{ "uniprot_canonical_ac": "P04554-1", "uniprot_ac": "P04554", "uniprot_id": "PRM2_HUMAN", "mass": { "chemical_mass": 13051.0, "monoisotopic_mass": 13051.0 }, "refseq": { "ac": "NP_001273285", "name": "protamine-2 isoform 2", "summary": "Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis, and are the major DNA-binding proteins in the nucleus of sperm in many vertebrates. They package the sperm DNA into a highly condensed complex in a volume less than 5% of a somatic cell nucleus. Many mammalian species have only one protamine (protamine 1); however, a few species, including human and mouse, have two. This gene encodes protamine 2, which is cleaved to give rise to a family of protamine 2 peptides. Alternatively spliced transcript variants have also been found for this gene. [provided by RefSeq, Sep 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, "gene_names": [ { "name": "PRM2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04554", "id": "P04554" }, { "name": "CT94.2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285", "id": "NP_001273285" }, { "name": "PRM2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285", "id": "NP_001273285" } ], "protein_names": [ { "name": "Protamine-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04554" }, { "name": "P2''", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "P2'", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "Sperm histone P2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "Sperm protamine P2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "Sperm protamine P3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "Sperm protamine P4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04554" }, { "name": "cancer/testis antigen family 94, member 2; sperm protamine P2; sperm histone P2; testicular secretory protein Li 40", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285", "id": "NP_001273285" }, { "name": "protamine-2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285", "id": "NP_001273285" } ], "function": [ { "annotation": "Impact of tobacco smoking in association with H2BFWT, PRM1 and PRM2 genes variants on male infertility.", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, { "database": "PubMed", "id": "36217675", "url": "https://glygen.org/publication/PubMed/36217675" } ] }, { "annotation": "Protamine 1/Protamine 2 mRNA ratio in nonobstructive azoospermic patients.", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, { "database": "PubMed", "id": "33427330", "url": "https://glygen.org/publication/PubMed/33427330" } ] }, { "annotation": "Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis, and are the major DNA-binding proteins in the nucleus of sperm in many vertebrates. They package the sperm DNA into a highly condensed complex in a volume less than 5% of a somatic cell nucleus. Many mammalian species have only one protamine (protamine 1); however, a few species, including human and mouse, have two. This gene encodes protamine 2, which is cleaved to give rise to a family of protamine 2 peptides. Alternatively spliced transcript variants have also been found for this gene. [provided by RefSeq, Sep 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554#function" }, { "database": "UniProtKB", "id": "P07978", "url": "https://www.uniprot.org/uniprot/P07978#function" } ] }, { "annotation": "Spermatozoa retrieval in azoospermia and expression profile of JMJD1A, TNP2, and PRM2 in a subset of the Karachi population.", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, { "database": "PubMed", "id": "34235877", "url": "https://glygen.org/publication/PubMed/34235877" } ] }, { "annotation": "Tobacco smoking and its impact on the expression level of sperm nuclear protein genes: H2BFWT, TNP1, TNP2, PRM1 and PRM2.", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" }, { "database": "PubMed", "id": "33440036", "url": "https://glygen.org/publication/PubMed/33440036" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "58.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "42.19", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "53.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "43.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "24.08", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "69.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04554", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04554" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04554", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04554" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04554", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04554" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "common_name": "Human" } ], "gene": [ { "name": "PRM2", "url": "https://www.uniprot.org/uniprot/P04554", "locus": { "chromosome": "16", "start_pos": 11275639, "end_pos": 11276480, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000122304", "url": "https://www.ensembl.org/id/ENSG00000122304" } ] } } ], "crossref": [ { "id": "ENSG00000122304", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000122304", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "PRM2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRM2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5620", "url": "https://www.ncbi.nlm.nih.gov/gene/5620", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9448", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9448", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04554", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04554*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000492", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000492", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5620", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5620", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "182882", "url": "http://www.omim.org/entry/182882", "database": "MIM", "categories": [ "Other" ] }, { "id": "182890", "url": "http://www.omim.org/entry/182890", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04554", "url": "https://www.nextprot.org/entry/NX_P04554", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PCAPIPG", "url": "https://omabrowser.org/oma/group/PCAPIPG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4706552at2759", "url": "http://www.orthodb.org/?query=4706552at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21341", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21341", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21341:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21341:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00841", "url": "http://pfam.xfam.org/family/PF00841", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04554", "url": "https://pharos.nih.gov/targets/P04554", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P04554", "url": "http://purl.obolibrary.org/obo/PR_P04554", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9821993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821993", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04554-1", "url": "https://www.uniprot.org/uniprot/P04554-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04554-2", "url": "https://www.uniprot.org/uniprot/P04554-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH", "length": 102, "header": "sp|P04554-1|PRM2_HUMAN Isoform 1 of Protamine-2 OS=Homo sapiens OX=9606 GN=PRM2 PE=1 SV=3 CANONICAL=P04554-1" }, "isoforms": [ { "isoform_ac": "P04554-1", "url": "", "sequence": { "sequence": "MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH", "length": 102, "header": "sp|P04554-1|PRM2_HUMAN Isoform 1 of Protamine-2 OS=Homo sapiens OX=9606 GN=PRM2 PE=1 SV=3 CANONICAL=P04554-1" }, "locus": { "chromosome": "16", "start_pos": 11276370, "end_pos": 11275903, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000241808.9", "url": "https://www.ensembl.org/id/ENST00000241808.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000241808.5", "url": "https://www.ensembl.org/id/ENSP00000241808.5" } ] } }, { "isoform_ac": "P04554-2", "url": "", "sequence": { "sequence": "MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRESLGDPLNQNFLSQKAAEPGREHAEGTKLPGPLTPSWKLRKSRPKHQVRP", "length": 140, "header": "sp|P04554-2|PRM2_HUMAN Isoform 2 of Protamine-2 OS=Homo sapiens OX=9606 GN=PRM2 PE=1 SV=3 CANONICAL=P04554-1" }, "locus": { "chromosome": "16", "start_pos": 11276370, "end_pos": 11275833, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435245.2", "url": "https://www.ensembl.org/id/ENST00000435245.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000403681.2", "url": "https://www.ensembl.org/id/ENSP00000403681.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "site_lbl": "Ser10" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "site_lbl": "Ser37" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P04554", "url": "http://phospho.elm.eu.org/byAccession/P04554.html" }, { "database": "iPTMnet", "id": "P04554", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04554" }, { "database": "PubMed", "id": "8218377", "url": "https://glygen.org/publication/PubMed/8218377" } ], "site_lbl": "Ser59" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "site_lbl": "Ser8" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Rapid evolution of male reproductive genes in the descent of man.", "journal": "Nature", "date": "2000", "authors": "Wyckoff G J, Wang W, Wu C I", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "10659848", "url": "https://glygen.org/publication/PubMed/10659848" } ] }, { "title": "Molecular structure of human protamine P4 (HP4), a minor basic protein of human sperm nuclei.", "journal": "Eur. J. Biochem.", "date": "1991", "authors": "Arkhis A, Martinage A, Sautiere P, Chevaillier P", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "1889406", "url": "https://glygen.org/publication/PubMed/1889406" } ] }, { "title": "Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered.", "journal": "Genomics", "date": "1990", "authors": "Domenjoud L, Nussbaum G, Adham IM, Greeske G, Engel W", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "2081589", "url": "https://glygen.org/publication/PubMed/2081589" } ] }, { "title": "Function of homo- and hetero-oligomers of human nucleoplasmin/nucleophosmin family proteins NPM1, NPM2 and NPM3 during sperm chromatin remodeling.", "journal": "Nucleic acids research", "date": "2012", "authors": "Okuwaki M, Sumi A, Hisaoka M, Saotome-Nakamura A, Akashi S, Nishimura Y, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821993", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821993" } ], "reference": [ { "type": "PubMed", "id": "22362753", "url": "https://glygen.org/publication/PubMed/22362753" } ] }, { "title": "Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3.", "journal": "Eur. J. Biochem.", "date": "1990", "authors": "Martinage A, Arkhis A, Alimi E, Sauti\u00e8re P, Chevaillier P", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "2384091", "url": "https://glygen.org/publication/PubMed/2384091" } ] }, { "title": "Protamine 1/Protamine 2 mRNA ratio in nonobstructive azoospermic patients.", "journal": "Andrologia", "date": "2021", "authors": "Amjad S, Mushtaq S, Rehman R, Munir A, Zahid N, Siddique PQR", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" } ], "reference": [ { "type": "PubMed", "id": "33427330", "url": "https://glygen.org/publication/PubMed/33427330" } ] }, { "title": "Tobacco smoking and its impact on the expression level of sperm nuclear protein genes: H2BFWT, TNP1, TNP2, PRM1 and PRM2.", "journal": "Andrologia", "date": "2021", "authors": "Amor H, Zeyad A, Hammadeh ME", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" } ], "reference": [ { "type": "PubMed", "id": "33440036", "url": "https://glygen.org/publication/PubMed/33440036" } ] }, { "title": "Comparison of the amino acid sequences of human protamines HP2 and HP3 and of intermediate basic nuclear proteins HPS1 and HPS2. Structural evidence that HPS1 and HPS2 are pro-protamines.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Sauti\u00e8re P, Martinage A, B\u00e9laiche D, Arkhis A, Chevaillier P", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "3403514", "url": "https://glygen.org/publication/PubMed/3403514" } ] }, { "title": "Sequence of human protamine 2 cDNA.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Domenjoud L, Fronia C, Uhde F, Engel W", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "3412906", "url": "https://glygen.org/publication/PubMed/3412906" } ] }, { "title": "Spermatozoa retrieval in azoospermia and expression profile of JMJD1A, TNP2, and PRM2 in a subset of the Karachi population.", "journal": "Andrology", "date": "2021", "authors": "Amjad S, Mushtaq S, Rehman R, Zahid N, Munir A, Siddiqui PQR", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" } ], "reference": [ { "type": "PubMed", "id": "34235877", "url": "https://glygen.org/publication/PubMed/34235877" } ] }, { "title": "Isolation and amino-acid sequence analysis of human sperm protamines P1 and P2. Occurrence of two forms of protamine P2.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1986", "authors": "Ammer H, Henschen A, Lee C H", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "3527226", "url": "https://glygen.org/publication/PubMed/3527226" } ] }, { "title": "Impact of tobacco smoking in association with H2BFWT, PRM1 and PRM2 genes variants on male infertility.", "journal": "Andrologia", "date": "2022-12", "authors": "Amor Houda, Jankowski Peter Michael, Dahadhah Fatina W, Al Zoubi Mazhar Salim, Hammadeh Mohamad Eid", "evidence": [ { "database": "RefSeq", "id": "NP_001273285", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273285" } ], "reference": [ { "type": "PubMed", "id": "36217675", "url": "https://glygen.org/publication/PubMed/36217675" } ] }, { "title": "Human sperm protamines. Amino-acid sequences of two forms of protamine P2.", "journal": "Eur. J. Biochem.", "date": "1986", "authors": "McKay DJ, Renaux BS, Dixon GH", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "3956509", "url": "https://glygen.org/publication/PubMed/3956509" } ] }, { "title": "Characterization of a human locus in transition.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Nelson JE, Krawetz SA", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "7983046", "url": "https://glygen.org/publication/PubMed/7983046" } ] }, { "title": "Phosphorylation of human sperm protamines HP1 and HP2: identification of phosphorylation sites.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Chirat F, Arkhis A, Martinage A, Jaquinod M, Chevaillier P, Sautiere P", "evidence": [ { "database": "iPTMnet", "id": "P04554", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04554" } ], "reference": [ { "type": "PubMed", "id": "8218377", "url": "https://glygen.org/publication/PubMed/8218377" } ] }, { "title": "Amino acid sequence of the human intermediate basic protein 2 (HPI2) from sperm nuclei. Structural relationship with protamine P2.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Alimi E, Martinage A, Arkhis A, Belaiche D, Sautiere P, Chevaillier P", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "reference": [ { "type": "PubMed", "id": "8513794", "url": "https://glygen.org/publication/PubMed/8513794" } ] } ], "pathway": [ { "id": "hsa:5620", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5620", "resource": "KEGG Pathway" }, { "id": "R-HSA-9821993", "name": "Replacement of protamines by nucleosomes in the male pronucleus", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821993", "resource": "Reactome", "description": "Replacement of protamines by nucleosomes in the male pronucleus" } ], "orthologs": [ { "uniprot_canonical_ac": "P07978-1", "protein_name": "Protamine-2", "gene_name": "Prm2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVRYRMRSPSEGPHQGPGQDHEREEQGQGQGLSPERVEDYGRTHRGHHHHRHRRCSRKRLHRIHKRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRRCRCRKCRRHHH", "length": 107 }, "evidence": [ { "id": "45935869", "url": "http://www.informatics.jax.org/homology/45935869", "database": "MGI" }, { "id": "P04554", "url": "https://omabrowser.org/oma/group/P04554/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P11248-1", "protein_name": "Protamine-2", "gene_name": "Prm2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVRYRMRSPSEGQHQGPGQDHEREEQGQGQELSPERVEDYGRTERGHHHRHRRCKRLHRIHKRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRSCRCRKCRWHYY", "length": 104 }, "evidence": [ { "id": "45935869", "url": "http://www.informatics.jax.org/homology/45935869", "database": "MGI" }, { "id": "P04554", "url": "https://omabrowser.org/oma/group/P04554/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "cadmium ion binding", "id": "GO:0046870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046870", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "male germ cell nucleus", "id": "GO:0001673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001673", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "spermatid development", "id": "GO:0007286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007286", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "chromosome condensation", "id": "GO:0030261", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030261", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "nucleus organization", "id": "GO:0006997", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006997", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" }, { "name": "chromosome organization", "id": "GO:0051276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051276", "evidence": [ { "database": "UniProtKB", "id": "P04554", "url": "https://www.uniprot.org/uniprot/P04554" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 8, 10, 37, 59 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }