{ "uniprot_canonical_ac": "P04278-1", "uniprot_ac": "P04278", "uniprot_id": "SHBG_HUMAN", "mass": { "chemical_mass": 43779.0, "monoisotopic_mass": 43779.0 }, "refseq": { "ac": "NP_001031", "name": "sex hormone-binding globulin isoform 1 precursor", "summary": "This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, "gene_names": [ { "name": "SHBG", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04278", "id": "P04278" }, { "name": "ABP; SBP; TEBG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031", "id": "NP_001031" }, { "name": "SHBG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031", "id": "NP_001031" }, { "name": "hCG_42018", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P04278", "id": "P04278" } ], "protein_names": [ { "name": "Sex hormone-binding globulin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04278" }, { "name": "ABP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "SBP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "SHBG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "Sex steroid-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "TeBG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "Testis-specific androgen-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "Testosterone-estradiol-binding globulin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "Testosterone-estrogen-binding globulin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04278" }, { "name": "sex hormone-binding globulin isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031", "id": "NP_001031" }, { "name": "testosterone-binding beta-globulin; sex steroid-binding protein; testis-specific androgen-binding protein; testosterone-estrogen-binding globulin; testosterone-estradiol-binding globulin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031", "id": "NP_001031" } ], "function": [ { "annotation": "Association of sex hormones and sex hormone-binding globulin with liver fat in men and women: an observational and Mendelian randomization study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, { "database": "PubMed", "id": "37900132", "url": "https://glygen.org/publication/PubMed/37900132" } ] }, { "annotation": "Associations of bone mineral density with sex hormone-binding globulin (SHBG) and testosterone in middle-aged Saudi men: a cross-sectional study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, { "database": "PubMed", "id": "38116310", "url": "https://glygen.org/publication/PubMed/38116310" } ] }, { "annotation": "Circulating sex hormone-binding globulin levels and ischemic stroke risk: a Mendelian randomization study.", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, { "database": "PubMed", "id": "37742091", "url": "https://glygen.org/publication/PubMed/37742091" } ] }, { "annotation": "Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.", "evidence": [ { "database": "UniProtKB", "id": "I3L145", "url": "https://www.uniprot.org/uniprot/I3L145#function" }, { "database": "UniProtKB", "id": "ARBA00037620", "url": "https://www.uniprot.org/uniprot/ARBA00037620#function" }, { "database": "UniProtKB", "id": "I3L1C1", "url": "https://www.uniprot.org/uniprot/I3L1C1#function" }, { "database": "UniProtKB", "id": "I3L2F1", "url": "https://www.uniprot.org/uniprot/I3L2F1#function" }, { "database": "UniProtKB", "id": "B0FWH5", "url": "https://www.uniprot.org/uniprot/B0FWH5#function" }, { "database": "UniProtKB", "id": "B0FWH7", "url": "https://www.uniprot.org/uniprot/B0FWH7#function" }, { "database": "UniProtKB", "id": "B0FWH6", "url": "https://www.uniprot.org/uniprot/B0FWH6#function" }, { "database": "UniProtKB", "id": "I3L0M1", "url": "https://www.uniprot.org/uniprot/I3L0M1#function" }, { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278#function" }, { "database": "UniProtKB", "id": "I3L1G4", "url": "https://www.uniprot.org/uniprot/I3L1G4#function" }, { "database": "UniProtKB", "id": "I3L4B9", "url": "https://www.uniprot.org/uniprot/I3L4B9#function" }, { "database": "UniProtKB", "id": "I3L1J1", "url": "https://www.uniprot.org/uniprot/I3L1J1#function" }, { "database": "UniProtKB", "id": "A0A0C4DGN2", "url": "https://www.uniprot.org/uniprot/A0A0C4DGN2#function" }, { "database": "UniProtKB", "id": "I3L2X4", "url": "https://www.uniprot.org/uniprot/I3L2X4#function" } ] }, { "annotation": "Is elevated baseline SHBG associated with increased ovulation?", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, { "database": "PubMed", "id": "37913814", "url": "https://glygen.org/publication/PubMed/37913814" } ] }, { "annotation": "Sex hormone-binding globulin exerts sex-related causal effects on lower extremity varicose veins: evidence from gender-stratified Mendelian randomization. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" }, { "database": "PubMed", "id": "38152135", "url": "https://glygen.org/publication/PubMed/38152135" } ] }, { "annotation": "This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs373254168", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373254168" }, { "id": "rs373254168", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373254168" }, { "id": "rs373254168", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373254168#frequency_tab" }, { "id": "rs373254168", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs373254168" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TQS->NQS); o-glyco-site-loss (T->N).", "chr_id": "17", "chr_pos": "7630279", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T36", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs6259", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs6259" }, { "id": "rs6259", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs6259" }, { "id": "rs6259", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs6259" }, { "id": "rs6259", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs6259#frequency_tab" }, { "id": "rs6259", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs6259" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 356, "end_pos": 356, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "17", "chr_pos": "7633209", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0653", "site_lbl": "D356", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761769667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761769667" }, { "id": "rs761769667", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761769667" }, { "id": "rs761769667", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761769667" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 36, "end_pos": 36, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "7630278", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T36", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200408334", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200408334" }, { "id": "rs200408334", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200408334" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 380, "end_pos": 380, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->KRS).", "chr_id": "17", "chr_pos": "7633283", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N380", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04278", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04278" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 382, "end_pos": 382, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NRS->NRC).", "chr_id": "17", "chr_pos": "7633287", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S382", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs767484347", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767484347" }, { "id": "rs767484347", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767484347" }, { "id": "rs767484347", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767484347" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 382, "end_pos": 382, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRN).", "chr_id": "17", "chr_pos": "7633288", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S382", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1448649216", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1448649216" }, { "id": "rs1448649216", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1448649216#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 382, "end_pos": 382, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->NRR).", "chr_id": "17", "chr_pos": "7633289", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S382", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs142693170", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142693170" }, { "id": "rs142693170", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142693170" }, { "id": "rs142693170", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs142693170#frequency_tab" }, { "id": "rs142693170", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142693170" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 398, "end_pos": 398, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGN).", "chr_id": "17", "chr_pos": "7633336", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T398", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P04278", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04278" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 65, "end_pos": 65, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KIT->NIT).", "chr_id": "17", "chr_pos": "7630499", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K65", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1238496494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1238496494" }, { "id": "rs1238496494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1238496494" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).", "chr_id": "17", "chr_pos": "7630682", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T69", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "52.77", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "52.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "63.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "69.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "59.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "63.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "54.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "63.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "62.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "80.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "66.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "59.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04278" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "common_name": "Human" } ], "gene": [ { "name": "SHBG", "url": "https://www.uniprot.org/uniprot/P04278", "locus": { "chromosome": "17", "start_pos": 7633382, "end_pos": 7613946, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000129214", "url": "https://www.ensembl.org/id/ENSG00000129214" } ] } } ], "crossref": [ { "id": "ENSG00000129214", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000129214", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P04278", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04278", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00110", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00110", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3305", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3305", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "SHBG", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SHBG", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "6462", "url": "https://www.ncbi.nlm.nih.gov/gene/6462", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "562", "url": "https://glyconnect.expasy.org/browser/proteins/562", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "10839", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10839", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04278", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04278*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001791", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001791", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:6462", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6462", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "182205", "url": "http://www.omim.org/entry/182205", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04278", "url": "https://www.nextprot.org/entry/NX_P04278", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NLSMPWE", "url": "https://omabrowser.org/oma/group/NLSMPWE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5316510at2759", "url": "http://www.orthodb.org/?query=5316510at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24040", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24040", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24040:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24040:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1D2S", "url": "https://www.rcsb.org/structure/1D2S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1F5F", "url": "https://www.rcsb.org/structure/1F5F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KDK", "url": "https://www.rcsb.org/structure/1KDK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KDM", "url": "https://www.rcsb.org/structure/1KDM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LHN", "url": "https://www.rcsb.org/structure/1LHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LHO", "url": "https://www.rcsb.org/structure/1LHO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LHU", "url": "https://www.rcsb.org/structure/1LHU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LHV", "url": "https://www.rcsb.org/structure/1LHV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LHW", "url": "https://www.rcsb.org/structure/1LHW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYA", "url": "https://www.rcsb.org/structure/6PYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYB", "url": "https://www.rcsb.org/structure/6PYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYF", "url": "https://www.rcsb.org/structure/6PYF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ULB", "url": "https://www.rcsb.org/structure/6ULB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00054", "url": "http://pfam.xfam.org/family/PF00054", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04278", "url": "https://pharos.nih.gov/targets/P04278", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053386", "url": "https://proconsortium.org/app/entry/PR:000053386", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053387", "url": "https://proconsortium.org/app/entry/PR:000053387", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053388", "url": "https://proconsortium.org/app/entry/PR:000053388", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053389", "url": "https://proconsortium.org/app/entry/PR:000053389", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053390", "url": "https://proconsortium.org/app/entry/PR:000053390", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053391", "url": "https://proconsortium.org/app/entry/PR:000053391", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053392", "url": "https://proconsortium.org/app/entry/PR:000053392", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053393", "url": "https://proconsortium.org/app/entry/PR:000053393", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053394", "url": "https://proconsortium.org/app/entry/PR:000053394", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053395", "url": "https://proconsortium.org/app/entry/PR:000053395", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053396", "url": "https://proconsortium.org/app/entry/PR:000053396", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053397", "url": "https://proconsortium.org/app/entry/PR:000053397", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053398", "url": "https://proconsortium.org/app/entry/PR:000053398", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053399", "url": "https://proconsortium.org/app/entry/PR:000053399", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053400", "url": "https://proconsortium.org/app/entry/PR:000053400", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053401", "url": "https://proconsortium.org/app/entry/PR:000053401", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053402", "url": "https://proconsortium.org/app/entry/PR:000053402", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053403", "url": "https://proconsortium.org/app/entry/PR:000053403", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053404", "url": "https://proconsortium.org/app/entry/PR:000053404", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P04278", "url": "http://purl.obolibrary.org/obo/PR_P04278", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04278", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A0C4DGN2", "url": "https://www.uniprot.org/uniprot/A0A0C4DGN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DGN2-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DGN2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH5", "url": "https://www.uniprot.org/uniprot/B0FWH5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH5-1", "url": "https://www.uniprot.org/uniprot/B0FWH5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH6", "url": "https://www.uniprot.org/uniprot/B0FWH6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH6-1", "url": "https://www.uniprot.org/uniprot/B0FWH6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH7", "url": "https://www.uniprot.org/uniprot/B0FWH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0FWH7-1", "url": "https://www.uniprot.org/uniprot/B0FWH7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L0M1", "url": "https://www.uniprot.org/uniprot/I3L0M1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L0M1-1", "url": "https://www.uniprot.org/uniprot/I3L0M1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L145", "url": "https://www.uniprot.org/uniprot/I3L145", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L145-1", "url": "https://www.uniprot.org/uniprot/I3L145-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1C1", "url": "https://www.uniprot.org/uniprot/I3L1C1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1C1-1", "url": "https://www.uniprot.org/uniprot/I3L1C1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1G4", "url": "https://www.uniprot.org/uniprot/I3L1G4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1G4-1", "url": "https://www.uniprot.org/uniprot/I3L1G4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1J1", "url": "https://www.uniprot.org/uniprot/I3L1J1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1J1-1", "url": "https://www.uniprot.org/uniprot/I3L1J1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2F1", "url": "https://www.uniprot.org/uniprot/I3L2F1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2F1-1", "url": "https://www.uniprot.org/uniprot/I3L2F1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2X4", "url": "https://www.uniprot.org/uniprot/I3L2X4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L2X4-1", "url": "https://www.uniprot.org/uniprot/I3L2X4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4B9", "url": "https://www.uniprot.org/uniprot/I3L4B9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4B9-1", "url": "https://www.uniprot.org/uniprot/I3L4B9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4D0", "url": "https://www.uniprot.org/uniprot/I3L4D0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4D0-1", "url": "https://www.uniprot.org/uniprot/I3L4D0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278-1", "url": "https://www.uniprot.org/uniprot/P04278-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278-2", "url": "https://www.uniprot.org/uniprot/P04278-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278-3", "url": "https://www.uniprot.org/uniprot/P04278-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278-4", "url": "https://www.uniprot.org/uniprot/P04278-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04278-5", "url": "https://www.uniprot.org/uniprot/P04278-5", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 402, "header": "sp|P04278-1|SHBG_HUMAN Isoform 1 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "isoforms": [ { "isoform_ac": "A0A0C4DGN2-1", "url": "", "sequence": { "sequence": "WALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 260, "header": "tr|A0A0C4DGN2-1|A0A0C4DGN2_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630254, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576830.5", "url": "https://www.ensembl.org/id/ENST00000576830.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000460219.1", "url": "https://www.ensembl.org/id/ENSP00000460219.1" } ] } }, { "isoform_ac": "B0FWH5-1", "url": "", "sequence": { "sequence": "WALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQEKTLPPLFA", "length": 212, "header": "tr|B0FWH5-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630254, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571153.5", "url": "https://www.ensembl.org/id/ENST00000571153.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458858.1", "url": "https://www.ensembl.org/id/ENSP00000458858.1" } ] } }, { "isoform_ac": "B0FWH6-1", "url": "", "sequence": { "sequence": "WALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 206, "header": "tr|B0FWH6-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630254, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576152.1", "url": "https://www.ensembl.org/id/ENST00000576152.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000461743.1", "url": "https://www.ensembl.org/id/ENSP00000461743.1" } ] } }, { "isoform_ac": "B0FWH7-1", "url": "", "sequence": { "sequence": "WALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQEKTLPPLFA", "length": 113, "header": "tr|B0FWH7-1|B0FWH7_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630254, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575618.5", "url": "https://www.ensembl.org/id/ENST00000575618.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000459826.1", "url": "https://www.ensembl.org/id/ENSP00000459826.1" } ] } }, { "isoform_ac": "I3L0M1-1", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAAPETGLWAPDQQTPSHHEDCAWGAALPRFQPSVAAGSCPGWLPAPGFLAGQTGRDLSICPH", "length": 181, "header": "tr|I3L0M1-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7631668, "end_pos": 7630173, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570353.5", "url": "https://www.ensembl.org/id/ENST00000570353.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458199.1", "url": "https://www.ensembl.org/id/ENSP00000458199.1" } ] } }, { "isoform_ac": "I3L145-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 344, "header": "tr|I3L145-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000340624.9", "url": "https://www.ensembl.org/id/ENST00000340624.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000345675.6", "url": "https://www.ensembl.org/id/ENSP00000345675.6" } ] } }, { "isoform_ac": "I3L1C1-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVL", "length": 93, "header": "tr|I3L1C1-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7631259, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575729.5", "url": "https://www.ensembl.org/id/ENST00000575729.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458719.1", "url": "https://www.ensembl.org/id/ENSP00000458719.1" } ] } }, { "isoform_ac": "I3L1G4-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQEKTLPPLFA", "length": 82, "header": "tr|I3L1G4-1|I3L1G4_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000572182.5", "url": "https://www.ensembl.org/id/ENST00000572182.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458816.1", "url": "https://www.ensembl.org/id/ENSP00000458816.1" } ] } }, { "isoform_ac": "I3L1J1-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 229, "header": "tr|I3L1J1-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570547.5", "url": "https://www.ensembl.org/id/ENST00000570547.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458875.1", "url": "https://www.ensembl.org/id/ENSP00000458875.1" } ] } }, { "isoform_ac": "I3L2F1-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQEKTLPPLFA", "length": 181, "header": "tr|I3L2F1-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576728.5", "url": "https://www.ensembl.org/id/ENST00000576728.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000459620.1", "url": "https://www.ensembl.org/id/ENSP00000459620.1" } ] } }, { "isoform_ac": "I3L2X4-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 290, "header": "tr|I3L2X4-1|I3L2X4_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000572262.5", "url": "https://www.ensembl.org/id/ENST00000572262.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000459999.1", "url": "https://www.ensembl.org/id/ENSP00000459999.1" } ] } }, { "isoform_ac": "I3L4B9-1", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 175, "header": "tr|I3L4B9-1|I3L4B9_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576478.5", "url": "https://www.ensembl.org/id/ENST00000576478.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000461133.1", "url": "https://www.ensembl.org/id/ENSP00000461133.1" } ] } }, { "isoform_ac": "I3L4D0-1", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQVQERDRALSSCSLPFSPLAL", "length": 57, "header": "tr|I3L4D0-1|SHBG_HUMAN Computationally mapped isoform of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=1 CANONICAL=P04278-1" }, "locus": {} }, { "isoform_ac": "P04278-1", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 402, "header": "sp|P04278-1|SHBG_HUMAN Isoform 1 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630173, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380450.9", "url": "https://www.ensembl.org/id/ENST00000380450.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000369816.4", "url": "https://www.ensembl.org/id/ENSP00000369816.4" } ] } }, { "isoform_ac": "P04278-2", "url": "", "sequence": { "sequence": "MTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQEKTLPPLFA", "length": 235, "header": "sp|P04278-2|SHBG_HUMAN Isoform 2 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000574539.5", "url": "https://www.ensembl.org/id/ENST00000574539.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458181.1", "url": "https://www.ensembl.org/id/ENSP00000458181.1" } ] } }, { "isoform_ac": "P04278-3", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQEKTLPPLFA", "length": 293, "header": "sp|P04278-3|SHBG_HUMAN Isoform 3 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633230, "end_pos": 7630173, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000416273.7", "url": "https://www.ensembl.org/id/ENST00000416273.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000388867.3", "url": "https://www.ensembl.org/id/ENSP00000388867.3" } ] } }, { "isoform_ac": "P04278-4", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 287, "header": "sp|P04278-4|SHBG_HUMAN Isoform 4 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630173, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000441599.6", "url": "https://www.ensembl.org/id/ENST00000441599.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000393426.2", "url": "https://www.ensembl.org/id/ENSP00000393426.2" } ] } }, { "isoform_ac": "P04278-5", "url": "", "sequence": { "sequence": "MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH", "length": 384, "header": "sp|P04278-5|SHBG_HUMAN Isoform 5 of Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2 CANONICAL=P04278-1" }, "locus": { "chromosome": "17", "start_pos": 7633349, "end_pos": 7630173, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575903.5", "url": "https://www.ensembl.org/id/ENST00000575903.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458973.1", "url": "https://www.ensembl.org/id/ENSP00000458973.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "THR-36", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" }, { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" }, { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" }, { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "P04278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "id": "1400872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1400872" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278@N380", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04278@N380" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37320GX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G69062KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G81413UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G87433AX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 380, "start_aa": "Asn", "end_pos": 380, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn380", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" }, { "id": "P04278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "3542030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3542030" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37320GX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G69062KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G81413UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: T-36, N-380, N-396", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G87433AX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "P04278", "database": "UniCarbKB", "url": "" }, { "id": "23001782", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23001782" }, { "id": "P04278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "id": "1400872", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1400872" }, { "id": "3542030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3542030" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "562", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/562" }, { "id": "6684483", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6684483" } ] } ], "phosphorylation": [ { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04278", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04278" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ], "site_lbl": "Tyr86" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.", "journal": "Nature genetics", "date": "1999", "authors": "Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "10391209", "url": "https://glygen.org/publication/PubMed/10391209" } ] }, { "title": "Crystal structure of human sex hormone-binding globulin: steroid transport by a laminin G-like domain.", "journal": "EMBO J.", "date": "2000", "authors": "Grishkovskaya I, Avvakumov G V, Sklenar G, Dales D, Hammond G L, Muller Y A", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "10675319", "url": "https://glygen.org/publication/PubMed/10675319" } ] }, { "title": "Steroid ligands bind human sex hormone-binding globulin in specific orientations and produce distinct changes in protein conformation.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Grishkovskaya Irina, Avvakumov George V, Hammond Geoffrey L, Catalano Maria G, Muller Yves A", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "12065592", "url": "https://glygen.org/publication/PubMed/12065592" } ] }, { "title": "Molecular analyses of a human sex hormone-binding globulin variant: evidence for an additional carbohydrate chain.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Power SG, Bocchinfuso WP, Pallesen M, Warmels-Rodenhiser S, Van Baelen H, Hammond GL", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "1400872", "url": "https://glygen.org/publication/PubMed/1400872" } ] }, { "title": "PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.", "journal": "Genomics", "date": "2004", "authors": "Jin Pei, Fu Glenn K, Wilson Amy D, Yang Junming, Chien David, Hawkins Phillip R, Au-Young Janice, Stuve Laura L", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "15028279", "url": "https://glygen.org/publication/PubMed/15028279" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Implications of gene-environment interaction in studies of gene variants in breast cancer: an example of dietary isoflavones and the D356N polymorphism in the sex hormone-binding globulin gene.", "journal": "Cancer research", "date": "2006", "authors": "Low YL, Dunning AM, Dowsett M, Luben RN, Khaw KT, Wareham NJ, Bingham SA", "evidence": [ { "database": "Entrez", "id": "6462", "url": "https://www.ncbi.nlm.nih.gov/gene/6462" } ], "reference": [ { "type": "PubMed", "id": "16982738", "url": "https://glygen.org/publication/PubMed/16982738" } ] }, { "title": "Variant in sex hormone-binding globulin gene and the risk of prostate cancer.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2007", "authors": "Berndt SI, Chatterjee N, Huang WY, Chanock SJ, Welch R, Crawford ED, Hayes RB", "evidence": [ { "database": "Entrez", "id": "6462", "url": "https://www.ncbi.nlm.nih.gov/gene/6462" } ], "reference": [ { "type": "PubMed", "id": "17220347", "url": "https://glygen.org/publication/PubMed/17220347" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P04278-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04278-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Micro- and macroheterogeneity of N-glycosylation yields size and charge isoforms of human sex hormone binding globulin circulating in serum.", "journal": "Proteomics", "date": "2012", "authors": "Sumer-Bayraktar Z, Nguyen-Khuong T, Jayo R, Chen DD, Ali S, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "UniCarbKB", "id": "P04278", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23001782", "url": "https://glygen.org/publication/PubMed/23001782" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Characterization of the human sex hormone binding globulin (SHBG) gene and demonstration of two transcripts in both liver and testis.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Gershagen S, Lundwall A, Fernlund P", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "2587256", "url": "https://glygen.org/publication/PubMed/2587256" } ] }, { "title": "The human sex hormone-binding globulin gene contains exons for androgen-binding protein and two other testicular messenger RNAs.", "journal": "Mol. Endocrinol.", "date": "1989", "authors": "Hammond GL, Underhill DA, Rykse HM, Smith CL", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "2608061", "url": "https://glygen.org/publication/PubMed/2608061" } ] }, { "title": "Characterization of a cDNA coding for sex steroid-binding protein of human plasma.", "journal": "FEBS Lett.", "date": "1987", "authors": "Que B G, Petra P H", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "2956125", "url": "https://glygen.org/publication/PubMed/2956125" } ] }, { "title": "A cDNA coding for human sex hormone binding globulin. Homology to vitamin K-dependent protein S.", "journal": "FEBS Lett.", "date": "1987", "authors": "Gershagen S, Fernlund P, Lundwall A", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "2956126", "url": "https://glygen.org/publication/PubMed/2956126" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04278", "url": "" }, { "database": "GlyConnect", "id": "562", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "562", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04278", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "562", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Amino acid sequence of the sex steroid binding protein of human blood plasma.", "journal": "Biochemistry", "date": "1986", "authors": "Walsh KA, Titani K, Takio K, Kumar S, Hayes R, Petra PH", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278#ptm_processing" }, { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "3542030", "url": "https://glygen.org/publication/PubMed/3542030" } ] }, { "title": "The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain.", "journal": "FEBS Lett.", "date": "1987", "authors": "Hammond G L, Underhill D A, Smith C L, Goping I S, Harley M J, Musto N A, Cheng C Y, Bardin C W", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "3569533", "url": "https://glygen.org/publication/PubMed/3569533" } ] }, { "title": "Physicochemical characteristics of human sex hormone binding globulin: evidence for two identical subunits.", "journal": "J. Steroid Biochem.", "date": "1986", "authors": "Hammond G L, Robinson P A, Sugino H, Ward D N, Finne J", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "3702459", "url": "https://glygen.org/publication/PubMed/3702459" } ] }, { "title": "Circulating sex hormone-binding globulin levels and ischemic stroke risk: a Mendelian randomization study.", "journal": "Postgraduate medical journal", "date": "2023-11-20", "authors": "Zeng Youjie, Cao Si, Yang Heng", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ], "reference": [ { "type": "PubMed", "id": "37742091", "url": "https://glygen.org/publication/PubMed/37742091" } ] }, { "title": "Association of sex hormones and sex hormone-binding globulin with liver fat in men and women: an observational and Mendelian randomization study.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Cai Xinting, Thorand Barbara, Hohenester Simon, Prehn Cornelia, Cecil Alexander, Adamski Jerzy, Zeller Tanja, Dennis Andrea, Banerjee Rajarshi, Peters Annette, Yaghootkar Hanieh, Nano Jana", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ], "reference": [ { "type": "PubMed", "id": "37900132", "url": "https://glygen.org/publication/PubMed/37900132" } ] }, { "title": "Is elevated baseline SHBG associated with increased ovulation?", "journal": "Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology", "date": "2023-12", "authors": "Chang Hui, Ge Hang, Wu Qi, Li Jian, Zhang Yanli, Zhu Mengyi, Luo Xi, Han Yanhua, Wang Yong, Wang Chi Chiu, Wu Xiaoke", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ], "reference": [ { "type": "PubMed", "id": "37913814", "url": "https://glygen.org/publication/PubMed/37913814" } ] }, { "title": "Associations of bone mineral density with sex hormone-binding globulin (SHBG) and testosterone in middle-aged Saudi men: a cross-sectional study.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Yakout Sobhy M, Khattak Malak Nawaz Khan, Al-Daghri Nasser M, Al-Masri Abeer A, Elsaid Mohamed A", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ], "reference": [ { "type": "PubMed", "id": "38116310", "url": "https://glygen.org/publication/PubMed/38116310" } ] }, { "title": "Sex hormone-binding globulin exerts sex-related causal effects on lower extremity varicose veins: evidence from gender-stratified Mendelian randomization.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Fan Qinglu, Meng Yang, Nie Zhihao, Xie Songping, Chen Changzheng", "evidence": [ { "database": "RefSeq", "id": "NP_001031", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001031" } ], "reference": [ { "type": "PubMed", "id": "38152135", "url": "https://glygen.org/publication/PubMed/38152135" } ] }, { "title": "Study of the carbohydrate moiety of human serum sex hormone-binding globulin.", "journal": "Biochimica et biophysica acta", "date": "1983", "authors": "Avvakumov GV, Matveentseva IV, Akhrem LV, Strel'chyonok OA, Akhrem AA", "evidence": [ { "database": "UniCarbKB", "id": "P04278", "url": "" }, { "database": "GlyConnect", "id": "562", "url": "https://glyconnect.expasy.org/browser/proteins/562" } ], "reference": [ { "type": "PubMed", "id": "6684483", "url": "https://glygen.org/publication/PubMed/6684483" } ] }, { "title": "Molecular characterization of a genetic variant of the steroid hormone-binding globulin gene in heterozygous subjects.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Hardy DO, Carino C, Catterall JF, Larrea F", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "reference": [ { "type": "PubMed", "id": "7714097", "url": "https://glygen.org/publication/PubMed/7714097" } ] } ], "pathway": [ { "id": "hsa:6462", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6462", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P08689-1", "protein_name": "Sex hormone-binding globulin", "gene_name": "Shbg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEKGEVASLRCRLLLLLLLLTLPPTHQGRTLRHIDPIQSAQDSPAKYLSNGPGQEPVTVLTIDLTKISKPSSSFEFRTWDPEGVIFYGDTNTEDDWFMLGLRDGQLEIQLHNLWARLTVGFGPRLNDGRWHPVELKMNGDSLLLWVDGKEMLCLRQVSASLADHPQLSMRIALGGLLLPTSKLRFPLVPALDGCIRRDIWLGHQAQLSTSARTSLGNCDVDLQPGLFFPPGTHAEFSLQDIPQPHTDPWTFSLELGFKLVDGAGRLLTLGTGTNSSWLTLHLQDQTVVLSSEAEPKLALPLAVGLPLQLKLDVFKVALSQGPKMEVLSTSLLRLASLWRLWSHPQGHLSLGALPGEDSSASFCLSDLWVQGQRLDIDKALSRSQDIWTHSCPQSPSNDTHTSH", "length": 403 }, "evidence": [ { "id": "45919044", "url": "http://www.informatics.jax.org/homology/45919044", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97497-1", "protein_name": "Sex hormone-binding globulin", "gene_name": "Shbg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEKRDSVALHWRLLLLLLLLMPPPTHQGRALRHIDPIQSAQDPPAKYLSNGPGQEPVMVMTIDLTKISKPHSSFEFRTWDPEGVIFYGDTNTEDDWFLLGLRAGQLEIQLHNAWARLTVGFGPRLDDGRWHPVELKMNGDSLLLWVDGKEMLCLRQISASLADHSQRSMRIALGGLLLPTSKLRFPLVPALDGCIRRDIWLGHQAQLSASPRTSLGNCDVDLQPGLFFPPGTHAEFSLQDIPQPHADPWTFSLELGFKLVDGSGQLLALGTGTNSSWLNIHLQNQSVVLSSEAEPKVVLPLDVGLPLQLTLDRVKVVLSQGPKMEVLSMSLLRPASLWRLWSHPQGHLSLGALPGESSSASFCLSDFWVQGQRLDIDQALSRSQDIWTHSCPQRPSNDTRTSH", "length": 403 }, "evidence": [ { "id": "45919044", "url": "http://www.informatics.jax.org/homology/45919044", "database": "MGI" }, { "id": "P04278", "url": "https://omabrowser.org/oma/group/P04278/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "androgen binding", "id": "GO:0005497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005497", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "pmid": "" }, { "name": "steroid binding", "id": "GO:0005496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005496", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "sex hormone-binding globulin N-glycosylated 1 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G37320GX. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G37320GX. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053386", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053386" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 2 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G56749GV. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G56749GV. [PRO:DNx, PMID:6684483]", "evidence": [ { "id": "PR:000053387", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053387" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 3 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053388", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053388" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 4 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G69062KW. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G69062KW. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053389", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053389" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 5 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G81413UE. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G81413UE. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053390", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053390" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 6 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:6684483]", "evidence": [ { "id": "PR:000053391", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053391" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 7 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-380 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G87433AX. Example: UniProtKB:P04278-1, Asn-380, MOD:00160~GNO:G87433AX. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053392", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053392" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 8 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053393", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053393" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 9 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G37320GX. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G37320GX. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053394", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053394" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 10 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G56749GV. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G56749GV. [PRO:DNx, PMID:6684483]", "evidence": [ { "id": "PR:000053395", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053395" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 11 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053396", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053396" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 12 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G69062KW. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G69062KW. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053397", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053397" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 13 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G81413UE. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G81413UE. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053398", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053398" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 14 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:6684483]", "evidence": [ { "id": "PR:000053399", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053399" } ] }, { "name": "sex hormone-binding globulin N-glycosylated 15 (human)", "definition": "A sex hormone-binding globulin (human) that has been N-glycosylated at the residue equivalent to Asn-396 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G87433AX. Example: UniProtKB:P04278-1, Asn-396, MOD:00160~GNO:G87433AX. [PRO:DNx, PMID:23001782]", "evidence": [ { "id": "PR:000053400", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053400" } ] }, { "name": "sex hormone-binding globulin O-glycosylated 1 (human)", "definition": "A sex hormone-binding globulin (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P04278-1, Thr-36, MOD:00005~GNO:G01614ZM. [PRO:DNx, PMID:23001782, PMID:6684483]", "evidence": [ { "id": "PR:000053401", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053401" } ] }, { "name": "sex hormone-binding globulin O-glycosylated 2 (human)", "definition": "A sex hormone-binding globulin (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04278-1, Thr-36, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053402", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053402" } ] }, { "name": "sex hormone-binding globulin O-glycosylated 3 (human)", "definition": "A sex hormone-binding globulin (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P04278-1, Thr-36, MOD:00005~GNO:G56682BC. [PRO:DNx, PMID:6684483]", "evidence": [ { "id": "PR:000053403", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053403" } ] }, { "name": "sex hormone-binding globulin O-glycosylated 4 (human)", "definition": "A sex hormone-binding globulin (human) that has been O-glycosylated at the residue equivalent to Thr-36 of the amino acid sequence represented by UniProtKB:P04278-1, in which the glycan structure is represented by GlyTouCan:G65562ZE. Example: UniProtKB:P04278-1, Thr-36, MOD:00005~GNO:G65562ZE. [PRO:DNx, PMID:23001782, PMID:6684483]", "evidence": [ { "id": "PR:000053404", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053404" } ] } ], "site_annotation": [ { "start_pos": 380, "end_pos": 382, "annotation": "n_glycosylation_sequon" }, { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Variant Asn-356 contains one N-linked (GlcNAc...) at position 356.", "evidence": [ { "database": "UniProtKB", "id": "P04278", "url": "https://www.uniprot.org/uniprot/P04278" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "1400872", "url": "https://glygen.org/publication/PubMed/1400872" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 380, 396 ], "o_linked_sites": [ 36 ], "snv_sites": [ 36, 65, 69, 356, 380, 382, 398 ], "glycation_sites": [], "phosphorylation_sites": [ 86 ], "sequon_annotation_sites": [ { "start_pos": 380, "end_pos": 382 }, { "start_pos": 396, "end_pos": 398 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 34 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 12 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 12 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }