubMed/9631292" } ] } ], "pathway": [ { "id": "hsa:6185", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6185", "resource": "KEGG Pathway" }, { "id": "R-HSA-1799339", "name": "SRP-dependent cotranslational protein targeting to membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1799339", "resource": "Reactome", "description": "SRP-dependent cotranslational protein targeting to membrane" }, { "id": "R-HSA-446203", "name": "Asparagine N-linked glycosylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-446203", "resource": "Reactome", "description": "Asparagine N-linked glycosylation" }, { "id": "R-HSA-9694548", "name": "Maturation of spike protein", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548", "resource": "Reactome", "description": "Maturation of spike protein" } ], "orthologs": [ { "uniprot_canonical_ac": "F1SEM2-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "RPN2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAPPGSSTVLLLALTIIASAQALTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLSSLGAQVPDEKKACTFIKSNLDPSNVDSLFYTAQSSQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALGALTARLSKEETVLATVQALQTASYLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNTIFSKKNFESLPEAFSVASAAAALSQNRYHVPVVVVPEGSPSDTQEQAFLRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFVNVKFSSGYYDFSVKVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGAFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDSKNVYRFELDTSERKIEFDSASGTYTLYLIIGDATLKNPIHWNVADVVIRFPEEDAPSTVLSKNLFTAKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANISNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAIKRTAH", "length": 631 }, "evidence": [ { "id": "P04844", "url": "https://omabrowser.org/oma/group/P04844/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P25235-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "Rpn2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAPPGSSAVFLLALTITASTQALTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLNSLGAQVPDVKKACAFIKSNLDPSNVDSLFYAAQSSQVLSGCEISVSNETRDLLLAAVSEDSSVAQIYHAVAALSGFGLPLASHEALGALTARLSKEETVLATVQALHTASHLSQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSIKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSASDTQEQAILRLQVSSVLSQPLAQAAVKLEHAKSVASRATVLQKMPFSLVGDVFELNFKNVKLPSGYYDFSVRVEGDNRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAVLGTVTFLAGNRMLAQQAVKRTAH", "length": 631 }, "evidence": [ { "id": "45924308", "url": "http://www.informatics.jax.org/homology/45924308", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q7K110-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "OstDelta", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MLKLGLVIFCVLVASGPTWSARTVDSHLGQKDLSRLQKVFVDGFGSSDLQSIFFSSLNIQLTDATQKEPLCKKIATLHSESKLNSFEKDYYYIGASRNLGCSAKIDEGLLSKVYSSLNSELGSSQEIFYRVVTHKVLGVEINEATQEKLVKRLQELLKKDDTLSGLGYAFNVAPLLGASASFIANRVEDAIVQADEVDGKLLQFEGGLSITSLIINGAFGVSKTFNKPVPITADQAVKFANYFLSRRSVQTAKGAHVLIEALKTISGADKIAPVCVQLIGNGQLDAQSPTLNVAVVDLLGKPLSPAPKVINAKVIRKKDSSVLADKITVASKSSDKTTYVADLASLKPARGVYQAELSADGVYTQTLQFKVLGRVKVQSLEVGIAESDASAATRKQSVTYPGKLQEVLSADSTQKLLLKAVLVDESTSKPLAVHQAFVRLYNKKTDKEIIFVAEQDSSKAYKFDMDVGNNGKNFNYQSGTYSIYLTVGDSSLSNSFEWLVAEVQLKFNEDKEVKPKNTSGPLPEIIHQFRVPDKRPPRIVSDIFTGLCITPLVLLFVFWGKLGINVSNLTLAPSTIGFHLGFGGILVLFFVFWLQLNMFQTLRLLIPIAVFTFLAGNRLLRRLYAQRNSKASAS", "length": 634 }, "evidence": [ { "id": "P04844", "url": "https://omabrowser.org/oma/group/P04844/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9DBG6-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2", "gene_name": "Rpn2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPPGSSAVFLLALTITASVQALTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSSLGVQVPDVKKACTFIKSNLDPSNVDSLFYAAQSSQVLSGCEISVSNETKELLLAAVSEDSPIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHLSQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQKTPFSLVGNVFELNFKNVKLSSGYYDFSVRVEGDSRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQSLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMFQTLKYLAVLGTVTFLAGNRMLAQHAVKRTAH", "length": 631 }, "evidence": [ { "id": "45924308", "url": "http://www.informatics.jax.org/homology/45924308", "database": "MGI" }, { "id": "P04844", "url": "https://omabrowser.org/oma/group/P04844/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "protein modification process", "id": "GO:0036211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "protein N-linked glycosylation", "id": "GO:0006487", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006487", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "protein N-linked glycosylation via asparagine", "id": "GO:0018279", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018279", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" }, { "name": "oligosaccharyltransferase complex", "id": "GO:0008250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008250", "evidence": [ { "database": "UniProtKB", "id": "P04844", "url": "https://www.uniprot.org/uniprot/P04844" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" }, { "start_pos": 566, "end_pos": 568, "annotation": "n_glycosylation_sequon" }, { "start_pos": 569, "end_pos": 571, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 106 ], "o_linked_sites": [ 54, 77, 227, 312, 315, 521 ], "snv_sites": [ 54, 77, 106, 108, 312, 340, 403, 432, 457, 521, 611 ], "glycation_sites": [], "phosphorylation_sites": [ 157 ], "sequon_annotation_sites": [ { "start_pos": 106, "end_pos": 108 }, { "start_pos": 566, "end_pos": 568 }, { "start_pos": 569, "end_pos": 571 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 59 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }