{ "uniprot_canonical_ac": "P04114-1", "uniprot_ac": "P04114", "uniprot_id": "APOB_HUMAN", "mass": { "chemical_mass": 515545.0, "monoisotopic_mass": 515545.0 }, "refseq": { "ac": "NP_000375", "name": "apolipoprotein B-100 precursor", "summary": "This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins (LDL), and is the ligand for the LDL receptor. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq, Dec 2019].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" }, "gene_names": [ { "name": "APOB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04114", "id": "P04114" }, { "name": "APOB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375", "id": "NP_000375" }, { "name": "apoB-100; apoB-48; FCHL2; FLDB; LDLCQ4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375", "id": "NP_000375" } ], "protein_names": [ { "name": "Apolipoprotein B-100", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04114" }, { "name": "Apo B-100", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04114" }, { "name": "apolipoprotein B-100 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375", "id": "NP_000375" }, { "name": "apolipoprotein B-100; apolipoprotein B48; apolipoprotein B (including Ag(x) antigen)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375", "id": "NP_000375" } ], "function": [ { "annotation": "Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114#function" } ] }, { "annotation": "Association of APO B gene polymorphisms with the development of myocardial infarction in Pakistani population.", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" }, { "database": "PubMed", "id": "38042210", "url": "https://glygen.org/publication/PubMed/38042210" } ] }, { "annotation": "Associations between apolipoprotein B and bone mineral density: a population-based study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" }, { "database": "PubMed", "id": "37919727", "url": "https://glygen.org/publication/PubMed/37919727" } ] }, { "annotation": "Integrative bioinformatics analysis identifies APOB as a critical biomarker in coronary in-stent restenosis.", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" }, { "database": "PubMed", "id": "38223945", "url": "https://glygen.org/publication/PubMed/38223945" } ] }, { "annotation": "The relationship between genetic liver fat and coronary heart disease is explained by apoB-containing lipoproteins.", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" }, { "database": "PubMed", "id": "38102060", "url": "https://glygen.org/publication/PubMed/38102060" } ] }, { "annotation": "This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins (LDL), and is the ligand for the LDL receptor. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq, Dec 2019].", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" } ] } ], "disease": [ { "disease_id": "DOID:0111062", "recommended_name": { "id": "DOID:0111062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111062", "name": "familial hypobetalipoproteinemia 1", "description": "A hypobetalipoproteinemia that has_material_basis_in mutation in the APOB gene on chromosome 2p24." }, "synonyms": [ { "id": "DOID:0111062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111062", "name": "FHBL1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia 1", "description": "Any hypobetalipoproteinemia in which the cause of the disease is a mutation in the APOB gene." }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "APOB hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "FHBL1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia type 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia caused by mutation in APOB", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial, type 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "FHBL", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "acanthocytosis with hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, Normotriglyceridemic", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial, 1", "description": "" }, { "id": "MIM:615558", "resource": "MIM", "url": "https://www.omim.org/entry/615558", "name": "Hypobetalipoproteinemia, familial, 1", "description": "Hypobetalipoproteinemia, familial, 1" } ], "evidence": [ { "id": "615558", "database": "MIM", "url": "https://www.omim.org/entry/615558" } ] }, { "disease_id": "MONDO:0007751", "recommended_name": { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "hypercholesterolemia, autosomal dominant, type B", "description": "" }, "synonyms": [ { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "hypercholesterolemia, autosomal dominant, type B", "description": "" }, { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "hypercholesterolemia, familial, 2", "description": "" }, { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "apolipoprotein B-100, familial defective", "description": "" }, { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "apolipoprotein B-100, familial ligand-defective", "description": "" }, { "id": "MONDO:0007751", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007751", "name": "hypercholesterolemia, familial, due to ligand-defective apolipoprotein B", "description": "" }, { "id": "MIM:144010", "resource": "MIM", "url": "https://www.omim.org/entry/144010", "name": "Hypercholesterolemia, familial, 2", "description": "Hypercholesterolemia, familial, 2" } ], "evidence": [ { "id": "144010", "database": "MIM", "url": "https://www.omim.org/entry/144010" } ] } ], "snv": [ { "evidence": [ { "id": "rs763878189", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763878189" }, { "id": "rs763878189", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763878189" }, { "id": "rs763878189", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763878189" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 200, "end_pos": 200, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).", "chr_id": "2", "chr_pos": "21037195", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A200", "disease": [ { "disease_id": "DOID:0111062", "recommended_name": { "id": "DOID:0111062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111062", "name": "familial hypobetalipoproteinemia 1", "description": "A hypobetalipoproteinemia that has_material_basis_in mutation in the APOB gene on chromosome 2p24." }, "synonyms": [ { "id": "DOID:0111062", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111062", "name": "FHBL1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia 1", "description": "Any hypobetalipoproteinemia in which the cause of the disease is a mutation in the APOB gene." }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "APOB hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "FHBL1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "familial hypobetalipoproteinemia type 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia caused by mutation in APOB", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial, type 1", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "FHBL", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "acanthocytosis with hypobetalipoproteinemia", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, Normotriglyceridemic", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial", "description": "" }, { "id": "MONDO:0014252", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014252", "name": "hypobetalipoproteinemia, familial, 1", "description": "" }, { "id": "MIM:615558", "resource": "MIM", "url": "https://www.omim.org/entry/615558", "name": "Hypobetalipoproteinemia, familial, 1", "description": "Hypobetalipoproteinemia, familial, 1" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1321025524", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321025524" }, { "id": "rs1321025524", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1321025524" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 34, "end_pos": 34, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->DVS).", "chr_id": "2", "chr_pos": "21043534", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N34", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1439559056", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1439559056" }, { "id": "rs1439559056", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1439559056#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "2", "chr_pos": "21042419", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S60", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 483, "end_pos": 483, "sequence_org": "D", "sequence_mut": "N", "comment": "Impairs protein secretion.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "12551903", "url": "https://glygen.org/publication/PubMed/12551903" } ] }, { "start_pos": 483, "end_pos": 483, "sequence_org": "D", "sequence_mut": "Q", "comment": "Does not affect protein secretion.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "12551903", "url": "https://glygen.org/publication/PubMed/12551903" } ] }, { "start_pos": 490, "end_pos": 490, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs protein secretion.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "12551903", "url": "https://glygen.org/publication/PubMed/12551903" } ] }, { "start_pos": 490, "end_pos": 490, "sequence_org": "R", "sequence_mut": "K", "comment": "Does not affect protein secretion.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "12551903", "url": "https://glygen.org/publication/PubMed/12551903" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.04", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "61.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "49.33", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "50.4", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "40.13", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "46.69", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "52.46", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04114", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04114" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "common_name": "Human" } ], "gene": [ { "name": "APOB", "url": "https://www.uniprot.org/uniprot/P04114", "locus": { "chromosome": "2", "start_pos": 21001429, "end_pos": 21044073, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000084674", "url": "https://www.ensembl.org/id/ENSG00000084674" } ] } } ], "crossref": [ { "id": "ENSG00000084674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000084674", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL4549", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4549", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "APOB", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APOB", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "338", "url": "https://www.ncbi.nlm.nih.gov/gene/338", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "603", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=603", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04114", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04114*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001747", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001747", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009454", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009454", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015255", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015255", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015816", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015816", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015817", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015817", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015819", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015819", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022176", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022176", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:338", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:338", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107730", "url": "http://www.omim.org/entry/107730", "database": "MIM", "categories": [ "Other" ] }, { "id": "144010", "url": "http://www.omim.org/entry/144010", "database": "MIM", "categories": [ "Other" ] }, { "id": "615558", "url": "http://www.omim.org/entry/615558", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04114", "url": "https://www.nextprot.org/entry/NX_P04114", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P04114", "url": "https://oglcnac.org/atlas/detail/P04114", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P04114", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04114", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "5349904at2759", "url": "http://www.orthodb.org/?query=5349904at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13769", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13769", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13769:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13769:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01347", "url": "http://pfam.xfam.org/family/PF01347", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06448", "url": "http://pfam.xfam.org/family/PF06448", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09172", "url": "http://pfam.xfam.org/family/PF09172", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12491", "url": "http://pfam.xfam.org/family/PF12491", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04114", "url": "https://pharos.nih.gov/targets/P04114", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053267", "url": "https://proconsortium.org/app/entry/PR:000053267", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053268", "url": "https://proconsortium.org/app/entry/PR:000053268", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053269", "url": "https://proconsortium.org/app/entry/PR:000053269", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053270", "url": "https://proconsortium.org/app/entry/PR:000053270", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053271", "url": "https://proconsortium.org/app/entry/PR:000053271", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053272", "url": "https://proconsortium.org/app/entry/PR:000053272", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053273", "url": "https://proconsortium.org/app/entry/PR:000053273", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053274", "url": "https://proconsortium.org/app/entry/PR:000053274", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053275", "url": "https://proconsortium.org/app/entry/PR:000053275", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053276", "url": "https://proconsortium.org/app/entry/PR:000053276", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053277", "url": "https://proconsortium.org/app/entry/PR:000053277", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053278", "url": "https://proconsortium.org/app/entry/PR:000053278", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053279", "url": "https://proconsortium.org/app/entry/PR:000053279", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053280", "url": "https://proconsortium.org/app/entry/PR:000053280", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053281", "url": "https://proconsortium.org/app/entry/PR:000053281", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053282", "url": "https://proconsortium.org/app/entry/PR:000053282", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053283", "url": "https://proconsortium.org/app/entry/PR:000053283", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053284", "url": "https://proconsortium.org/app/entry/PR:000053284", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053285", "url": "https://proconsortium.org/app/entry/PR:000053285", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053286", "url": "https://proconsortium.org/app/entry/PR:000053286", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053287", "url": "https://proconsortium.org/app/entry/PR:000053287", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053288", "url": "https://proconsortium.org/app/entry/PR:000053288", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053289", "url": "https://proconsortium.org/app/entry/PR:000053289", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053290", "url": "https://proconsortium.org/app/entry/PR:000053290", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053291", "url": "https://proconsortium.org/app/entry/PR:000053291", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053292", "url": "https://proconsortium.org/app/entry/PR:000053292", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053293", "url": "https://proconsortium.org/app/entry/PR:000053293", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053294", "url": "https://proconsortium.org/app/entry/PR:000053294", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053295", "url": "https://proconsortium.org/app/entry/PR:000053295", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053296", "url": "https://proconsortium.org/app/entry/PR:000053296", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053297", "url": "https://proconsortium.org/app/entry/PR:000053297", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053298", "url": "https://proconsortium.org/app/entry/PR:000053298", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053299", "url": "https://proconsortium.org/app/entry/PR:000053299", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053300", "url": "https://proconsortium.org/app/entry/PR:000053300", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053301", "url": "https://proconsortium.org/app/entry/PR:000053301", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053302", "url": "https://proconsortium.org/app/entry/PR:000053302", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053303", "url": "https://proconsortium.org/app/entry/PR:000053303", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053304", "url": "https://proconsortium.org/app/entry/PR:000053304", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053305", "url": "https://proconsortium.org/app/entry/PR:000053305", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053306", "url": "https://proconsortium.org/app/entry/PR:000053306", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053307", "url": "https://proconsortium.org/app/entry/PR:000053307", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053308", "url": "https://proconsortium.org/app/entry/PR:000053308", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053309", "url": "https://proconsortium.org/app/entry/PR:000053309", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053310", "url": "https://proconsortium.org/app/entry/PR:000053310", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053311", "url": "https://proconsortium.org/app/entry/PR:000053311", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053312", "url": "https://proconsortium.org/app/entry/PR:000053312", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053313", "url": "https://proconsortium.org/app/entry/PR:000053313", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P04114", "url": "http://purl.obolibrary.org/obo/PR_P04114", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-432142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964026", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04114", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A669KB70", "url": "https://www.uniprot.org/uniprot/A0A669KB70", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A669KB70-1", "url": "https://www.uniprot.org/uniprot/A0A669KB70-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MUN2", "url": "https://www.uniprot.org/uniprot/A8MUN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MUN2-1", "url": "https://www.uniprot.org/uniprot/A8MUN2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04114-1", "url": "https://www.uniprot.org/uniprot/P04114-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSDLKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVEDIPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILPSLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALVQVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSASLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEEDGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFPRFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQDFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELTIIL", "length": 4563, "header": "sp|P04114-1|APOB_HUMAN Isoform 1 of Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=3 CANONICAL=P04114-1" }, "isoforms": [ { "isoform_ac": "A0A669KB70-1", "url": "", "sequence": { "sequence": "MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRIPCMETAPLTLPSRRGRAMWQQKYPLKETWGSVIASSPSAQASAHLLSSKA", "length": 179, "header": "tr|A0A669KB70-1|APOB_HUMAN Computationally mapped isoform of Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2 CANONICAL=P04114-1" }, "locus": {} }, { "isoform_ac": "A8MUN2-1", "url": "", "sequence": { "sequence": "MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMDRPDSLTIPAAQARKDACTFFRDGGLP", "length": 828, "header": "tr|A8MUN2-1|APOB_HUMAN Computationally mapped isoform of Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2 CANONICAL=P04114-1" }, "locus": { "chromosome": "2", "start_pos": 21043945, "end_pos": 21024797, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000399256.4", "url": "https://www.ensembl.org/id/ENST00000399256.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000382200.4", "url": "https://www.ensembl.org/id/ENSP00000382200.4" } ] } }, { "isoform_ac": "P04114-1", "url": "", "sequence": { "sequence": "MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSDLKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVEDIPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILPSLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALVQVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSASLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEEDGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFPRFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQDFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELTIIL", "length": 4563, "header": "sp|P04114-1|APOB_HUMAN Isoform 1 of Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=3 CANONICAL=P04114-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1318, "start_aa": "Thr", "end_pos": 1318, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1318", "evidence": [ { "id": "P04114", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P04114" }, { "id": "34105348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34105348" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1368, "start_aa": "Asn", "end_pos": 1368, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1368", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1377, "start_aa": "Asn", "end_pos": 1377, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1377", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N1523", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N1523" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1523, "start_aa": "Asn", "end_pos": 1523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1523", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 185, "start_aa": "Asn", "end_pos": 185, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn185", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "P04114@N2239", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N2239" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2239, "start_aa": "Asn", "end_pos": 2239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2239", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2560, "start_aa": "Asn", "end_pos": 2560, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2560", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2779, "start_aa": "Asn", "end_pos": 2779, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2779", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2779, "start_aa": "Asn", "end_pos": 2779, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2779", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N2982", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N2982" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "P04114@N2982", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N2982" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N2982", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N2982" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2982, "start_aa": "Asn", "end_pos": 2982, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2982", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3101, "start_aa": "Asn", "end_pos": 3101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3101", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "NNALDFVTK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 3213, "start_aa": "Asn", "end_pos": 3221, "end_aa": "Lys", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "NNALDFVTKSYNETK", "relation": "attached", "comment": "", "start_pos": 3213, "start_aa": "Asn", "end_pos": 3227, "end_aa": "Lys", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 3220, "start_aa": "Thr", "end_pos": 3220, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3220", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3224, "start_aa": "Asn", "end_pos": 3224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3224", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3224, "start_aa": "Asn", "end_pos": 3224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3224", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3264, "start_aa": "Thr", "end_pos": 3264, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3264", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3336, "start_aa": "Asn", "end_pos": 3336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3336", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3336, "start_aa": "Asn", "end_pos": 3336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3336", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3336, "start_aa": "Asn", "end_pos": 3336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3336", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3358, "start_aa": "Asn", "end_pos": 3358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3358", "evidence": [ { "id": "P04114@N3358", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3358" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3358, "start_aa": "Asn", "end_pos": 3358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3358", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N3411", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3411" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N3411", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3411" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114@N3411", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3411" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N3411", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3411" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G71560PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3411, "start_aa": "Asn", "end_pos": 3411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3411", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N3465", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3465" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3465, "start_aa": "Asn", "end_pos": 3465, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3465", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3512, "start_aa": "Thr", "end_pos": 3512, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3512", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3605, "start_aa": "Ser", "end_pos": 3605, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3605", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3748, "start_aa": "Thr", "end_pos": 3748, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3748", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3854, "start_aa": "Thr", "end_pos": 3854, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3854", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04114@N3895", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3895" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "P04114@N3895", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3895" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "P04114@N3895", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N3895" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3895, "start_aa": "Asn", "end_pos": 3895, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3895", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "AASGTTGTYQEWK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 4133, "start_aa": "Ala", "end_pos": 4145, "end_aa": "Lys", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 4137, "start_aa": "Thr", "end_pos": 4137, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr4137", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 4138, "start_aa": "Thr", "end_pos": 4138, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr4138", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 4237, "start_aa": "Asn", "end_pos": 4237, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4237", "evidence": [ { "id": "P04114@N4237", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04114@N4237" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 4237, "start_aa": "Asn", "end_pos": 4237, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4237", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 4351, "start_aa": "Asn", "end_pos": 4351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4351", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 4351, "start_aa": "Asn", "end_pos": 4351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4351", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 4351, "start_aa": "Asn", "end_pos": 4351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4351", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 4351, "start_aa": "Asn", "end_pos": 4351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4351", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 4431, "start_aa": "Asn", "end_pos": 4431, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn4431", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "P04114", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 983, "start_aa": "Asn", "end_pos": 983, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn983", "evidence": [ { "id": "P04114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G04689DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G10073SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G15956KF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" } ] }, { "glytoucan_ac": "G22340YC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G28839WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G34449FW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G36598FV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G37020YV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G37369XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G44306ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P04114", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04114" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "34105348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34105348" } ] }, { "glytoucan_ac": "G49447IS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" } ] }, { "glytoucan_ac": "G61151LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G62785VB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G67381VP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G76014WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G77852EK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G79167DN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G79982IL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G80123ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G88509SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G97101NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "11588155", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "glytoucan_ac": "G98719SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "57", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/57" }, { "id": "4043085", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4043085" } ] } ], "phosphorylation": [ { "start_pos": 1242, "end_pos": 1242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "32387766", "url": "" } ], "site_lbl": "Ser1242" }, { "start_pos": 1714, "end_pos": 1714, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr1714" }, { "start_pos": 1723, "end_pos": 1723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1723" }, { "start_pos": 2018, "end_pos": 2018, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr2018" }, { "start_pos": 2022, "end_pos": 2022, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser2022" }, { "start_pos": 2515, "end_pos": 2515, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Thr2515" }, { "start_pos": 2707, "end_pos": 2707, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr2707" }, { "start_pos": 2759, "end_pos": 2759, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "32387766", "url": "" } ], "site_lbl": "Tyr2759" }, { "start_pos": 3279, "end_pos": 3279, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "site_lbl": "Ser3279" }, { "start_pos": 3776, "end_pos": 3776, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr3776" }, { "start_pos": 3778, "end_pos": 3778, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser3778" }, { "start_pos": 4048, "end_pos": 4048, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Ser4048" }, { "start_pos": 4052, "end_pos": 4052, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "site_lbl": "Thr4052" }, { "start_pos": 4409, "end_pos": 4409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser4409" }, { "start_pos": 4507, "end_pos": 4507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ], "site_lbl": "Ser4507" }, { "start_pos": 4510, "end_pos": 4510, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ], "site_lbl": "Tyr4510" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser520" }, { "start_pos": 928, "end_pos": 928, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser928" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The beta2-adrenergic receptor/betaarrestin complex recruits the clathrin adaptor AP-2 during endocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Laporte SA, Oakley RH, Zhang J, Holt JA, Ferguson SS, Caron MG, Barak LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10097102", "url": "https://glygen.org/publication/PubMed/10097102" } ] }, { "title": "Uptake and fate of class B scavenger receptor ligands in HepG2 cells.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Rhainds D, Falstrault L, Tremblay C, Brissette L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10103054", "url": "https://glygen.org/publication/PubMed/10103054" } ] }, { "title": "Antipeptide antibodies reveal interrelationships of MBP 200 and MBP 235: unique apoB-specific receptors for triglyceride-rich lipoproteins on human monocyte-macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Bradley WA, Brown ML, Ramprasad MP, Li R, Song R, Gianturco SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "10191299", "url": "https://glygen.org/publication/PubMed/10191299" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Molecular cloning of a lipolysis-stimulated remnant receptor expressed in the liver.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yen FT, Masson M, Clossais-Besnard N, Andre P, Grosset JM, Bougueleret L, Dumas JB, Guerassimenko O, Bihain BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "10224102", "url": "https://glygen.org/publication/PubMed/10224102" } ] }, { "title": "Role of the scavenger receptor MARCO in alveolar macrophage binding of unopsonized environmental particles.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Palecanda A, Paulauskis J, Al-Mutairi E, Imrich A, Qin G, Suzuki H, Kodama T, Tryggvason K, Koziel H, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10224290", "url": "https://glygen.org/publication/PubMed/10224290" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Tebar F, Bohlander SK, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10436022", "url": "https://glygen.org/publication/PubMed/10436022" } ] }, { "title": "Human acyl-CoA:cholesterol acyltransferase-1 in the endoplasmic reticulum contains seven transmembrane domains.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Lin S, Cheng D, Liu MS, Chen J, Chang TY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "10438503", "url": "https://glygen.org/publication/PubMed/10438503" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rosenthal JA, Chen H, Slepnev VI, Pellegrini L, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10567358", "url": "https://glygen.org/publication/PubMed/10567358" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Doria M, Salcini AE, Colombo E, Parslow TG, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10613896", "url": "https://glygen.org/publication/PubMed/10613896" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "Molecular characterization of a human scavenger receptor, human MARCO.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Elshourbagy NA, Li X, Terrett J, Vanhorn S, Gross MS, Adamou JE, Anderson KM, Webb CL, Lysko PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10651831", "url": "https://glygen.org/publication/PubMed/10651831" } ] }, { "title": "Palmitoylation of apolipoprotein B is required for proper intracellular sorting and transport of cholesteroyl esters and triglycerides.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Zhao Y, McCabe JB, Vance J, Berthiaume LG", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "10679026", "url": "https://glygen.org/publication/PubMed/10679026" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Selective adhesion of macrophages to denatured forms of type I collagen is mediated by scavenger receptors.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2000", "authors": "Gowen BB, Borg TK, Ghaffar A, Mayer EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10686426", "url": "https://glygen.org/publication/PubMed/10686426" } ] }, { "title": "Macrophage class A scavenger receptor-mediated phagocytosis of Escherichia coli: role of cell heterogeneity, microbial strain, and culture conditions in vitro.", "journal": "Infection and immunity", "date": "2000", "authors": "Peiser L, Gough PJ, Kodama T, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10722588", "url": "https://glygen.org/publication/PubMed/10722588" } ] }, { "title": "The binding of oxidized low density lipoprotein to mouse CD36 is mediated in part by oxidized phospholipids that are associated with both the lipid and protein moieties of the lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boullier A, Gillotte KL, Horkko S, Green SR, Friedman P, Dennis EA, Witztum JL, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10734051", "url": "https://glygen.org/publication/PubMed/10734051" } ] }, { "title": "Kinase pathways in chemoattractant-induced degranulation of neutrophils: the role of p38 mitogen-activated protein kinase activated by Src family kinases.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Mocsai A, Jakus Z, Vantus T, Berton G, Lowell CA, Ligeti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142" } ], "reference": [ { "type": "PubMed", "id": "10754332", "url": "https://glygen.org/publication/PubMed/10754332" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.", "journal": "The Biochemical journal", "date": "2000", "authors": "Oleinikov AV, Zhao J, Makker SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10769163", "url": "https://glygen.org/publication/PubMed/10769163" } ] }, { "title": "Macrophage scavenger receptor CD36 is the major receptor for LDL modified by monocyte-generated reactive nitrogen species.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Podrez EA, Febbraio M, Sheibani N, Schmitt D, Silverstein RL, Hajjar DP, Cohen PA, Frazier WA, Hoff HF, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10772654", "url": "https://glygen.org/publication/PubMed/10772654" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "A macrophage receptor for apolipoprotein B48: cloning, expression, and atherosclerosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Brown ML, Ramprasad MP, Umeda PK, Tanaka A, Kobayashi Y, Watanabe T, Shimoyamada H, Kuo WL, Li R, Song R, Bradley WA, Gianturco SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "10852956", "url": "https://glygen.org/publication/PubMed/10852956" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "Oxidized LDL-induced NF-kappa B activation and subsequent expression of proinflammatory genes are defective in monocyte-derived macrophages from CD36-deficient patients.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2000", "authors": "Janabi M, Yamashita S, Hirano K, Sakai N, Hiraoka H, Matsumoto K, Zhang Z, Nozaki S, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10938017", "url": "https://glygen.org/publication/PubMed/10938017" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "The hPLIC proteins may provide a link between the ubiquitination machinery and the proteasome.", "journal": "Molecular cell", "date": "2000", "authors": "Kleijnen MF, Shih AH, Zhou P, Kumar S, Soccio RE, Kedersha NL, Gill G, Howley PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10983987", "url": "https://glygen.org/publication/PubMed/10983987" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "Multiple C-terminal motifs of the 46-kDa mannose 6-phosphate receptor tail contribute to efficient binding of medium chains of AP-2 and AP-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Storch S, Braulke T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11071885", "url": "https://glygen.org/publication/PubMed/11071885" } ] }, { "title": "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Mah AL, Perry G, Smith MA, Monteiro MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11076969", "url": "https://glygen.org/publication/PubMed/11076969" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Morris SM, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11247302", "url": "https://glygen.org/publication/PubMed/11247302" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Apolipoproteins C-I and C-III as important modulators of lipoprotein metabolism.", "journal": "Current opinion in lipidology", "date": "2001", "authors": "Shachter NS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423" } ], "reference": [ { "type": "PubMed", "id": "11353333", "url": "https://glygen.org/publication/PubMed/11353333" } ] }, { "title": "Intracellular assembly of VLDL: two major steps in separate cell compartments.", "journal": "Trends in cardiovascular medicine", "date": "2000", "authors": "Olofsson SO, Stillemark-Billton P, Asp L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423" } ], "reference": [ { "type": "PubMed", "id": "11369260", "url": "https://glygen.org/publication/PubMed/11369260" } ] }, { "title": "Heme mediates derepression of Maf recognition element through direct binding to transcription repressor Bach1.", "journal": "The EMBO journal", "date": "2001", "authors": "Ogawa K, Sun J, Taketani S, Nakajima O, Nishitani C, Sassa S, Hayashi N, Yamamoto M, Shibahara S, Fujita H, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "11387216", "url": "https://glygen.org/publication/PubMed/11387216" } ] }, { "title": "Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.", "journal": "EMBO reports", "date": "2001", "authors": "Walther K, Krauss M, Diril MK, Lemke S, Ricotta D, Honing S, Kaiser S, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11454741", "url": "https://glygen.org/publication/PubMed/11454741" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Fibrinogen stimulates macrophage chemokine secretion through toll-like receptor 4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Smiley ST, King JA, Hancock WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11509636", "url": "https://glygen.org/publication/PubMed/11509636" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "The membrane-type collectin CL-P1 is a scavenger receptor on vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ohtani K, Suzuki Y, Eda S, Kawai T, Kase T, Keshi H, Sakai Y, Fukuoh A, Sakamoto T, Itabe H, Suzutani T, Ogasawara M, Yoshida I, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "11564734", "url": "https://glygen.org/publication/PubMed/11564734" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Acyl-coenzyme A: cholesterol acyltransferase modulates the generation of the amyloid beta-peptide.", "journal": "Nature cell biology", "date": "2001", "authors": "Puglielli L, Konopka G, Pack-Chung E, Ingano LA, Berezovska O, Hyman BT, Chang TY, Tanzi RE, Kovacs DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "11584272", "url": "https://glygen.org/publication/PubMed/11584272" } ] }, { "title": "Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles.", "journal": "Glycobiology", "date": "2001", "authors": "Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM", "evidence": [ { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "11588155", "url": "https://glygen.org/publication/PubMed/11588155" } ] }, { "title": "Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Shenoy SK, McDonald PH, Kohout TA, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11588219", "url": "https://glygen.org/publication/PubMed/11588219" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "Surfactant protein A inhibits peptidoglycan-induced tumor necrosis factor-alpha secretion in U937 cells and alveolar macrophages by direct interaction with toll-like receptor 2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Murakami S, Iwaki D, Mitsuzawa H, Sano H, Takahashi H, Voelker DR, Akino T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "11724772", "url": "https://glygen.org/publication/PubMed/11724772" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "Arginine residues in domain V have a central role for bacteria-binding activity of macrophage scavenger receptor MARCO.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Brannstrom A, Sankala M, Tryggvason K, Pikkarainen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "11820786", "url": "https://glygen.org/publication/PubMed/11820786" } ] }, { "title": "Reconstituted discoidal ApoE-phospholipid particles are ligands for the scavenger receptor BI. The amino-terminal 1-165 domain of ApoE suffices for receptor binding.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Kan HY, Lavrentiadou S, Krieger M, Zannis V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11861652", "url": "https://glygen.org/publication/PubMed/11861652" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.", "journal": "Nature", "date": "2002", "authors": "Polo S, Sigismund S, Faretta M, Guidi M, Capua MR, Bossi G, Chen H, De Camilli P, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11919637", "url": "https://glygen.org/publication/PubMed/11919637" } ] }, { "title": "Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.", "journal": "The EMBO journal", "date": "2002", "authors": "Morris SM, Tallquist MD, Rock CO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11927540", "url": "https://glygen.org/publication/PubMed/11927540" } ] }, { "title": "CD36 mediates the cardiovascular action of growth hormone-releasing peptides in the heart.", "journal": "Circulation research", "date": "2002", "authors": "Bodart V, Febbraio M, Demers A, McNicoll N, Pohankova P, Perreault A, Sejlitz T, Escher E, Silverstein RL, Lamontagne D, Ong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11988484", "url": "https://glygen.org/publication/PubMed/11988484" } ] }, { "title": "Epsins and Vps27p/Hrs contain ubiquitin-binding domains that function in receptor endocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Shih SC, Katzmann DJ, Schnell JD, Sutanto M, Emr SD, Hicke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11988742", "url": "https://glygen.org/publication/PubMed/11988742" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Adachi H, Tsujimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12077138", "url": "https://glygen.org/publication/PubMed/12077138" } ] }, { "title": "Molecular architecture and functional model of the endocytic AP2 complex.", "journal": "Cell", "date": "2002", "authors": "Collins BM, McCoy AJ, Kent HM, Evans PR, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12086608", "url": "https://glygen.org/publication/PubMed/12086608" } ] }, { "title": "Identification of a novel family of oxidized phospholipids that serve as ligands for the macrophage scavenger receptor CD36.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Podrez EA, Poliakov E, Shen Z, Zhang R, Deng Y, Sun M, Finton PJ, Shan L, Gugiu B, Fox PL, Hoff HF, Salomon RG, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12105195", "url": "https://glygen.org/publication/PubMed/12105195" } ] }, { "title": "Release of chromatin protein HMGB1 by necrotic cells triggers inflammation.", "journal": "Nature", "date": "2002", "authors": "Scaffidi P, Misteli T, Bianchi ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12110890", "url": "https://glygen.org/publication/PubMed/12110890" } ] }, { "title": "Pro-oxidant and cytotoxic effects of circulating heme.", "journal": "Blood", "date": "2002", "authors": "Jeney V, Balla J, Yachie A, Varga Z, Vercellotti GM, Eaton JW, Balla G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12130498", "url": "https://glygen.org/publication/PubMed/12130498" } ] }, { "title": "Lipid free apolipoprotein E binds to the class B Type I scavenger receptor I (SR-BI) and enhances cholesteryl ester uptake from lipoproteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Bultel-Brienne S, Lestavel S, Pilon A, Laffont I, Tailleux A, Fruchart JC, Siest G, Clavey V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12138091", "url": "https://glygen.org/publication/PubMed/12138091" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "Protective role of phospholipid oxidation products in endotoxin-induced tissue damage.", "journal": "Nature", "date": "2002", "authors": "Bochkov VN, Kadl A, Huber J, Gruber F, Binder BR, Leitinger N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12214235", "url": "https://glygen.org/publication/PubMed/12214235" } ] }, { "title": "ARH is a modular adaptor protein that interacts with the LDL receptor, clathrin, and AP-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "He G, Gupta S, Yi M, Michaely P, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12221107", "url": "https://glygen.org/publication/PubMed/12221107" } ] }, { "title": "Disabled-2 exhibits the properties of a cargo-selective endocytic clathrin adaptor.", "journal": "The EMBO journal", "date": "2002", "authors": "Mishra SK, Keyel PA, Hawryluk MJ, Agostinelli NR, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12234931", "url": "https://glygen.org/publication/PubMed/12234931" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "Hemoprotein Bach1 regulates enhancer availability of heme oxygenase-1 gene.", "journal": "The EMBO journal", "date": "2002", "authors": "Sun J, Hoshino H, Takaku K, Nakajima O, Muto A, Suzuki H, Tashiro S, Takahashi S, Shibahara S, Alam J, Taketo MM, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12356737", "url": "https://glygen.org/publication/PubMed/12356737" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Yao D, Ehrlich M, Henis YI, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12429842", "url": "https://glygen.org/publication/PubMed/12429842" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "The autosomal recessive hypercholesterolemia (ARH) protein interfaces directly with the clathrin-coat machinery.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Mishra SK, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12451172", "url": "https://glygen.org/publication/PubMed/12451172" } ] }, { "title": "Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braun L, Christophe T, Boulay F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12464600", "url": "https://glygen.org/publication/PubMed/12464600" } ] }, { "title": "Restoration of LDL receptor function in cells from patients with autosomal recessive hypercholesterolemia by retroviral expression of ARH1.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Eden ER, Patel DD, Sun XM, Burden JJ, Themis M, Edwards M, Lee P, Neuwirth C, Naoumova RP, Soutar AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "12464675", "url": "https://glygen.org/publication/PubMed/12464675" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "FEEL-1 and FEEL-2 are endocytic receptors for advanced glycation end products.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tamura Y, Adachi H, Osuga J, Ohashi K, Yahagi N, Sekiya M, Okazaki H, Tomita S, Iizuka Y, Shimano H, Nagai R, Kimura S, Tsujimoto M, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12473645", "url": "https://glygen.org/publication/PubMed/12473645" } ] }, { "title": "The class A scavenger receptor binds to proteoglycans and mediates adhesion of macrophages to the extracellular matrix.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Santiago-Garcia J, Kodama T, Pitas RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12488451", "url": "https://glygen.org/publication/PubMed/12488451" } ] }, { "title": "Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kitamuro T, Takahashi K, Ogawa K, Udono-Fujimori R, Takeda K, Furuyama K, Nakayama M, Sun J, Fujita H, Hida W, Hattori T, Shirato K, Igarashi K, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12511571", "url": "https://glygen.org/publication/PubMed/12511571" } ] }, { "title": "Microsomal triglyceride transfer protein and its role in apoB-lipoprotein assembly.", "journal": "Journal of lipid research", "date": "2003", "authors": "Hussain MM, Shi J, Dreizen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12518019", "url": "https://glygen.org/publication/PubMed/12518019" } ] }, { "title": "A novel nontruncating APOB gene mutation, R463W, causes familial hypobetalipoproteinemia.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Burnett JR, Shan J, Miskie BA, Whitfield AJ, Yuan J, Tran K, McKnight CJ, Hegele RA, Yao Z", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "12551903", "url": "https://glygen.org/publication/PubMed/12551903" } ] }, { "title": "Purification and molecular identification of the human hyaluronan receptor for endocytosis.", "journal": "Glycobiology", "date": "2003", "authors": "Zhou B, McGary CT, Weigel JA, Saxena A, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "12626425", "url": "https://glygen.org/publication/PubMed/12626425" } ] }, { "title": "Binding and internalization of lipopolysaccharide by Cla-1, a human orthologue of rodent scavenger receptor B1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Vishnyakova TG, Bocharov AV, Baranova IN, Chen Z, Remaley AT, Csako G, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12651854", "url": "https://glygen.org/publication/PubMed/12651854" } ] }, { "title": "Multifunctional roles of macrophages in the development and progression of atherosclerosis in humans and experimental animals.", "journal": "Medical electron microscopy : official journal of the Clinical Electron Microscopy Society of Japan", "date": "2002", "authors": "Takahashi K, Takeya M, Sakashita N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "12658354", "url": "https://glygen.org/publication/PubMed/12658354" } ] }, { "title": "Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.", "journal": "Nature genetics", "date": "2003", "authors": "Jones B, Jones EL, Bonney SA, Patel HN, Mensenkamp AR, Eichenbaum-Voline S, Rudling M, Myrdal U, Annesi G, Naik S, Meadows N, Quattrone A, Islam SA, Naoumova RP, Angelin B, Infante R, Levy E, Roy CC, Freemont PS, Scott J, Shoulders CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12692552", "url": "https://glygen.org/publication/PubMed/12692552" } ] }, { "title": "PPAR(alpha) and PPAR(gamma) activators suppress the monocyte-macrophage apoB-48 receptor.", "journal": "Journal of lipid research", "date": "2003", "authors": "Haraguchi G, Kobayashi Y, Brown ML, Tanaka A, Isobe M, Gianturco SH, Bradley WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "12700342", "url": "https://glygen.org/publication/PubMed/12700342" } ] }, { "title": "Human apoC-IV: isolation, characterization, and immunochemical quantification in plasma and plasma lipoproteins.", "journal": "Journal of lipid research", "date": "2003", "authors": "Kotite L, Zhang LH, Yu Z, Burlingame AL, Havel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "12700345", "url": "https://glygen.org/publication/PubMed/12700345" } ] }, { "title": "Multiple monoubiquitination of RTKs is sufficient for their endocytosis and degradation.", "journal": "Nature cell biology", "date": "2003", "authors": "Haglund K, Sigismund S, Polo S, Szymkiewicz I, Di Fiore PP, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12717448", "url": "https://glygen.org/publication/PubMed/12717448" } ] }, { "title": "SRCL/CL-P1 recognizes GalNAc and a carcinoma-associated antigen, Tn antigen.", "journal": "Journal of biochemistry", "date": "2003", "authors": "Yoshida T, Tsuruta Y, Iwasaki M, Yamane S, Ochi T, Suzuki R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12761161", "url": "https://glygen.org/publication/PubMed/12761161" } ] }, { "title": "Oxidative stress impairs endocytosis of the scavenger receptor class A.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Aguilar-Gaytan R, Mas-Oliva J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12763022", "url": "https://glygen.org/publication/PubMed/12763022" } ] }, { "title": "Platelet endothelial cell adhesion molecule-1 (PECAM-1) inhibits low density lipoprotein-induced signaling in platelets.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Relou IA, Gorter G, Ferreira IA, van Rijn HJ, Akkerman JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-432142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142" } ], "reference": [ { "type": "PubMed", "id": "12775720", "url": "https://glygen.org/publication/PubMed/12775720" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "Direct binding of Toll-like receptor 2 to zymosan, and zymosan-induced NF-kappa B activation and TNF-alpha secretion are down-regulated by lung collectin surfactant protein A.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Sato M, Sano H, Iwaki D, Kudo K, Konishi M, Takahashi H, Takahashi T, Imaizumi H, Asai Y, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "12817025", "url": "https://glygen.org/publication/PubMed/12817025" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "Identification of uteroglobin-related protein 1 and macrophage scavenger receptor with collagenous structure as a lung-specific ligand-receptor pair.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Bin LH, Nielson LD, Liu X, Mason RJ, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12847263", "url": "https://glygen.org/publication/PubMed/12847263" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Xenopus autosomal recessive hypercholesterolemia protein couples lipoprotein receptors with the AP-2 complex in oocytes and embryos and is required for vitellogenesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhou Y, Zhang J, King ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12944396", "url": "https://glygen.org/publication/PubMed/12944396" } ] }, { "title": "Endocytosis of oxidized low density lipoprotein through scavenger receptor CD36 utilizes a lipid raft pathway that does not require caveolin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zeng Y, Tao N, Chung KN, Heuser JE, Lublin DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12947091", "url": "https://glygen.org/publication/PubMed/12947091" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Chen W, ten Berge D, Brown J, Ahn S, Hu LA, Miller WE, Caron MG, Barak LS, Nusse R, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12958364", "url": "https://glygen.org/publication/PubMed/12958364" } ] }, { "title": "Characterization of the signal for rapid internalization of the bovine mannose 6-phosphate/insulin-like growth factor-II receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Jadot M, Canfield WM, Gregory W, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1317852", "url": "https://glygen.org/publication/PubMed/1317852" } ] }, { "title": "Molecular flypaper, atherosclerosis, and host defense: structure and function of the macrophage scavenger receptor.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "1992", "authors": "Krieger M, Abrams JM, Lux A, Steller H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "1339697", "url": "https://glygen.org/publication/PubMed/1339697" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "Scavenger receptor-A mediates gp96/GRP94 and calreticulin internalization by antigen-presenting cells.", "journal": "The EMBO journal", "date": "2003", "authors": "Berwin B, Hart JP, Rice S, Gass C, Pizzo SV, Post SR, Nicchitta CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "14609958", "url": "https://glygen.org/publication/PubMed/14609958" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "The ubiquitin-related protein PLIC-1 regulates heterotrimeric G protein function through association with Gbetagamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "N'Diaye EN, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14662753", "url": "https://glygen.org/publication/PubMed/14662753" } ] }, { "title": "High density lipoprotein uptake by scavenger receptor SR-BII.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Eckhardt ER, Cai L, Sun B, Webb NR, van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "14726519", "url": "https://glygen.org/publication/PubMed/14726519" } ] }, { "title": "Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Walther K, Diril MK, Jung N, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14726597", "url": "https://glygen.org/publication/PubMed/14726597" } ] }, { "title": "Microsomal triglyceride transfer protein: a protein complex required for the assembly of lipoprotein particles.", "journal": "Trends in cell biology", "date": "1995", "authors": "Gordon DA, Wetterau JR, Gregg RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "14732096", "url": "https://glygen.org/publication/PubMed/14732096" } ] }, { "title": "Hypobetalipoproteinemia with an apparently recessive inheritance due to a 'de novo' mutation of apolipoprotein B.", "journal": "Biochim. Biophys. Acta", "date": "2004", "authors": "Lancellotti S, Di Leo E, Penacchioni JY, Balli F, Viola L, Bertolini S, Calandra S, Tarugi P", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "14732481", "url": "https://glygen.org/publication/PubMed/14732481" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.", "journal": "Biochimie", "date": "2004", "authors": "Gallagher H, Oleinikov AV, Fenske C, Newman DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15134832", "url": "https://glygen.org/publication/PubMed/15134832" } ] }, { "title": "The modular adaptor protein ARH is required for low density lipoprotein (LDL) binding and internalization but not for LDL receptor clustering in coated pits.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Michaely P, Li WP, Anderson RG, Cohen JC, Hobbs HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "15166224", "url": "https://glygen.org/publication/PubMed/15166224" } ] }, { "title": "Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.", "journal": "The EMBO journal", "date": "2004", "authors": "Suzuki H, Tashiro S, Hira S, Sun J, Yamazaki C, Zenke Y, Ikeda-Saito M, Yoshida M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "15175654", "url": "https://glygen.org/publication/PubMed/15175654" } ] }, { "title": "Endocytic function, glycosaminoglycan specificity, and antibody sensitivity of the recombinant human 190-kDa hyaluronan receptor for endocytosis (HARE).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Harris EN, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15208308", "url": "https://glygen.org/publication/PubMed/15208308" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "Distribution of the lipolysis stimulated receptor in adult and embryonic murine tissues and lethality of LSR-/- embryos at 12.5 to 14.5 days of gestation.", "journal": "European journal of biochemistry", "date": "2004", "authors": "Mesli S, Javorschi S, Berard AM, Landry M, Priddle H, Kivlichan D, Smith AJ, Yen FT, Bihain BE, Darmon M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "15265030", "url": "https://glygen.org/publication/PubMed/15265030" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "Rapid plasma membrane-endosomal trafficking of the lymph node sinus and high endothelial venule scavenger receptor/homing receptor stabilin-1 (FEEL-1/CLEVER-1).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Prevo R, Banerji S, Ni J, Jackson DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15345716", "url": "https://glygen.org/publication/PubMed/15345716" } ] }, { "title": "Stabilin-1 localizes to endosomes and the trans-Golgi network in human macrophages and interacts with GGA adaptors.", "journal": "Journal of leukocyte biology", "date": "2004", "authors": "Kzhyshkowska J, Gratchev A, Martens JH, Pervushina O, Mamidi S, Johansson S, Schledzewski K, Hansen B, He X, Tang J, Nakayama K, Goerdt S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15345724", "url": "https://glygen.org/publication/PubMed/15345724" } ] }, { "title": "A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains.", "journal": "Cell", "date": "1992", "authors": "Letourneur F, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1535555", "url": "https://glygen.org/publication/PubMed/1535555" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "SREC-I, a type F scavenger receptor, is an endocytic receptor for calreticulin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Berwin B, Delneste Y, Lovingood RV, Post SR, Pizzo SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "15371419", "url": "https://glygen.org/publication/PubMed/15371419" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Binding of low density lipoprotein to platelet apolipoprotein E receptor 2' results in phosphorylation of p38MAPK.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Korporaal SJ, Relou IA, van Eck M, Strasser V, Bezemer M, Gorter G, van Berkel TJ, Nimpf J, Akkerman JW, Lenting PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-432142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142" } ], "reference": [ { "type": "PubMed", "id": "15459198", "url": "https://glygen.org/publication/PubMed/15459198" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Adaptors for clathrin coats: structure and function.", "journal": "Annual review of cell and developmental biology", "date": "2004", "authors": "Owen DJ, Collins BM, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15473838", "url": "https://glygen.org/publication/PubMed/15473838" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Stabilin-1 and stabilin-2 are both directed into the early endocytic pathway in hepatic sinusoidal endothelium via interactions with clathrin/AP-2, independent of ligand binding.", "journal": "Experimental cell research", "date": "2005", "authors": "Hansen B, Longati P, Elvevold K, Nedredal GI, Schledzewski K, Olsen R, Falkowski M, Kzhyshkowska J, Carlsson F, Johansson S, Smedsrod B, Goerdt S, Johansson S, McCourt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "15572036", "url": "https://glygen.org/publication/PubMed/15572036" } ] }, { "title": "Serum amyloid A binding to CLA-1 (CD36 and LIMPII analogous-1) mediates serum amyloid A protein-induced activation of ERK1/2 and p38 mitogen-activated protein kinases.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Baranova IN, Vishnyakova TG, Bocharov AV, Kurlander R, Chen Z, Kimelman ML, Remaley AT, Csako G, Thomas F, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15576377", "url": "https://glygen.org/publication/PubMed/15576377" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "Pitavastatin inhibits remnant lipoprotein-induced macrophage foam cell formation through ApoB48 receptor-dependent mechanism.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Kawakami A, Tani M, Chiba T, Yui K, Shinozaki S, Nakajima K, Tanaka A, Shimokado K, Yoshida M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "15591219", "url": "https://glygen.org/publication/PubMed/15591219" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "Different G protein-coupled receptor kinases govern G protein and beta-arrestin-mediated signaling of V2 vasopressin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren XR, Reiter E, Ahn S, Kim J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15671180", "url": "https://glygen.org/publication/PubMed/15671180" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "CD36 is a sensor of diacylglycerides.", "journal": "Nature", "date": "2005", "authors": "Hoebe K, Georgel P, Rutschmann S, Du X, Mudd S, Crozat K, Sovath S, Shamel L, Hartung T, Zahringer U, Beutler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15690042", "url": "https://glygen.org/publication/PubMed/15690042" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Functional dissection of an AP-2 beta2 appendage-binding sequence within the autosomal recessive hypercholesterolemia protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Mishra SK, Keyel PA, Edeling MA, Dupin AL, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15728179", "url": "https://glygen.org/publication/PubMed/15728179" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "Endocytosis is not required for the selective lipid uptake mediated by murine SR-BI.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Nieland TJ, Ehrlich M, Krieger M, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15866482", "url": "https://glygen.org/publication/PubMed/15866482" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.", "journal": "Journal of cell science", "date": "2005", "authors": "Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16159959", "url": "https://glygen.org/publication/PubMed/16159959" } ] }, { "title": "Phosphatidylinositide 3-kinase activity is required for stabilin-1-mediated endosomal transport of acLDL.", "journal": "Immunobiology", "date": "2005", "authors": "Kzhyshkowska J, Gratchev A, Brundiers H, Mamidi S, Krusell L, Goerdt S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "16164023", "url": "https://glygen.org/publication/PubMed/16164023" } ] }, { "title": "The modular adaptor protein autosomal recessive hypercholesterolemia (ARH) promotes low density lipoprotein receptor clustering into clathrin-coated pits.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Garuti R, Jones C, Li WP, Michaely P, Herz J, Gerard RD, Cohen JC, Hobbs HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "16179341", "url": "https://glygen.org/publication/PubMed/16179341" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "Surfactant proteins SP-A and SP-D: structure, function and receptors.", "journal": "Molecular immunology", "date": "2006", "authors": "Kishore U, Greenhough TJ, Waters P, Shrive AK, Ghai R, Kamran MF, Bernal AL, Reid KB, Madan T, Chakraborty T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16213021", "url": "https://glygen.org/publication/PubMed/16213021" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "MARCO is the major binding receptor for unopsonized particles and bacteria on human alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Arredouani MS, Palecanda A, Koziel H, Huang YC, Imrich A, Sulahian TH, Ning YY, Yang Z, Pikkarainen T, Sankala M, Vargas SO, Takeya M, Tryggvason K, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16237101", "url": "https://glygen.org/publication/PubMed/16237101" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "CD36 involvement in orosensory detection of dietary lipids, spontaneous fat preference, and digestive secretions.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Laugerette F, Passilly-Degrace P, Patris B, Niot I, Febbraio M, Montmayeur JP, Besnard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16276419", "url": "https://glygen.org/publication/PubMed/16276419" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "High density lipoprotein endocytosis by scavenger receptor SR-BII is clathrin-dependent and requires a carboxyl-terminal dileucine motif.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eckhardt ER, Cai L, Shetty S, Zhao Z, Szanto A, Webb NR, Van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16368683", "url": "https://glygen.org/publication/PubMed/16368683" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.", "journal": "Developmental cell", "date": "2006", "authors": "Diril MK, Wienisch M, Jung N, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16459302", "url": "https://glygen.org/publication/PubMed/16459302" } ] }, { "title": "The structural basis of arrestin-mediated regulation of G-protein-coupled receptors.", "journal": "Pharmacology & therapeutics", "date": "2006", "authors": "Gurevich VV, Gurevich EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16460808", "url": "https://glygen.org/publication/PubMed/16460808" } ] }, { "title": "SR-BI-mediated high density lipoprotein (HDL) endocytosis leads to HDL resecretion facilitating cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pagler TA, Rhode S, Neuhofer A, Laggner H, Strobl W, Hinterndorfer C, Volf I, Pavelka M, Eckhardt ER, van der Westhuyzen DR, Schutz GJ, Stangl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16488891", "url": "https://glygen.org/publication/PubMed/16488891" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "MARCO, an innate activation marker of macrophages, is a class A scavenger receptor for Neisseria meningitidis.", "journal": "European journal of immunology", "date": "2006", "authors": "Mukhopadhyay S, Chen Y, Sankala M, Peiser L, Pikkarainen T, Kraal G, Tryggvason K, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16525990", "url": "https://glygen.org/publication/PubMed/16525990" } ] }, { "title": "Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.", "journal": "Cell. Microbiol.", "date": "2006", "authors": "Leong WF, Chow VT", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "16548883", "url": "https://glygen.org/publication/PubMed/16548883" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "Novel function of alternatively activated macrophages: stabilin-1-mediated clearance of SPARC.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Kzhyshkowska J, Workman G, Cardo-Vila M, Arap W, Pasqualini R, Gratchev A, Krusell L, Goerdt S, Sage EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "16670288", "url": "https://glygen.org/publication/PubMed/16670288" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.", "journal": "Journal of cell science", "date": "2006", "authors": "Schmidt U, Briese S, Leicht K, Schurmann A, Joost HG, Al-Hasani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16723738", "url": "https://glygen.org/publication/PubMed/16723738" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Surfactant protein A directly interacts with TLR4 and MD-2 and regulates inflammatory cellular response. Importance of supratrimeric oligomerization.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yamada C, Sano H, Shimizu T, Mitsuzawa H, Nishitani C, Himi T, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16754682", "url": "https://glygen.org/publication/PubMed/16754682" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "Human pulmonary surfactant protein D binds the extracellular domains of Toll-like receptors 2 and 4 through the carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.", "journal": "Biochemistry", "date": "2006", "authors": "Ohya M, Nishitani C, Sano H, Yamada C, Mitsuzawa H, Shimizu T, Saito T, Smith K, Crouch E, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16834340", "url": "https://glygen.org/publication/PubMed/16834340" } ] }, { "title": "The extracellular release of HMGB1 during apoptotic cell death.", "journal": "American journal of physiology. Cell physiology", "date": "2006", "authors": "Bell CW, Jiang W, Reich CF 3rd, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16855214", "url": "https://glygen.org/publication/PubMed/16855214" } ] }, { "title": "HMGB1 signals through toll-like receptor (TLR) 4 and TLR2.", "journal": "Shock (Augusta, Ga.)", "date": "2006", "authors": "Yu M, Wang H, Ding A, Golenbock DT, Latz E, Czura CJ, Fenton MJ, Tracey KJ, Yang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "16878026", "url": "https://glygen.org/publication/PubMed/16878026" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "Role of scavenger receptor MARCO in macrophage responses to CpG oligodeoxynucleotides.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Jozefowski S, Sulahian TH, Arredouani M, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16882874", "url": "https://glygen.org/publication/PubMed/16882874" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "Identification of Neisseria meningitidis nonlipopolysaccharide ligands for class A macrophage scavenger receptor by using a novel assay.", "journal": "Infection and immunity", "date": "2006", "authors": "Peiser L, Makepeace K, Pluddemann A, Savino S, Wright JC, Pizza M, Rappuoli R, Moxon ER, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16926412", "url": "https://glygen.org/publication/PubMed/16926412" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "MARCO mediates silica uptake and toxicity in alveolar macrophages from C57BL/6 mice.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hamilton RF Jr, Thakur SA, Mayfair JK, Holian A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16984918", "url": "https://glygen.org/publication/PubMed/16984918" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "NPC2, the protein deficient in Niemann-Pick C2 disease, consists of multiple glycoforms that bind a variety of sterols.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Liou HL, Dixit SS, Xu S, Tint GS, Stock AM, Lobel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "17018531", "url": "https://glygen.org/publication/PubMed/17018531" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "Oxidized phosphatidylserine-CD36 interactions play an essential role in macrophage-dependent phagocytosis of apoptotic cells.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Greenberg ME, Sun M, Zhang R, Febbraio M, Silverstein R, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17101731", "url": "https://glygen.org/publication/PubMed/17101731" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "Expression, processing, and glycosaminoglycan binding activity of the recombinant human 315-kDa hyaluronic acid receptor for endocytosis (HARE).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Harris EN, Kyosseva SV, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "17145755", "url": "https://glygen.org/publication/PubMed/17145755" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "Identification and characterization of a novel human collectin CL-K1.", "journal": "Microbiology and immunology", "date": "2006", "authors": "Keshi H, Sakamoto T, Kawai T, Ohtani K, Katoh T, Jang SJ, Motomura W, Yoshizaki T, Fukuda M, Koyama S, Fukuzawa J, Fukuoh A, Yoshida I, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17179669", "url": "https://glygen.org/publication/PubMed/17179669" } ] }, { "title": "Cloning and expression of cDNA encoding human lysosomal acid lipase/cholesteryl ester hydrolase. Similarities to gastric and lingual lipases.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Anderson RA, Sando GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "1718995", "url": "https://glygen.org/publication/PubMed/1718995" } ] }, { "title": "Inhibition of microsomal triglyceride transfer protein in familial hypercholesterolemia.", "journal": "The New England journal of medicine", "date": "2007", "authors": "Cuchel M, Bloedon LT, Szapary PO, Kolansky DM, Wolfe ML, Sarkis A, Millar JS, Ikewaki K, Siegelman ES, Gregg RE, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "17215532", "url": "https://glygen.org/publication/PubMed/17215532" } ] }, { "title": "Crystal structure of cholesteryl ester transfer protein reveals a long tunnel and four bound lipid molecules.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Qiu X, Mistry A, Ammirati MJ, Chrunyk BA, Clark RW, Cong Y, Culp JS, Danley DE, Freeman TB, Geoghegan KF, Griffor MC, Hawrylik SJ, Hayward CM, Hensley P, Hoth LR, Karam GA, Lira ME, Lloyd DB, McGrath KM, Stutzman-Engwall KJ, Subashi AK, Subashi TA, Thompson JF, Wang IK, Zhao H, Seddon AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "17237796", "url": "https://glygen.org/publication/PubMed/17237796" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Downregulation of CD4 by human immunodeficiency virus type 1 Nef is dependent on clathrin and involves direct interaction of Nef with the AP2 clathrin adaptor.", "journal": "Journal of virology", "date": "2007", "authors": "Chaudhuri R, Lindwasser OW, Smith WJ, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17267500", "url": "https://glygen.org/publication/PubMed/17267500" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Protection against inhaled oxidants through scavenging of oxidized lipids by macrophage receptors MARCO and SR-AI/II.", "journal": "The Journal of clinical investigation", "date": "2007", "authors": "Dahl M, Bauer AK, Arredouani M, Soininen R, Tryggvason K, Kleeberger SR, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17332894", "url": "https://glygen.org/publication/PubMed/17332894" } ] }, { "title": "The Src family kinases Hck and Fgr regulate neutrophil responses to N-formyl-methionyl-leucyl-phenylalanine.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Fumagalli L, Zhang H, Baruzzi A, Lowell CA, Berton G", "evidence": [ { "database": "Reactome", "id": "R-HSA-432142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142" } ], "reference": [ { "type": "PubMed", "id": "17339487", "url": "https://glygen.org/publication/PubMed/17339487" } ] }, { "title": "Apolipoprotein C-I binds free fatty acids and reduces their intracellular esterification.", "journal": "Journal of lipid research", "date": "2007", "authors": "Westerterp M, Berbee JF, Delsing DJ, Jong MC, Gijbels MJ, Dahlmans VE, Offerman EH, Romijn JA, Havekes LM, Rensen PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "17339654", "url": "https://glygen.org/publication/PubMed/17339654" } ] }, { "title": "The gamma/sigma1 and alpha/sigma2 hemicomplexes of clathrin adaptors AP-1 and AP-2 harbor the dileucine recognition site.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doray B, Lee I, Knisely J, Bu G, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17360967", "url": "https://glygen.org/publication/PubMed/17360967" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "Binding of proprotein convertase subtilisin/kexin type 9 to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Zhang DW, Lagace TA, Garuti R, Zhao Z, McDonald M, Horton JD, Cohen JC, Hobbs HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "17452316", "url": "https://glygen.org/publication/PubMed/17452316" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "Src-dependent phosphorylation of beta2-adaptin dissociates the beta-arrestin-AP-2 complex.", "journal": "Journal of cell science", "date": "2007", "authors": "Fessart D, Simaan M, Zimmerman B, Comeau J, Hamdan FF, Wiseman PW, Bouvier M, Laporte SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17456551", "url": "https://glygen.org/publication/PubMed/17456551" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Clathrin-dependent entry of severe acute respiratory syndrome coronavirus into target cells expressing ACE2 with the cytoplasmic tail deleted.", "journal": "Journal of virology", "date": "2007", "authors": "Inoue Y, Tanaka N, Tanaka Y, Inoue S, Morita K, Zhuang M, Hattori T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17522231", "url": "https://glygen.org/publication/PubMed/17522231" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "Hsp110 and Grp170, members of the Hsp70 superfamily, bind to scavenger receptor-A and scavenger receptor expressed by endothelial cells-I.", "journal": "European journal of immunology", "date": "2007", "authors": "Facciponte JG, Wang XY, Subjeck JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "17615582", "url": "https://glygen.org/publication/PubMed/17615582" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "Scavenger receptor class-A is a novel cell surface receptor for double-stranded RNA.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Limmon GV, Arredouani M, McCann KL, Corn Minor RA, Kobzik L, Imani F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17709607", "url": "https://glygen.org/publication/PubMed/17709607" } ] }, { "title": "The inhibition of endocytosis affects HDL-lipid uptake mediated by the human scavenger receptor class B type I.", "journal": "Molecular membrane biology", "date": "2007", "authors": "Zhang Y, Ahmed AM, Tran TL, Lin J, McFarlane N, Boreham DR, Igdoura SA, Truant R, Trigatti BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17710648", "url": "https://glygen.org/publication/PubMed/17710648" } ] }, { "title": "Integrating molecular and network biology to decode endocytosis.", "journal": "Nature", "date": "2007", "authors": "Schmid EM, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17713526", "url": "https://glygen.org/publication/PubMed/17713526" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "Mrp8 and Mrp14 are endogenous activators of Toll-like receptor 4, promoting lethal, endotoxin-induced shock.", "journal": "Nature medicine", "date": "2007", "authors": "Vogl T, Tenbrock K, Ludwig S, Leukert N, Ehrhardt C, van Zoelen MA, Nacken W, Foell D, van der Poll T, Sorg C, Roth J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "17767165", "url": "https://glygen.org/publication/PubMed/17767165" } ] }, { "title": "Distinct mechanisms for OxLDL uptake and cellular trafficking by class B scavenger receptors CD36 and SR-BI.", "journal": "Journal of lipid research", "date": "2007", "authors": "Sun B, Boyanovsky BB, Connelly MA, Shridas P, van der Westhuyzen DR, Webb NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17876058", "url": "https://glygen.org/publication/PubMed/17876058" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Rapid cell corpse clearance by stabilin-2, a membrane phosphatidylserine receptor.", "journal": "Cell death and differentiation", "date": "2008", "authors": "Park SY, Jung MY, Kim HJ, Lee SJ, Kim SY, Lee BH, Kwon TH, Park RW, Kim IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "17962816", "url": "https://glygen.org/publication/PubMed/17962816" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "A diacidic motif in human immunodeficiency virus type 1 Nef is a novel determinant of binding to AP-2.", "journal": "Journal of virology", "date": "2008", "authors": "Lindwasser OW, Smith WJ, Chaudhuri R, Yang P, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18032517", "url": "https://glygen.org/publication/PubMed/18032517" } ] }, { "title": "Host glycoprotein Gp96 and scavenger receptor SREC interact with PorB of disseminating Neisseria gonorrhoeae in an epithelial invasion pathway.", "journal": "Cell host & microbe", "date": "2007", "authors": "Rechner C, Kuhlewein C, Muller A, Schild H, Rudel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "18078691", "url": "https://glygen.org/publication/PubMed/18078691" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Jung N, Wienisch M, Gu M, Rand JB, Muller SL, Krause G, Jorgensen EM, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18166656", "url": "https://glygen.org/publication/PubMed/18166656" } ] }, { "title": "The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "N'Diaye EN, Hanyaloglu AC, Kajihara KK, Puthenveedu MA, Wu P, von Zastrow M, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18199683", "url": "https://glygen.org/publication/PubMed/18199683" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "High mobility group box 1 protein binding to lipopolysaccharide facilitates transfer of lipopolysaccharide to CD14 and enhances lipopolysaccharide-mediated TNF-alpha production in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Youn JH, Oh YJ, Kim ES, Choi JE, Shin JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18354232", "url": "https://glygen.org/publication/PubMed/18354232" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "The human hyaluronan receptor for endocytosis (HARE/Stabilin-2) is a systemic clearance receptor for heparin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Harris EN, Weigel JA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "18434317", "url": "https://glygen.org/publication/PubMed/18434317" } ] }, { "title": "Cellular trafficking of lipoteichoic acid and Toll-like receptor 2 in relation to signaling: role of CD14 and CD36.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Nilsen NJ, Deininger S, Nonstad U, Skjeldal F, Husebye H, Rodionov D, von Aulock S, Hartung T, Lien E, Bakke O, Espevik T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18458151", "url": "https://glygen.org/publication/PubMed/18458151" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Oleate stimulates secretion of apolipoprotein B-containing lipoproteins from Hep G2 cells by inhibiting early intracellular degradation of apolipoprotein B.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dixon JL, Furukawa S, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "1848237", "url": "https://glygen.org/publication/PubMed/1848237" } ] }, { "title": "The ligand-binding profile of HARE: hyaluronan and chondroitin sulfates A, C, and D bind to overlapping sites distinct from the sites for heparin, acetylated low-density lipoprotein, dermatan sulfate, and CS-E.", "journal": "Glycobiology", "date": "2008", "authors": "Harris EN, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "18499864", "url": "https://glygen.org/publication/PubMed/18499864" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "Recognition and plasma clearance of endotoxin by scavenger receptors.", "journal": "Nature", "date": "1991", "authors": "Hampton RY, Golenbock DT, Penman M, Krieger M, Raetz CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "1852209", "url": "https://glygen.org/publication/PubMed/1852209" } ] }, { "title": "CD36 N-terminal cytoplasmic domain is not required for the internalization of oxidized low-density lipoprotein.", "journal": "Bioscience reports", "date": "2008", "authors": "McDermott-Roe C, Martin J, Collot-Teixeira S, McGregor JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18558917", "url": "https://glygen.org/publication/PubMed/18558917" } ] }, { "title": "Oxidized phospholipid inhibition of toll-like receptor (TLR) signaling is restricted to TLR2 and TLR4: roles for CD14, LPS-binding protein, and MD2 as targets for specificity of inhibition.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Erridge C, Kennedy S, Spickett CM, Webb DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18559343", "url": "https://glygen.org/publication/PubMed/18559343" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Lipolysis stimulated lipoprotein receptor: a novel molecular link between hyperlipidemia, weight gain, and atherosclerosis in mice.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yen FT, Roitel O, Bonnard L, Notet V, Pratte D, Stenger C, Magueur E, Bihain BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "18644789", "url": "https://glygen.org/publication/PubMed/18644789" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "NPC2 facilitates bidirectional transfer of cholesterol between NPC1 and lipid bilayers, a step in cholesterol egress from lysosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Infante RE, Wang ML, Radhakrishnan A, Kwon HJ, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "18772377", "url": "https://glygen.org/publication/PubMed/18772377" } ] }, { "title": "Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.", "journal": "Cell", "date": "2008", "authors": "Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18775314", "url": "https://glygen.org/publication/PubMed/18775314" } ] }, { "title": "Identification of neutral cholesterol ester hydrolase, a key enzyme removing cholesterol from macrophages.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Okazaki H, Igarashi M, Nishi M, Sekiya M, Tajima M, Takase S, Takanashi M, Ohta K, Tamura Y, Okazaki S, Yahagi N, Ohashi K, Amemiya-Kudo M, Nakagawa Y, Nagai R, Kadowaki T, Osuga J, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "18782767", "url": "https://glygen.org/publication/PubMed/18782767" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "Role of HRB in clathrin-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chaineau M, Danglot L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18819912", "url": "https://glygen.org/publication/PubMed/18819912" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "Pulmonary surfactant protein D inhibits lipopolysaccharide (LPS)-induced inflammatory cell responses by altering LPS binding to its receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yamazoe M, Nishitani C, Takahashi M, Katoh T, Ariki S, Shimizu T, Mitsuzawa H, Sawada K, Voelker DR, Takahashi H, Kuroki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "18990700", "url": "https://glygen.org/publication/PubMed/18990700" } ] }, { "title": "Overexpression of apolipoprotein F reduces HDL cholesterol levels in vivo.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "Lagor WR, Brown RJ, Toh SA, Millar JS, Fuki IV, de la Llera-Moya M, Yuen T, Rothblat G, Billheimer JT, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "19008531", "url": "https://glygen.org/publication/PubMed/19008531" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Scavenger receptor collectin placenta 1 (CL-P1) predominantly mediates zymosan phagocytosis by human vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Jang S, Ohtani K, Fukuoh A, Yoshizaki T, Fukuda M, Motomura W, Mori K, Fukuzawa J, Kitamoto N, Yoshida I, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19073604", "url": "https://glygen.org/publication/PubMed/19073604" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "Multi-hit inhibition of circulating and cell-associated components of the toll-like receptor 4 pathway by oxidized phospholipids.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "von Schlieffen E, Oskolkova OV, Schabbauer G, Gruber F, Bluml S, Genest M, Kadl A, Marsik C, Knapp S, Chow J, Leitinger N, Binder BR, Bochkov VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "19112167", "url": "https://glygen.org/publication/PubMed/19112167" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "A structural explanation for the binding of endocytic dileucine motifs by the AP2 complex.", "journal": "Nature", "date": "2008", "authors": "Kelly BT, McCoy AJ, Spate K, Miller SE, Evans PR, Honing S, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19140243", "url": "https://glygen.org/publication/PubMed/19140243" } ] }, { "title": "Acyl-coenzyme A:cholesterol acyltransferases.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2009", "authors": "Chang TY, Li BL, Chang CC, Urano Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "19141679", "url": "https://glygen.org/publication/PubMed/19141679" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114#ptm_processing" }, { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Antibody-mediated disruption of the interaction between PCSK9 and the low-density lipoprotein receptor.", "journal": "The Biochemical journal", "date": "2009", "authors": "Duff CJ, Scott MJ, Kirby IT, Hutchinson SE, Martin SL, Hooper NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "19196236", "url": "https://glygen.org/publication/PubMed/19196236" } ] }, { "title": "Scavenger receptor A: a new route for adenovirus 5.", "journal": "Molecular pharmaceutics", "date": "2009", "authors": "Haisma HJ, Boesjes M, Beerens AM, van der Strate BW, Curiel DT, Pluddemann A, Gordon S, Bellu AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19227971", "url": "https://glygen.org/publication/PubMed/19227971" } ] }, { "title": "Evolutionarily conserved recognition and innate immunity to fungal pathogens by the scavenger receptors SCARF1 and CD36.", "journal": "The Journal of experimental medicine", "date": "2009", "authors": "Means TK, Mylonakis E, Tampakakis E, Colvin RA, Seung E, Puckett L, Tai MF, Stewart CR, Pukkila-Worley R, Hickman SE, Moore KJ, Calderwood SB, Hacohen N, Luster AD, El Khoury J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19237602", "url": "https://glygen.org/publication/PubMed/19237602" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Rat and human HARE/stabilin-2 are clearance receptors for high- and low-molecular-weight heparins.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2009", "authors": "Harris EN, Baggenstoss BA, Weigel PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "19359419", "url": "https://glygen.org/publication/PubMed/19359419" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "Structure of N-terminal domain of NPC1 reveals distinct subdomains for binding and transfer of cholesterol.", "journal": "Cell", "date": "2009", "authors": "Kwon HJ, Abi-Mosleh L, Wang ML, Deisenhofer J, Goldstein JL, Brown MS, Infante RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "19563754", "url": "https://glygen.org/publication/PubMed/19563754" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "Targeting of neutral cholesterol ester hydrolase to the endoplasmic reticulum via its N-terminal sequence.", "journal": "Journal of lipid research", "date": "2010", "authors": "Igarashi M, Osuga J, Isshiki M, Sekiya M, Okazaki H, Takase S, Takanashi M, Ohta K, Kumagai M, Nishi M, Fujita T, Nagai R, Kadowaki T, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "19592704", "url": "https://glygen.org/publication/PubMed/19592704" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Chen WJ, Goldstein JL, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1968060", "url": "https://glygen.org/publication/PubMed/1968060" } ] }, { "title": "Scavenger receptors of endothelial cells mediate the uptake and cellular proatherogenic effects of carbamylated LDL.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "Apostolov EO, Shah SV, Ray D, Basnakian AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "19696406", "url": "https://glygen.org/publication/PubMed/19696406" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Endocytosis and signalling: intertwining molecular networks.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Sorkin A, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19696798", "url": "https://glygen.org/publication/PubMed/19696798" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages.", "journal": "Journal of cell science", "date": "2009", "authors": "Park SY, Jung MY, Lee SJ, Kang KB, Gratchev A, Riabov V, Kzhyshkowska J, Kim IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "19726632", "url": "https://glygen.org/publication/PubMed/19726632" } ] }, { "title": "Stonins--specialized adaptors for synaptic vesicle recycling and beyond?", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Maritzen T, Podufall J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19732400", "url": "https://glygen.org/publication/PubMed/19732400" } ] }, { "title": "Uptake of oxidized low density lipoprotein by CD36 occurs by an actin-dependent pathway distinct from macropinocytosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Collins RF, Touret N, Kuwata H, Tandon NN, Grinstein S, Trimble WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19740737", "url": "https://glygen.org/publication/PubMed/19740737" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "Detection by denaturing gradient gel electrophoresis of a new polymorphism in the apolipoprotein B gene.", "journal": "Hum. Genet.", "date": "1990", "authors": "Navajas M, Laurent A M, Moreel J F, Ragab A, Cambou J P, Cuny G, Cambien F, Roiz\u00e8s G", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "1979313", "url": "https://glygen.org/publication/PubMed/1979313" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Arrestin development: emerging roles for beta-arrestins in developmental signaling pathways.", "journal": "Developmental cell", "date": "2009", "authors": "Kovacs JJ, Hara MR, Davenport CL, Kim J, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19853559", "url": "https://glygen.org/publication/PubMed/19853559" } ] }, { "title": "Macrophage scavenger receptor A mediates adhesion to apolipoproteins A-I and E.", "journal": "Biochemistry", "date": "2009", "authors": "Neyen C, Pluddemann A, Roversi P, Thomas B, Cai L, van der Westhuyzen DR, Sim RB, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19911804", "url": "https://glygen.org/publication/PubMed/19911804" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.", "journal": "Nature immunology", "date": "2010", "authors": "Stewart CR, Stuart LM, Wilkinson K, van Gils JM, Deng J, Halle A, Rayner KJ, Boyer L, Zhong R, Frazier WA, Lacy-Hulbert A, El Khoury J, Golenbock DT, Moore KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20037584", "url": "https://glygen.org/publication/PubMed/20037584" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "Alpha-AP-2 directs myosin VI-dependent endocytosis of cystic fibrosis transmembrane conductance regulator chloride channels in the intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Collaco A, Jakab R, Hegan P, Mooseker M, Ameen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20351096", "url": "https://glygen.org/publication/PubMed/20351096" } ] }, { "title": "An accessory to the 'Trinity': SR-As are essential pathogen sensors of extracellular dsRNA, mediating entry and leading to subsequent type I IFN responses.", "journal": "PLoS pathogens", "date": "2010", "authors": "DeWitte-Orr SJ, Collins SE, Bauer CM, Bowdish DM, Mossman KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20360967", "url": "https://glygen.org/publication/PubMed/20360967" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "The Toll-like receptor 4 ligands Mrp8 and Mrp14 are crucial in the development of autoreactive CD8+ T cells.", "journal": "Nature medicine", "date": "2010", "authors": "Loser K, Vogl T, Voskort M, Lueken A, Kupas V, Nacken W, Klenner L, Kuhn A, Foell D, Sorokin L, Luger TA, Roth J, Beissert S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "20473308", "url": "https://glygen.org/publication/PubMed/20473308" } ] }, { "title": "Heat shock protein 90 mediates efficient antigen cross presentation through the scavenger receptor expressed by endothelial cells-I.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Murshid A, Gong J, Calderwood SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "20686127", "url": "https://glygen.org/publication/PubMed/20686127" } ] }, { "title": "Biological, clinical and population relevance of 95 loci for blood lipids.", "journal": "Nature", "date": "2010", "authors": "Teslovich TM, Musunuru K, Smith AV, Edmondson AC, Stylianou IM, Koseki M, Pirruccello JP, Ripatti S, Chasman DI, Willer CJ, Johansen CT, Fouchier SW, Isaacs A, Peloso GM, Barbalic M, Ricketts SL, Bis JC, Aulchenko YS, Thorleifsson G, Feitosa MF, Chambers J, Orho-Melander M, Melander O, Johnson T, Li X, Guo X, Li M, Shin Cho Y, Jin Go M, Jin Kim Y, Lee JY, Park T, Kim K, Sim X, Twee-Hee Ong R, Croteau-Chonka DC, Lange LA, Smith JD, Song K, Hua Zhao J, Yuan X, Luan J, Lamina C, Ziegler A, Zhang W, Zee RY, Wright AF, Witteman JC, Wilson JF, Willemsen G, Wichmann HE, Whitfield JB, Waterworth DM, Wareham NJ, Waeber G, Vollenweider P, Voight BF, Vitart V, Uitterlinden AG, Uda M, Tuomilehto J, Thompson JR, Tanaka T, Surakka I, Stringham HM, Spector TD, Soranzo N, Smit JH, Sinisalo J, Silander K, Sijbrands EJ, Scuteri A, Scott J, Schlessinger D, Sanna S, Salomaa V, Saharinen J, Sabatti C, Ruokonen A, Rudan I, Rose LM, Roberts R, Rieder M, Psaty BM, Pramstaller PP, Pichler I, Perola M, Penninx BW, Pedersen NL, Pattaro C, Parker AN, Pare G, Oostra BA, O'Donnell CJ, Nieminen MS, Nickerson DA, Montgomery GW, Meitinger T, McPherson R, McCarthy MI, McArdle W, Masson D, Martin NG, Marroni F, Mangino M, Magnusson PK, Lucas G, Luben R, Loos RJ, Lokki ML, Lettre G, Langenberg C, Launer LJ, Lakatta EG, Laaksonen R, Kyvik KO, Kronenberg F, Konig IR, Khaw KT, Kaprio J, Kaplan LM, Johansson A, Jarvelin MR, Janssens AC, Ingelsson E, Igl W, Kees Hovingh G, Hottenga JJ, Hofman A, Hicks AA, Hengstenberg C, Heid IM, Hayward C, Havulinna AS, Hastie ND, Harris TB, Haritunians T, Hall AS, Gyllensten U, Guiducci C, Groop LC, Gonzalez E, Gieger C, Freimer NB, Ferrucci L, Erdmann J, Elliott P, Ejebe KG, Doring A, Dominiczak AF, Demissie S, Deloukas P, de Geus EJ, de Faire U, Crawford G, Collins FS, Chen YD, Caulfield MJ, Campbell H, Burtt NP, Bonnycastle LL, Boomsma DI, Boekholdt SM, Bergman RN, Barroso I, Bandinelli S, Ballantyne CM, Assimes TL, Quertermous T, Altshuler D, Seielstad M, Wong TY, Tai ES, Feranil AB, Kuzawa CW, Adair LS, Taylor HA Jr, Borecki IB, Gabriel SB, Wilson JG, Holm H, Thorsteinsdottir U, Gudnason V, Krauss RM, Mohlke KL, Ordovas JM, Munroe PB, Kooner JS, Tall AR, Hegele RA, Kastelein JJ, Schadt EE, Rotter JI, Boerwinkle E, Strachan DP, Mooser V, Stefansson K, Reilly MP, Samani NJ, Schunkert H, Cupples LA, Sandhu MS, Ridker PM, Rader DJ, van Duijn CM, Peltonen L, Abecasis GR, Boehnke M, Kathiresan S", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "20686565", "url": "https://glygen.org/publication/PubMed/20686565" } ] }, { "title": "The class A scavenger receptor, macrophage receptor with collagenous structure, is the major phagocytic receptor for Clostridium sordellii expressed by human decidual macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Thelen T, Hao Y, Medeiros AI, Curtis JL, Serezani CH, Kobzik L, Harris LH, Aronoff DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20810988", "url": "https://glygen.org/publication/PubMed/20810988" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Cellular recognition and trafficking of amorphous silica nanoparticles by macrophage scavenger receptor A.", "journal": "Nanotoxicology", "date": "2011", "authors": "Orr GA, Chrisler WB, Cassens KJ, Tan R, Tarasevich BJ, Markillie LM, Zangar RC, Thrall BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20849212", "url": "https://glygen.org/publication/PubMed/20849212" } ] }, { "title": "Phagocytosis of fungal agents and yeast via macrophage cell surface scavenger receptors.", "journal": "The Journal of surgical research", "date": "2010", "authors": "Wang R, Chandawarkar RY", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20888598", "url": "https://glygen.org/publication/PubMed/20888598" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "The critical role of neutral cholesterol ester hydrolase 1 in cholesterol removal from human macrophages.", "journal": "Circulation research", "date": "2010", "authors": "Igarashi M, Osuga J, Uozaki H, Sekiya M, Nagashima S, Takahashi M, Takase S, Takanashi M, Li Y, Ohta K, Kumagai M, Nishi M, Hosokawa M, Fledelius C, Jacobsen P, Yagyu H, Fukayama M, Nagai R, Kadowaki T, Ohashi K, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "20947831", "url": "https://glygen.org/publication/PubMed/20947831" } ] }, { "title": "Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Hansen S, Selman L, Palaniyar N, Ziegler K, Brandt J, Kliem A, Jonasson M, Skjoedt MO, Nielsen O, Hartshorn K, Jorgensen TJ, Skjodt K, Holmskov U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20956340", "url": "https://glygen.org/publication/PubMed/20956340" } ] }, { "title": "Role of liver sinusoidal endothelial cells and stabilins in elimination of oxidized low-density lipoproteins.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2011", "authors": "Li R, Oteiza A, Sorensen KK, McCourt P, Olsen R, Smedsrod B, Svistounov D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "21030611", "url": "https://glygen.org/publication/PubMed/21030611" } ] }, { "title": "CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.", "journal": "The EMBO journal", "date": "2011", "authors": "Granata A, Koo SJ, Haucke V, Schiavo G, Warner TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21102408", "url": "https://glygen.org/publication/PubMed/21102408" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Isolation and characterization of sulfhydryl and disulfide peptides of human apolipoprotein B-100.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Yang CY, Kim TW, Weng SA, Lee BR, Yang ML, Gotto AM Jr", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2115173", "url": "https://glygen.org/publication/PubMed/2115173" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "Molecular basis of autosomal dominant hypercholesterolemia: assessment in a large cohort of hypercholesterolemic children.", "journal": "Circulation", "date": "2011", "authors": "van der Graaf A, Avis HJ, Kusters DM, Vissers MN, Hutten BA, Defesche JC, Huijgen R, Fouchier SW, Wijburg FA, Kastelein JJ, Wiegman A", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "21382890", "url": "https://glygen.org/publication/PubMed/21382890" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "Stabilin-1/CLEVER-1, a type 2 macrophage marker, is an adhesion and scavenging molecule on human placental macrophages.", "journal": "European journal of immunology", "date": "2011", "authors": "Palani S, Maksimow M, Miiluniemi M, Auvinen K, Jalkanen S, Salmi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497" } ], "reference": [ { "type": "PubMed", "id": "21480214", "url": "https://glygen.org/publication/PubMed/21480214" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "The apolipoprotein C-I content of very-low-density lipoproteins is associated with fasting triglycerides, postprandial lipemia, and carotid atherosclerosis.", "journal": "Journal of lipids", "date": "2011", "authors": "Hansen JB, Fernandez JA, Noto AT, Deguchi H, Bjorkegren J, Mathiesen EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423" } ], "reference": [ { "type": "PubMed", "id": "21776394", "url": "https://glygen.org/publication/PubMed/21776394" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "Effect of overexpression of human SR-AI on oxLDL uptake and apoptosis in 293T cells.", "journal": "International immunopharmacology", "date": "2011", "authors": "Yang H, Chen SC, Tang YQ, Dai YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "21782039", "url": "https://glygen.org/publication/PubMed/21782039" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "High mobility group box protein 1 in complex with lipopolysaccharide or IL-1 promotes an increased inflammatory phenotype in synovial fibroblasts.", "journal": "Arthritis research & therapy", "date": "2011", "authors": "Wahamaa H, Schierbeck H, Hreggvidsdottir HS, Palmblad K, Aveberger AC, Andersson U, Harris HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "21871094", "url": "https://glygen.org/publication/PubMed/21871094" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "A novel mutation of apolipoprotein B in a French Canadian family with homozygous hypobetalipoproteinemia.", "journal": "J. Clin. Lipidol.", "date": "2011", "authors": "Gangloff Anne, Bergeron Jean, Couture Patrick, Martins Rebecca, Hegele Robert A, Gagn\u00e9 Claude", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "21981844", "url": "https://glygen.org/publication/PubMed/21981844" } ] }, { "title": "Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Biochemical journal", "date": "2012", "authors": "Fu L, Rab A, Tang LP, Rowe SM, Bebok Z, Collawn JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21995445", "url": "https://glygen.org/publication/PubMed/21995445" } ] }, { "title": "Quantitative detection of single amino acid polymorphisms by targeted proteomics.", "journal": "Journal of molecular cell biology", "date": "2011", "authors": "Su ZD, Sun L, Yu DX, Li RX, Li HX, Yu ZJ, Sheng QH, Lin X, Zeng R, Wu JR", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "22028381", "url": "https://glygen.org/publication/PubMed/22028381" } ] }, { "title": "Genetic variation in APOB, PCSK9, and ANGPTL3 in carriers of pathogenic autosomal dominant hypercholesterolemic mutations with unexpected low LDL-Cl Levels.", "journal": "Human mutation", "date": "2012", "authors": "Huijgen R, Sjouke B, Vis K, de Randamie JS, Defesche JC, Kastelein JJ, Hovingh GK, Fouchier SW", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "22095935", "url": "https://glygen.org/publication/PubMed/22095935" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.", "journal": "Cell", "date": "2011", "authors": "Miller SE, Sahlender DA, Graham SC, Honing S, Robinson MS, Peden AA, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22118466", "url": "https://glygen.org/publication/PubMed/22118466" } ] }, { "title": "Sequence polymorphism in the human apoB gene at position 8344.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Huang L S, Gavish D, Breslow J L", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2216805", "url": "https://glygen.org/publication/PubMed/2216805" } ] }, { "title": "Coated pits, coated vesicles, and receptor-mediated endocytosis.", "journal": "Nature", "date": "1979", "authors": "Goldstein JL, Anderson RG, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "221835", "url": "https://glygen.org/publication/PubMed/221835" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "The extracellular release of DNA and HMGB1 from Jurkat T cells during in vitro necrotic cell death.", "journal": "Innate immunity", "date": "2012", "authors": "Beyer C, Stearns NA, Giessl A, Distler JH, Schett G, Pisetsky DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22344226", "url": "https://glygen.org/publication/PubMed/22344226" } ] }, { "title": "The role of ubiquitylation in receptor endocytosis and endosomal sorting.", "journal": "Journal of cell science", "date": "2012", "authors": "Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22357968", "url": "https://glygen.org/publication/PubMed/22357968" } ] }, { "title": "The effects of apolipoprotein F deficiency on high density lipoprotein cholesterol metabolism in mice.", "journal": "PloS one", "date": "2012", "authors": "Lagor WR, Fields DW, Khetarpal SA, Kumaravel A, Lin W, Weintraub N, Wu K, Hamm-Alvarez SF, Drazul-Schrader D, de la Llera-Moya M, Rothblat GH, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "22363685", "url": "https://glygen.org/publication/PubMed/22363685" } ] }, { "title": "Low-density lipoprotein receptor (LDLR) family orchestrates cholesterol homeostasis.", "journal": "The Yale journal of biology and medicine", "date": "2012", "authors": "Go GW, Mani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "22461740", "url": "https://glygen.org/publication/PubMed/22461740" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "Pro-inflammatory S100A8 and S100A9 proteins: self-assembly into multifunctional native and amyloid complexes.", "journal": "International journal of molecular sciences", "date": "2012", "authors": "Vogl T, Gharibyan AL, Morozova-Roche LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "22489132", "url": "https://glygen.org/publication/PubMed/22489132" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Human macrophage scavenger receptors: primary structure, expression, and localization in atherosclerotic lesions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Matsumoto A, Naito M, Itakura H, Ikemoto S, Asaoka H, Hayakawa I, Kanamori H, Aburatani H, Takaku F, Suzuki H, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "2251254", "url": "https://glygen.org/publication/PubMed/2251254" } ] }, { "title": "Intracellular trafficking and secretion of VLDL.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2012", "authors": "Tiwari S, Siddiqi SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423" } ], "reference": [ { "type": "PubMed", "id": "22517366", "url": "https://glygen.org/publication/PubMed/22517366" } ] }, { "title": "Biological functions of the novel collectins CL-L1, CL-K1, and CL-P1.", "journal": "Journal of biomedicine & biotechnology", "date": "2012", "authors": "Ohtani K, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "22570530", "url": "https://glygen.org/publication/PubMed/22570530" } ] }, { "title": "Transferrin receptor internalization sequence YXRF implicates a tight turn as the structural recognition motif for endocytosis.", "journal": "Cell", "date": "1990", "authors": "Collawn JF, Stangel M, Kuhn LA, Esekogwu V, Jing SQ, Trowbridge IS, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2257624", "url": "https://glygen.org/publication/PubMed/2257624" } ] }, { "title": "Proprotein convertase subtilisin/kexin type 9 interacts with apolipoprotein B and prevents its intracellular degradation, irrespective of the low-density lipoprotein receptor.", "journal": "Arterioscler. Thromb. Vasc. Biol.", "date": "2012", "authors": "Sun Hua, Samarghandi Amin, Zhang Ningyan, Yao Zemin, Xiong Momiao, Teng Ba-Bie", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "22580899", "url": "https://glygen.org/publication/PubMed/22580899" } ] }, { "title": "Molecular characterization of proprotein convertase subtilisin/kexin type 9-mediated degradation of the LDLR.", "journal": "Journal of lipid research", "date": "2012", "authors": "Wang Y, Huang Y, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "22764087", "url": "https://glygen.org/publication/PubMed/22764087" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "The epsin protein family: coordinators of endocytosis and signaling.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Sen A, Madhivanan K, Mukherjee D, Aguilar RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22942912", "url": "https://glygen.org/publication/PubMed/22942912" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Scavenger receptor-mediated uptake and metabolism of lipid vesicles containing acidic phospholipids by mouse peritoneal macrophages.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Nishikawa K, Arai H, Inoue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "2318890", "url": "https://glygen.org/publication/PubMed/2318890" } ] }, { "title": "MARCO is required for TLR2- and Nod2-mediated responses to Streptococcus pneumoniae and clearance of pneumococcal colonization in the murine nasopharynx.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013", "authors": "Dorrington MG, Roche AM, Chauvin SE, Tu Z, Mossman KL, Weiser JN, Bowdish DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "23197261", "url": "https://glygen.org/publication/PubMed/23197261" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "The many faces of HMGB1: molecular structure-functional activity in inflammation, apoptosis, and chemotaxis.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Yang H, Antoine DJ, Andersson U, Tracey KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "23446148", "url": "https://glygen.org/publication/PubMed/23446148" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Ubiquitin-dependent sorting in endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Piper RC, Dikic I, Lukacs GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24384571", "url": "https://glygen.org/publication/PubMed/24384571" } ] }, { "title": "Identification of a novel in-frame translational stop codon in human intestine apoB mRNA.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1987", "authors": "Hospattankar A V, Higuchi K, Law S W, Meglin N, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2445342", "url": "https://glygen.org/publication/PubMed/2445342" } ] }, { "title": "Human apolipoprotein B (apoB) mRNA: identification of two distinct apoB mRNAs, an mRNA with the apoB-100 sequence and an apoB mRNA containing a premature in-frame translational stop codon, in both liver and intestine.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Higuchi K, Hospattankar A V, Law S W, Meglin N, Cortright J, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2450346", "url": "https://glygen.org/publication/PubMed/2450346" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "Role of beta-arrestins and arrestin domain-containing proteins in G protein-coupled receptor trafficking.", "journal": "Current opinion in cell biology", "date": "2014", "authors": "Kang DS, Tian X, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24680432", "url": "https://glygen.org/publication/PubMed/24680432" } ] }, { "title": "Regulation of clathrin-mediated endocytosis by dynamic ubiquitination and deubiquitination.", "journal": "Current biology : CB", "date": "2014", "authors": "Weinberg JS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24746795", "url": "https://glygen.org/publication/PubMed/24746795" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "S100A1 is released from ischemic cardiomyocytes and signals myocardial damage via Toll-like receptor 4.", "journal": "EMBO molecular medicine", "date": "2014", "authors": "Rohde D, Schon C, Boerries M, Didrihsone I, Ritterhoff J, Kubatzky KF, Volkers M, Herzog N, Mahler M, Tsoporis JN, Parker TG, Linke B, Giannitsis E, Gao E, Peppel K, Katus HA, Most P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "24833748", "url": "https://glygen.org/publication/PubMed/24833748" } ] }, { "title": "Critical role of neutral cholesteryl ester hydrolase 1 in cholesteryl ester hydrolysis in murine macrophages.", "journal": "Journal of lipid research", "date": "2014", "authors": "Sakai K, Igarashi M, Yamamuro D, Ohshiro T, Nagashima S, Takahashi M, Enkhtuvshin B, Sekiya M, Okazaki H, Osuga J, Ishibashi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "24868095", "url": "https://glygen.org/publication/PubMed/24868095" } ] }, { "title": "C to U RNA editing mediated by APOBEC1 requires RNA-binding protein RBM47.", "journal": "EMBO Rep.", "date": "2014", "authors": "Fossat N, Tourle K, Radziewic T, Barratt K, Liebhold D, Studdert JB, Power M, Jones V, Loebel DA, Tam PP", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "24916387", "url": "https://glygen.org/publication/PubMed/24916387" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Association between a specific apolipoprotein B mutation and familial defective apolipoprotein B-100.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Soria LF, Ludwig EH, Clarke HR, Vega GL, Grundy SM, McCarthy BJ", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2563166", "url": "https://glygen.org/publication/PubMed/2563166" } ] }, { "title": "Hypobetalipoproteinemia due to an apolipoprotein B gene exon 21 deletion derived by Alu-Alu recombination.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Huang L S, Ripps M E, Korman S H, Deckelbaum R J, Breslow J L", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2567736", "url": "https://glygen.org/publication/PubMed/2567736" } ] }, { "title": "Lysosomal acid lipase: at the crossroads of normal and atherogenic cholesterol metabolism.", "journal": "Frontiers in cell and developmental biology", "date": "2015", "authors": "Dubland JA, Francis GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "25699256", "url": "https://glygen.org/publication/PubMed/25699256" } ] }, { "title": "Role of S100A1 in hypoxia-induced inflammatory response in cardiomyocytes via TLR4/ROS/NF-kappaB pathway.", "journal": "The Journal of pharmacy and pharmacology", "date": "2015", "authors": "Yu J, Lu Y, Li Y, Xiao L, Xing Y, Li Y, Wu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5686938", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938" } ], "reference": [ { "type": "PubMed", "id": "25880347", "url": "https://glygen.org/publication/PubMed/25880347" } ] }, { "title": "Effects of Proprotein Convertase Subtilisin/Kexin Type 9 Antibodies in Adults With Hypercholesterolemia: A Systematic Review and Meta-analysis.", "journal": "Annals of internal medicine", "date": "2015", "authors": "Navarese EP, Kolodziejczak M, Schulze V, Gurbel PA, Tantry U, Lin Y, Brockmeyer M, Kandzari DE, Kubica JM, D'Agostino RB Sr, Kubica J, Volpe M, Agewall S, Kereiakes DJ, Kelm M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "25915661", "url": "https://glygen.org/publication/PubMed/25915661" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P04114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04114" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "The association of APOC4 polymorphisms with premature coronary artery disease in a Chinese Han population.", "journal": "Lipids in health and disease", "date": "2015", "authors": "Xu S, Cheng J, Li NH, Chen YN, Cai MY, Tang SS, Huang H, Zhang B, Cen JM, Yang XL, Chen C, Liu X, Xiong XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "26129832", "url": "https://glygen.org/publication/PubMed/26129832" } ] }, { "title": "A novel abetalipoproteinemia missense mutation highlights the importance of N-Terminal beta-barrel in microsomal triglyceride transfer protein function.", "journal": "Circ. Cardiovasc. Genet.", "date": "2015", "authors": "Walsh MT, Iqbal J, Josekutty J, Soh J, Di Leo E, Ozaydin E, Gunduz M, Tarugi P, Hussain MM", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "26224785", "url": "https://glygen.org/publication/PubMed/26224785" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "ACAT1 regulates the dynamics of free cholesterols in plasma membrane which leads to the APP-alpha-processing alteration.", "journal": "Acta biochimica et biophysica Sinica", "date": "2015", "authors": "Zhu M, Zhao X, Chen J, Xu J, Hu G, Guo D, Li Q, Zhang X, Chang CC, Song B, Xiong Y, Chang T, Li B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "26474739", "url": "https://glygen.org/publication/PubMed/26474739" } ] }, { "title": "beta-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.", "journal": "Nature cell biology", "date": "2016", "authors": "Eichel K, Jullie D, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "26829388", "url": "https://glygen.org/publication/PubMed/26829388" } ] }, { "title": "Novel APOB missense variants, A224T and V925L, in a black South African woman with marked hypocholesterolemia.", "journal": "Journal of clinical lipidology", "date": "2016", "authors": "Miller SA, Hooper AJ, Mantiri GA, Marais D, Tanyanyiwa DM, McKnight J, Burnett JR", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "27206948", "url": "https://glygen.org/publication/PubMed/27206948" } ] }, { "title": "Stoichiometric binding of low density lipoprotein (LDL) and monoclonal antibodies to LDL receptors in a solid phase assay.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Van Driel IR, Brown MS, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "2722848", "url": "https://glygen.org/publication/PubMed/2722848" } ] }, { "title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.", "journal": "Biology open", "date": "2016", "authors": "Juhlen R, Landgraf D, Huebner A, Koehler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "27754849", "url": "https://glygen.org/publication/PubMed/27754849" } ] }, { "title": "The Scavenger Receptor SSc5D Physically Interacts with Bacteria through the SRCR-Containing N-Terminal Domain.", "journal": "Frontiers in immunology", "date": "2016", "authors": "Bessa Pereira C, Bockova M, Santos RF, Santos AM, Martins de Araujo M, Oliveira L, Homola J, Carmo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "27790215", "url": "https://glygen.org/publication/PubMed/27790215" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.", "journal": "Cell", "date": "2017", "authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "28111073", "url": "https://glygen.org/publication/PubMed/28111073" } ] }, { "title": "AUP1 (Ancient Ubiquitous Protein 1) Is a Key Determinant of Hepatic Very-Low-Density Lipoprotein Assembly and Secretion.", "journal": "Arterioscler. Thromb. Vasc. Biol.", "date": "2017", "authors": "Zhang J, Zamani M, Thiele C, Taher J, Amir Alipour M, Yao Z, Adeli K", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "28183703", "url": "https://glygen.org/publication/PubMed/28183703" } ] }, { "title": "Plasma cholesteryl ester transfer protein has binding sites for neutral lipids and phospholipids.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Swenson TL, Brocia RW, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "2833496", "url": "https://glygen.org/publication/PubMed/2833496" } ] }, { "title": "Analysis of the human apolipoprotein B gene; complete structure of the B-74 region.", "journal": "Gene", "date": "1986", "authors": "Carlsson P, Darnfors C, Olofsson S O, Bjursell G", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2883086", "url": "https://glygen.org/publication/PubMed/2883086" } ] }, { "title": "Clathrin assembly proteins: affinity purification and a model for coat assembly.", "journal": "The Journal of cell biology", "date": "1987", "authors": "Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2890644", "url": "https://glygen.org/publication/PubMed/2890644" } ] }, { "title": "Molecular cloning and expression of partial cDNAs and deduced amino acid sequence of a carboxyl-terminal fragment of human apolipoprotein B-100.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Wei C F, Chen S H, Yang C Y, Marcel Y L, Milne R W, Li W H, Sparrow J T, Gotto A M, Chan L", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2932736", "url": "https://glygen.org/publication/PubMed/2932736" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" }, { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Human apolipoprotein B: structure of carboxyl-terminal domains, sites of gene expression, and chromosomal localization.", "journal": "Science", "date": "1985", "authors": "Knott T J, Rall S C, Innerarity T L, Jacobson S F, Urdea M S, Levy-Wilson B, Powell L M, Pease R J, Eddy R, Nakai H", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "2994225", "url": "https://glygen.org/publication/PubMed/2994225" } ] }, { "title": "Human apolipoprotein B-100: cloning, analysis of liver mRNA, and assignment of the gene to chromosome 2.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Law S W, Lackner K J, Hospattankar A V, Anchors J M, Sakaguchi A Y, Naylor S L, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3001697", "url": "https://glygen.org/publication/PubMed/3001697" } ] }, { "title": "Isolation, expression and characterization of a human apolipoprotein B 100-specific cDNA clone.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1986", "authors": "Pfitzner R, Wagener R, Stoffel W", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3024665", "url": "https://glygen.org/publication/PubMed/3024665" } ] }, { "title": "The complete sequence and structural analysis of human apolipoprotein B-100: relationship between apoB-100 and apoB-48 forms.", "journal": "EMBO J.", "date": "1986", "authors": "Cladaras C, Hadzopoulou-Cladaras M, Nolte R T, Atkinson D, Zannis V I", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3030729", "url": "https://glygen.org/publication/PubMed/3030729" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04114", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Apolipoprotein B is a calcium binding protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1986", "authors": "Dashti N, Lee D M, Mok T", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3087360", "url": "https://glygen.org/publication/PubMed/3087360" } ] }, { "title": "Sequence, structure, receptor-binding domains and internal repeats of human apolipoprotein B-100.", "journal": "Nature", "date": "1986", "authors": "Yang C Y, Chen S H, Gianturco S H, Bradley W A, Sparrow J T, Tanimura M, Li W H, Sparrow D A, DeLoof H, Rosseneu M", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3095664", "url": "https://glygen.org/publication/PubMed/3095664" } ] }, { "title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.", "journal": "Nature", "date": "2019", "authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "31748741", "url": "https://glygen.org/publication/PubMed/31748741" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.", "journal": "Haematologica", "date": "2021", "authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32354867", "url": "https://glygen.org/publication/PubMed/32354867" } ] }, { "title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32695117", "url": "https://glygen.org/publication/PubMed/32695117" } ] }, { "title": "Human heme oxygenase cDNA and induction of its mRNA by hemin.", "journal": "European journal of biochemistry", "date": "1988", "authors": "Yoshida T, Biro P, Cohen T, Muller RM, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "3345742", "url": "https://glygen.org/publication/PubMed/3345742" } ] }, { "title": "Role of PCSK9 Inhibitors in Patients with Familial Hypercholesterolemia.", "journal": "Endocrinology and metabolism (Seoul, Korea)", "date": "2021", "authors": "Tomlinson B, Patil NG, Fok M, Lam CWK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "33866776", "url": "https://glygen.org/publication/PubMed/33866776" } ] }, { "title": "O-GlcNAcylation Quantification of Certain Protein by the Proximity Ligation Assay and Clostridium perfringen OGA(D298N)(CpOGA(D298N)).", "journal": "ACS chemical biology", "date": "2021", "authors": "Song J, Liu C, Wang X, Xu B, Liu X, Li Y, Xia J, Li Y, Zhang C, Li D, Sun H", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04114", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04114" }, { "database": "O-GlcNAc Atlas", "id": "P04114", "url": "https://oglcnac.org/atlas/detail/P04114" } ], "reference": [ { "type": "PubMed", "id": "34105348", "url": "https://glygen.org/publication/PubMed/34105348" } ] }, { "title": "Deep-etch visualization of proteins involved in clathrin assembly.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Heuser JE, Keen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "3417785", "url": "https://glygen.org/publication/PubMed/3417785" } ] }, { "title": "Carboxyl terminal analysis of human B-48 protein confirms the novel mechanism proposed for chain termination.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1987", "authors": "Hardman D A, Protter A A, Schilling J W, Kane J P", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3426612", "url": "https://glygen.org/publication/PubMed/3426612" } ] }, { "title": "Analysis of cDNA clones encoding the entire B-26 region of human apolipoprotein B.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Protter AA, Hardman DA, Sato KY, Schilling JW, Yamanaka M, Hort YJ, Hjerrild KA, Chen GC, Kane JP", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3461454", "url": "https://glygen.org/publication/PubMed/3461454" } ] }, { "title": "Human liver apolipoprotein B-100 cDNA: complete nucleic acid and derived amino acid sequence.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Law S W, Grant S M, Higuchi K, Hospattankar A, Lackner K, Lee N, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3464946", "url": "https://glygen.org/publication/PubMed/3464946" } ] }, { "title": "Recognition of solubilized apoproteins from delipidated, oxidized low density lipoprotein (LDL) by the acetyl-LDL receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Parthasarathy S, Fong LG, Otero D, Steinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "3467373", "url": "https://glygen.org/publication/PubMed/3467373" } ] }, { "title": "Isolation of a cDNA clone encoding the amino-terminal region of human apolipoprotein B.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Protter A A, Hardman D A, Schilling J W, Miller J, Appleby V, Chen G C, Kirsher S W, McEnroe G, Kane J P", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3513177", "url": "https://glygen.org/publication/PubMed/3513177" } ] }, { "title": "A novel form of tissue-specific RNA processing produces apolipoprotein-B48 in intestine.", "journal": "Cell", "date": "1987", "authors": "Powell L M, Wallis S C, Pease R J, Edwards Y H, Knott T J, Scott J", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3621347", "url": "https://glygen.org/publication/PubMed/3621347" } ] }, { "title": "DNA sequence of the human apolipoprotein B gene.", "journal": "DNA", "date": "1987", "authors": "Ludwig E H, Blackhart B D, Pierotti V R, Caiati L, Fortier C, Knott T, Scott J, Mahley R W, Levy-Wilson B, McCarthy B J", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3652907", "url": "https://glygen.org/publication/PubMed/3652907" } ] }, { "title": "Apolipoprotein B-48 is the product of a messenger RNA with an organ-specific in-frame stop codon.", "journal": "Science", "date": "1987", "authors": "Chen S H, Habib G, Yang C Y, Gu Z W, Lee B R, Weng S A, Silberman S R, Cai S J, Deslypere J P, Rosseneu M", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3659919", "url": "https://glygen.org/publication/PubMed/3659919" } ] }, { "title": "Structural comparison of human apolipoproteins B-48 and B-100.", "journal": "Biochemistry", "date": "1987", "authors": "Hardman D A, Protter A A, Chen G C, Schilling J W, Sato K Y, Lau K, Yamanaka M, Mikita T, Miller J, Crisp T", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3676265", "url": "https://glygen.org/publication/PubMed/3676265" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04114", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04114" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "The complete cDNA and amino acid sequence of human apolipoprotein B-100.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Chen SH, Yang CY, Chen PF, Setzer D, Tanimura M, Li WH, Gotto AM Jr, Chan L", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3759943", "url": "https://glygen.org/publication/PubMed/3759943" } ] }, { "title": "Complete cDNA and derived protein sequence of human apolipoprotein B-100.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Knott T J, Wallis S C, Powell L M, Pease R J, Lusis A J, Blackhart B, McCarthy B J, Mahley R W, Levy-Wilson B, Scott J", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3763409", "url": "https://glygen.org/publication/PubMed/3763409" } ] }, { "title": "Complete protein sequence and identification of structural domains of human apolipoprotein B.", "journal": "Nature", "date": "1986", "authors": "Knott T J, Pease R J, Powell L M, Wallis S C, Rall S C, Innerarity T L, Blackhart B, Taylor W H, Marcel Y, Milne R", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3773997", "url": "https://glygen.org/publication/PubMed/3773997" } ] }, { "title": "Associations between apolipoprotein B and bone mineral density: a population-based study.", "journal": "BMC musculoskeletal disorders", "date": "2023-11-02", "authors": "Zhao Xuefei, Tan Ning, Zhang Ya, Xiao Mengde, Li Lihong, Ning Zhongxing, Liu Mingjiang, Jin Haimin", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" } ], "reference": [ { "type": "PubMed", "id": "37919727", "url": "https://glygen.org/publication/PubMed/37919727" } ] }, { "title": "Association of APO B gene polymorphisms with the development of myocardial infarction in Pakistani population.", "journal": "Gene", "date": "2024-02-20", "authors": "Arshad Muhammad, Iqbal Riffat, Raza Muzammal, Bashir Razia, Ahmed Tanveer, Parveen Asia", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" } ], "reference": [ { "type": "PubMed", "id": "38042210", "url": "https://glygen.org/publication/PubMed/38042210" } ] }, { "title": "The relationship between genetic liver fat and coronary heart disease is explained by apoB-containing lipoproteins.", "journal": "Atherosclerosis", "date": "2024-01", "authors": "Bj\u00f6rnson Elias, Adiels Martin, Bergstr\u00f6m G\u00f6ran, Gummesson Anders", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" } ], "reference": [ { "type": "PubMed", "id": "38102060", "url": "https://glygen.org/publication/PubMed/38102060" } ] }, { "title": "Integrative bioinformatics analysis identifies APOB as a critical biomarker in coronary in-stent restenosis.", "journal": "Biomarkers in medicine", "date": "2023-12", "authors": "Bai Xinghua, Zhang Weizong, Yu Tao", "evidence": [ { "database": "RefSeq", "id": "NP_000375", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000375" } ], "reference": [ { "type": "PubMed", "id": "38223945", "url": "https://glygen.org/publication/PubMed/38223945" } ] }, { "title": "Molecular cloning of human apolipoprotein B cDNA.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Carlsson P, Olofsson S O, Bondjers G, Darnfors C, Wiklund O, Bjursell G", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3841204", "url": "https://glygen.org/publication/PubMed/3841204" } ] }, { "title": "Molecular cloning of human LDL apolipoprotein B cDNA. Evidence for more than one gene per haploid genome.", "journal": "Atherosclerosis", "date": "1985", "authors": "Shoulders C C, Myant N B, Sidoli A, Rodriguez J C, Cortese C, Baralle F E, Cortese R", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3841481", "url": "https://glygen.org/publication/PubMed/3841481" } ] }, { "title": "A partial cDNA clone for human apolipoprotein B.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Deeb S S, Motulsky A G, Albers J J", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3860836", "url": "https://glygen.org/publication/PubMed/3860836" } ] }, { "title": "Human apolipoprotein B: identification of cDNA clones and characterization of mRNA.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Mehrabian M, Schumaker V N, Fareed G C, West R, Johnson D F, Kirchgessner T, Lin H C, Wang X B, Ma Y H, Mendiaz E", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "3903660", "url": "https://glygen.org/publication/PubMed/3903660" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Vauhkonen M, Viitala J, Parkkinen J, Rauvala H", "evidence": [ { "database": "GlyConnect", "id": "57", "url": "https://glyconnect.expasy.org/browser/proteins/57" } ], "reference": [ { "type": "PubMed", "id": "4043085", "url": "https://glygen.org/publication/PubMed/4043085" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Role of lysines in mediating interaction of modified low density lipoproteins with the scavenger receptor of human monocyte macrophages.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Haberland ME, Olch CL, Folgelman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "6088540", "url": "https://glygen.org/publication/PubMed/6088540" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "The scavenger cell pathway for lipoprotein degradation: specificity of the binding site that mediates the uptake of negatively-charged LDL by macrophages.", "journal": "Journal of supramolecular structure", "date": "1980", "authors": "Brown MS, Basu SK, Falck JR, Ho YK, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "6255257", "url": "https://glygen.org/publication/PubMed/6255257" } ] }, { "title": "Human apolipoprotein B: partial amino acid sequence.", "journal": "FEBS Lett.", "date": "1984", "authors": "LeBoeuf R C, Miller C, Shively J E, Schumaker V N, Balla M A, Lusis A J", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "6373369", "url": "https://glygen.org/publication/PubMed/6373369" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "Inter-relationship of lipids transferred by the lipid-transfer protein isolated from human lipoprotein-deficient plasma.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Morton RE, Zilversmit DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "6619141", "url": "https://glygen.org/publication/PubMed/6619141" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "CD36 gene transfer confers capacity for phagocytosis of cells undergoing apoptosis.", "journal": "The Journal of experimental medicine", "date": "1995", "authors": "Ren Y, Silverstein RL, Allen J, Savill J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7536797", "url": "https://glygen.org/publication/PubMed/7536797" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Interaction of tyrosine-based sorting signals with clathrin-associated proteins.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Ohno H, Stewart J, Fournier MC, Bosshart H, Rhee I, Miyatake S, Saito T, Gallusser A, Kirchhausen T, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7569928", "url": "https://glygen.org/publication/PubMed/7569928" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Macrophage scavenger receptor mediates the endocytic uptake and degradation of advanced glycation end products of the Maillard reaction.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Araki N, Higashi T, Mori T, Shibayama R, Kawabe Y, Kodama T, Takahashi K, Shichiri M, Horiuchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "7607209", "url": "https://glygen.org/publication/PubMed/7607209" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "Cloning of a rat adipocyte membrane protein implicated in binding or transport of long-chain fatty acids that is induced during preadipocyte differentiation. Homology with human CD36.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Abumrad NA, el-Maghrabi MR, Amri EZ, Lopez E, Grimaldi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7688729", "url": "https://glygen.org/publication/PubMed/7688729" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Identification of two classes of lipid molecule binding sites on the microsomal triglyceride transfer protein.", "journal": "Biochemistry", "date": "1994", "authors": "Atzel A, Wetterau JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8866423", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423" } ], "reference": [ { "type": "PubMed", "id": "7803401", "url": "https://glygen.org/publication/PubMed/7803401" } ] }, { "title": "Arrestin interactions with G protein-coupled receptors. Direct binding studies of wild type and mutant arrestins with rhodopsin, beta 2-adrenergic, and m2 muscarinic cholinergic receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gurevich VV, Dion SB, Onorato JJ, Ptasienski J, Kim CM, Sterne-Marr R, Hosey MM, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7822302", "url": "https://glygen.org/publication/PubMed/7822302" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "Familial ligand-defective apolipoprotein B. Identification of a new mutation that decreases LDL receptor binding affinity.", "journal": "The Journal of clinical investigation", "date": "1995", "authors": "Pullinger CR, Hennessy LK, Chatterton JE, Liu W, Love JA, Mendel CM, Frost PH, Malloy MJ, Schumaker VN, Kane JP", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "7883971", "url": "https://glygen.org/publication/PubMed/7883971" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Purification, cloning, and expression of a human enzyme with acyl coenzyme A: cholesterol acyltransferase activity, which is identical to liver carboxylesterase.", "journal": "Arteriosclerosis and thrombosis : a journal of vascular biology", "date": "1994", "authors": "Becker A, Bottcher A, Lackner KJ, Fehringer P, Notka F, Aslanidis C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "8049197", "url": "https://glygen.org/publication/PubMed/8049197" } ] }, { "title": "Purification, characterization and molecular cloning of human hepatic lysosomal acid lipase.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Ameis D, Merkel M, Eckerskorn C, Greten H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "8112342", "url": "https://glygen.org/publication/PubMed/8112342" } ] }, { "title": "The type I macrophage scavenger receptor binds to gram-positive bacteria and recognizes lipoteichoic acid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Dunne DW, Resnick D, Greenberg J, Krieger M, Joiner KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8127896", "url": "https://glygen.org/publication/PubMed/8127896" } ] }, { "title": "Mutations at the lysosomal acid cholesteryl ester hydrolase gene locus in Wolman disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Anderson RA, Byrum RS, Coates PM, Sando GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "8146180", "url": "https://glygen.org/publication/PubMed/8146180" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "Structure, chromosome location, and expression of the human very low density lipoprotein receptor gene.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Sakai J, Hoshino A, Takahashi S, Miura Y, Ishii H, Suzuki H, Kawarabayasi Y, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "8294473", "url": "https://glygen.org/publication/PubMed/8294473" } ] }, { "title": "Secretion-capture role for apolipoprotein E in remnant lipoprotein metabolism involving cell surface heparan sulfate proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ji ZS, Fazio S, Lee YL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964026" } ], "reference": [ { "type": "PubMed", "id": "8300609", "url": "https://glygen.org/publication/PubMed/8300609" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "Molecular cloning and functional expression of human acyl-coenzyme A:cholesterol acyltransferase cDNA in mutant Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Chang CC, Huh HY, Cadigan KM, Chang TY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "8407899", "url": "https://glygen.org/publication/PubMed/8407899" } ] }, { "title": "Endothelial-cell heme uptake from heme proteins: induction of sensitization and desensitization to oxidant damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Balla J, Jacob HS, Balla G, Nath K, Eaton JW, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8415693", "url": "https://glygen.org/publication/PubMed/8415693" } ] }, { "title": "Polynucleotide binding to macrophage scavenger receptors depends on the formation of base-quartet-stabilized four-stranded helices.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Pearson AM, Rich A, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8429030", "url": "https://glygen.org/publication/PubMed/8429030" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Role of beta-arrestin in mediating agonist-promoted G protein-coupled receptor internalization.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Ferguson SS, Downey WE 3rd, Colapietro AM, Barak LS, Menard L, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8553074", "url": "https://glygen.org/publication/PubMed/8553074" } ] }, { "title": "Demonstration of a physical interaction between microsomal triglyceride transfer protein and apolipoprotein B during the assembly of ApoB-containing lipoproteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wu X, Zhou M, Huang LS, Wetterau J, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "8626595", "url": "https://glygen.org/publication/PubMed/8626595" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "Scavenger receptor-mediated adhesion of microglia to beta-amyloid fibrils.", "journal": "Nature", "date": "1996", "authors": "El Khoury J, Hickman SE, Thomas CA, Cao L, Silverstein SC, Loike JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8751442", "url": "https://glygen.org/publication/PubMed/8751442" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Binding studies of a triple-helical peptide model of macrophage scavenger receptor to tetraplex nucleic acids.", "journal": "Biochemistry", "date": "1996", "authors": "Mielewczyk SS, Breslauer KJ, Anachi RB, Brodsky B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8784195", "url": "https://glygen.org/publication/PubMed/8784195" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Beta-arrestin acts as a clathrin adaptor in endocytosis of the beta2-adrenergic receptor.", "journal": "Nature", "date": "1996", "authors": "Goodman OB Jr, Krupnick JG, Santini F, Gurevich VV, Penn RB, Gagnon AW, Keen JH, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8837779", "url": "https://glygen.org/publication/PubMed/8837779" } ] }, { "title": "Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Oyake T, Itoh K, Motohashi H, Hayashi N, Hoshino H, Nishizawa M, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8887638", "url": "https://glygen.org/publication/PubMed/8887638" } ] }, { "title": "Detection of new variants in the apolipoprotein B (Apo B) gene by PCR-SSCP.", "journal": "Hum. Mutat.", "date": "1996", "authors": "Poirier O, Ricard S, Behague I, Souriau C, Evans A E, Arveiler D, Marques-Vidal P, Luc G, Roizes G, Cambien F", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "8889592", "url": "https://glygen.org/publication/PubMed/8889592" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "Murine SR-BI, a high density lipoprotein receptor that mediates selective lipid uptake, is N-glycosylated and fatty acylated and colocalizes with plasma membrane caveolae.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Babitt J, Trigatti B, Rigotti A, Smart EJ, Anderson RG, Xu S, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9148942", "url": "https://glygen.org/publication/PubMed/9148942" } ] }, { "title": "Arrestin/clathrin interaction. Localization of the arrestin binding locus to the clathrin terminal domain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Goodman OB Jr, Krupnick JG, Gurevich VV, Benovic JL, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9169477", "url": "https://glygen.org/publication/PubMed/9169477" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "Characterization of CLA-1, a human homologue of rodent scavenger receptor BI, as a receptor for high density lipoprotein and apoptotic thymocytes.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Murao K, Terpstra V, Green SR, Kondratenko N, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9211901", "url": "https://glygen.org/publication/PubMed/9211901" } ] }, { "title": "Endocytic uptake of lysophosphatidylcholine mediated by macrophage scavenger receptor plays a major role in oxidized low density lipoprotein-induced macrophage growth.", "journal": "Journal of atherosclerosis and thrombosis", "date": "1996", "authors": "Sakai M, Miyazaki A, Hakamata H, Kobori S, Shichiri M, Horiuchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9225214", "url": "https://glygen.org/publication/PubMed/9225214" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "Apolipoproteins of HDL can directly mediate binding to the scavenger receptor SR-BI, an HDL receptor that mediates selective lipid uptake.", "journal": "Journal of lipid research", "date": "1997", "authors": "Xu S, Laccotripe M, Huang X, Rigotti A, Zannis VI, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9254056", "url": "https://glygen.org/publication/PubMed/9254056" } ] }, { "title": "Familial ligand-defective apolipoprotein B-100: simultaneous detection of the ARG3500-->GLN and ARG3531-->CYS mutations in a French population.", "journal": "Human mutation", "date": "1997", "authors": "Rabes JP, Varret M, Saint-Jore B, Erlich D, Jondeau G, Krempf M, Giraudet P, Junien C, Boileau C", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "9259199", "url": "https://glygen.org/publication/PubMed/9259199" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.", "journal": "Genes & development", "date": "1997", "authors": "Salcini AE, Confalonieri S, Doria M, Santolini E, Tassi E, Minenkova O, Cesareni G, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9303539", "url": "https://glygen.org/publication/PubMed/9303539" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Expression cloning of a novel scavenger receptor from human endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Adachi H, Tsujimoto M, Arai H, Inoue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000484", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484" } ], "reference": [ { "type": "PubMed", "id": "9395444", "url": "https://glygen.org/publication/PubMed/9395444" } ] }, { "title": "CLA-1 is an 85-kD plasma membrane glycoprotein that acts as a high-affinity receptor for both native (HDL, LDL, and VLDL) and modified (OxLDL and AcLDL) lipoproteins.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1997", "authors": "Calvo D, Gomez-Coronado D, Lasuncion MA, Vega MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9409200", "url": "https://glygen.org/publication/PubMed/9409200" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "Evidence that the lipid moiety of oxidized low density lipoprotein plays a role in its interaction with macrophage receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Terpstra V, Bird DA, Steinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9465098", "url": "https://glygen.org/publication/PubMed/9465098" } ] }, { "title": "Structure of the human macrophage MARCO receptor and characterization of its bacteria-binding region.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Elomaa O, Sankala M, Pikkarainen T, Bergmann U, Tuuttila A, Raatikainen-Ahokas A, Sariola H, Tryggvason K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9468508", "url": "https://glygen.org/publication/PubMed/9468508" } ] }, { "title": "Screening for mutations of the apolipoprotein B gene causing hypocholesterolemia.", "journal": "Hum. Genet.", "date": "1998", "authors": "Leren T P, Bakken K S, Hoel V, Hjermann I, Berg K", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "reference": [ { "type": "PubMed", "id": "9490296", "url": "https://glygen.org/publication/PubMed/9490296" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Scavenger receptors mediate adhesion of activated B lymphocytes.", "journal": "Experimental cell research", "date": "1998", "authors": "Yokota T, Ehlin-Henriksson B, Hansson GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9511720", "url": "https://glygen.org/publication/PubMed/9511720" } ] }, { "title": "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake.", "journal": "Journal of lipid research", "date": "1998", "authors": "Gough PJ, Greaves DR, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9548586", "url": "https://glygen.org/publication/PubMed/9548586" } ] }, { "title": "Intracellular metabolism of human apolipoprotein(a) in stably transfected Hep G2 cells.", "journal": "Biochemistry", "date": "1998", "authors": "Lobentanz EM, Krasznai K, Gruber A, Brunner C, Muller HJ, Sattler J, Kraft HG, Utermann G, Dieplinger H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "9548923", "url": "https://glygen.org/publication/PubMed/9548923" } ] }, { "title": "Apolipoprotein B-48 or its apolipoprotein B-100 equivalent mediates the binding of triglyceride-rich lipoproteins to their unique human monocyte-macrophage receptor.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Gianturco SH, Ramprasad MP, Song R, Li R, Brown ML, Bradley WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964046", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046" } ], "reference": [ { "type": "PubMed", "id": "9633939", "url": "https://glygen.org/publication/PubMed/9633939" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Molecular and enzymatic analyses of lysosomal acid lipase in cholesteryl ester storage disease.", "journal": "Molecular genetics and metabolism", "date": "1998", "authors": "Du H, Sheriff S, Bezerra J, Leonova T, Grabowski GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "9705237", "url": "https://glygen.org/publication/PubMed/9705237" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.", "journal": "Nature", "date": "1998", "authors": "Chen H, Fre S, Slepnev VI, Capua MR, Takei K, Butler MH, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9723620", "url": "https://glygen.org/publication/PubMed/9723620" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "Characterization of two human genes encoding acyl coenzyme A:cholesterol acyltransferase-related enzymes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Oelkers P, Behari A, Cromley D, Billheimer JT, Sturley SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038" } ], "reference": [ { "type": "PubMed", "id": "9756920", "url": "https://glygen.org/publication/PubMed/9756920" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "A structural explanation for the recognition of tyrosine-based endocytotic signals.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Owen DJ, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9812899", "url": "https://glygen.org/publication/PubMed/9812899" } ] }, { "title": "CD36 is required for phagocytosis of apoptotic cells by human macrophages that use either a phosphatidylserine receptor or the vitronectin receptor (alpha v beta 3).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Fadok VA, Warner ML, Bratton DL, Henson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9834113", "url": "https://glygen.org/publication/PubMed/9834113" } ] }, { "title": "Molecular cloning and expression of lipid transfer inhibitor protein reveals its identity with apolipoprotein F.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wang X, Driscoll DM, Morton RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041" } ], "reference": [ { "type": "PubMed", "id": "9880564", "url": "https://glygen.org/publication/PubMed/9880564" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] } ], "pathway": [ { "id": "hsa:338", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:338", "resource": "KEGG Pathway" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-3000471", "name": "Scavenging by Class B Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "resource": "Reactome", "description": "Scavenging by Class B Receptors" }, { "id": "R-HSA-3000480", "name": "Scavenging by Class A Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480", "resource": "Reactome", "description": "Scavenging by Class A Receptors" }, { "id": "R-HSA-3000484", "name": "Scavenging by Class F Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000484", "resource": "Reactome", "description": "Scavenging by Class F Receptors" }, { "id": "R-HSA-3000497", "name": "Scavenging by Class H Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000497", "resource": "Reactome", "description": "Scavenging by Class H Receptors" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-432142", "name": "Platelet sensitization by LDL", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432142", "resource": "Reactome", "description": "Platelet sensitization by LDL" }, { "id": "R-HSA-5686938", "name": "Regulation of TLR by endogenous ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5686938", "resource": "Reactome", "description": "Regulation of TLR by endogenous ligand" }, { "id": "R-HSA-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" }, { "id": "R-HSA-8866423", "name": "VLDL assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866423", "resource": "Reactome", "description": "VLDL assembly" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-8963888", "name": "Chylomicron assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "resource": "Reactome", "description": "Chylomicron assembly" }, { "id": "R-HSA-8963901", "name": "Chylomicron remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "resource": "Reactome", "description": "Chylomicron remodeling" }, { "id": "R-HSA-8964026", "name": "Chylomicron clearance", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964026", "resource": "Reactome", "description": "Chylomicron clearance" }, { "id": "R-HSA-8964038", "name": "LDL clearance", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964038", "resource": "Reactome", "description": "LDL clearance" }, { "id": "R-HSA-8964041", "name": "LDL remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964041", "resource": "Reactome", "description": "LDL remodeling" }, { "id": "R-HSA-8964046", "name": "VLDL clearance", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964046", "resource": "Reactome", "description": "VLDL clearance" }, { "id": "R-HSA-9707616", "name": "Heme signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "resource": "Reactome", "description": "Heme signaling" }, { "id": "R-HSA-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" } ], "orthologs": [ { "uniprot_canonical_ac": "E9Q414-1", "protein_name": "Apolipoprotein B-100", "gene_name": "Apob", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGPRKPALRTPLLLLFLLLFLDTSVWAQDEVLENLSFSCPKDATRFKHLRKYVYNYEAESSSGVQGTADSRSATKINCKVELEVPQICGFIMRTNQCTLKEVYGFNPEGKALMKKTKNSEEFAAAMSRYELKLAIPEGKQIVLYPDKDEPKYILNIKRGIISALLVPPETEEDQQELFLDTVYGNCSTQVTVNSRKGTVPTEMSTERNLQQCDGFQPISTSVSPLALIKGLVHPLSTLISSSQTCQYTLDPKRKHVSEAVCDEQHLFLPFSYKNKYGIMTRVTQKLSLEDTPKINSRFFSEGTNRMGLAFESTKSTSSPKQADAVLKTLQELKKLSISEQNAQRANLFNKLVTELRGLTGEAITSLLPQLIEVSSPITLQALVQCGQPQCYTHILQWLKTEKAHPLLVDIVTYLMALIPNPSTQRLQEIFNTAKEQQSRATLYALSHAVNSYFDVDHSRSPVLQDIAGYLLKQIDNECTGNEDHTFLILRVIGNMGRTMEQVMPALKSSVLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDINKIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIKNALENSQFPTIMDFRKFSRNYQISKSASLPMFDPVSVKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGRVPDGVSKVLVDHFGYTTDGKHEQDMVNGIMPIVDKLIKDLKSKEIPEARAYLRILGKELSFVRLQDLQVLGKLLLSGAQTLQGIPQMVVQAIREGSKNDLFLHYIFMDNAFELPTGAGLQLQVSSSGVFTPGIKAGVRLELANIQAELVAKPSVSLEFVTNMGIIIPDFAKSSVQMNTNFFHESGLEARVALKAGQLKVIIPSPKRPVKLFSGSNTLHLVSTTKTEVIPPLVENRQSWSTCKPLFTGMNYCTTGAYSNASSTESASYYPLTGDTRYELELRPTGEVEQYSATATYELLKEDKSLVDTLKFLVQAEGVQQSEATVLFKYNRRSRTLSSEVLIPGFDVNFGTILRVNDESAKDKNTYKLILDIQNKKITEVSLVGHLSYDKKGDGKIKGVVSIPRLQAEARSEVHTHWSSTKLLFQMDSSATAYGSTISKRVTWRYDNEIIEFDWNTGTNVDTKKVASNFPVDLSHYPRMLHEYANGLLDHRVPQTDVTFRDMGSKLIVATNTWLQMATRGLPYPQTLQDHLNSLSELNLLKMGLSDFHIPDNLFLKTDGRVKYTMNRNKINIDIPLPLGGKSSKDLKMPESVRTPALNFKSVGFHLPSREVQVPTFTIPKTHQLQVPLLGVLDLSTNVYSNLYNWSASYTGGNTSRDHFSLQAQYRMKTDSVVDLFSYSVQGSGETTYDSKNTFTLSCDGSLHHKFLDSKFKVSHVEKFGNSPVSKGLLTFETSSALGPQMSATVHLDSKKKQHLYVKDIKVDGQFRASSFYAQGKYGLSCERDVTTGQLSGESNMRFNSTYFQGTNQIVGMYQDGALSITSTSDLQDGIFKNTASLKYENYELTLKSDSSGQYENFAASNKLDVTFSTQSALLRSEHQANYKSLRLVTLLSGSLTSQGVELNADILGTDKINTGAHKATLKIARDGLSTSATTNLKYSPLLLENELNAELGLSGASMKLSTNGRFKEHHAKFSLDGRAALTEVSLGSIYQAMILGADSKNIFNFKLSREGLRLSNDLMGSYAEMKLDHTHSLNIAGLSLDFFSKMDNIYSGDKFYKQNFNLQLQPYSFITTLSNDLRYGALDLTNNGRFRLEPLKLNVGGNFKGTYQNNELKHIYTISYTDLVVASYRADTVAKVQGVEFSHRLNADIEGLTSSVDVTTSYNSDPLHFNNVFHFSLAPFTLGIDTHTSGDGKLSFWGEHTGQLYSKFLLKAEPLALIVSHDYKGSTSHSLPYESSISTALEHTVSALLTPAEQTSTWKFKTKLNDKVYSQDFEAYNTKDKIGVELSGRADLSGLYSPIKLPFFYSEPVNVLNGLEVNDAVDKPQEFTIIAVVKYDKNQDVHTINLPFFKSLPDYLERNRRGMISLLEAMRGELQRLSVDQFVRKYRAALSRLPQQIHHYLNASDWERQVAGAKEKITSFMENYRITDNDVLIAIDSAKINFNEKLSQLETYAIQFDQYIKDNYDPHDLKRTIAEIIDRIIEKLKILDEQYHIRVNLAKSIHNLYLFVENVDLNQVSSSNTSWIQNVDSNYQVRIQIQEKLQQLRTQIQNIDIQQLAAEVKRQMDAIDVTMHLDQLRTAILFQRISDIIDRVKYFVMNLIEDFKVTEKINTFRVIVRELIEKYEVDQHIQVLMDKSVELAHRYSLSEPLQKLSNVLQRIEIKDYYEKLVGFIDDTVEWLKALSFKNTIEELNRLTDMLVKKLKAFDYHQFVDKTNSKIREMTQRINAEIQALKLPQKMEALKLLVEDFKTTVSNSLERLKDTKVTVVIDWLQDILTQMKDHFQDTLEDVRDRIYQMDIQRELEHFLSLVNQVYSTLVTYMSDWWTLTAKNITDFAEQYSIQNWAESIKVLVEQGFIVPEMQTFLWTMPAFEVSLRALQEGNFQTPVFIVPLTDLRIPSIRINFKMLKNIKIPLRFSTPEFTLLNTFHVHSFTIDLLEIKAKIIRTIDQILSSELQWPLPEMYLRDLDVVNIPLARLTLPDFHVPEITIPEFTIPNVNLKDLHVPDLHIPEFQLPHLSHTIEIPAFGKLHSILKIQSPLFILDANANIQNVTTSGNKAEIVASVTAKGESQFEALNFDFQAQAQFLELNPHPPVLKESMNFSSKHVRMEHEGEIVFDGKAIEGKSDTVASLHTEKNEVEFNNGMTVKVNNQLTLDSHTKYFHKLSVPRLDFSSKASLNNEIKTLLEAGHVALTSSGTGSWNWACPNFSDEGIHSSQISFTVDGPIAFVGLSNNINGKHLRVIQKLTYESGFLNYSKFEVESKVESQHVGSSILTANGRALLKDAKAEMTGEHNANLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVGFPLKLTGKIDFLNNYALFLSPRAQQASWQASTRFNQYKYNQNFSAINNEHNIEASIGMNGDANLDFLNIPLTIPEINLPYTEFKTPLLKDFSIWEETGLKEFLKTTKQSFDLSVKAQYKKNSDKHSIVVPLGMFYEFILNNVNSWDRKFEKVRNNALHFLTTSYNEAKIKVDKYKTENSLNQPSGTFQNHGYTIPVVNIEVSPFAVETLASSHVIPTAISTPSVTIPGPNIMVPSYKLVLPPLELPVFHGPGNLFKFFLPDFKGFNTIDNIYIPAMGNFTYDFSFKSSVITLNTNAGLYNQSDIVAHFLSSSSFVTDALQYKLEGTSRLMRKRGLKLATAVSLTNKFVKGSHDSTISLTKKNMEASVRTTANLHAPIFSMNFKQELNGNTKSKPTVSSSIELNYDFNSSKLHSTATGGIDHKFSLESLTSYFSIESFTKGNIKSSFLSQEYSGSVANEANVYLNSKGTRSSVRLQGASKVDGIWNVEVGENFAGEATLQRIYTTWEHNMKNHLQVYSYFFTKGKQTCRATLELSPWTMSTLLQVHVSQLSSLLDLHHFDQEVILKANTKNQKISWKGGVQVESRVLQHNAQFSNDQEEIRLDLAGSLDGQLWDLEAIFLPVYGKSLQELLQMDGKRQYLQASTSLLYTKNPNGYLLSLPVQELADRFIIPGIKLNDFSGVKIYKKLSTSPFALNLTMLPKVKFPGIDLLTQYSTPEGSSVPIFEATIPEIHLTVSQFTLPKSLPVGNTVFDLNKLANMIADVDLPSVTLPEQTIVIPPLEFSVPAGIFIPFFGELTARAGMASPLYNVTWSAGWKTKADHVETFLDSMCTSTLQFLEYALKVVETHKIEEDLLTYNIKGTLQHCDFNVEYNEDGLFKGLWDWQGEAHLDITSPALTDFHLYYKEDKTSLSASAASSTIGTVGLDSSTDDQSVELNVYFHPQSPPEKKLSIFKTEWRYKESDGERYIKINWEEEAASRLLGSLKSNVPKASKAIYDYANKYHLEYVSSELRKSLQVNAEHARRMVDEMNMSFQRVARDTYQNLYEEMLAQKSLSIPENLKKRVLDSIVHVTQKYHMAVMWLMDSFIHFLKFNRVQFPGYAGTYTVDELYTIVMKETKKSLSQLFNGLGNLLSYVQNQVEKSRLINDITFKCPFFSKPCKLKDLILIFREELNILSNIGQQDIKFTTILSSLQGFLERVLDIIEEQIKCLKDNESTCVADHINMVFKIQVPYAFKSLREDIYFVLGEFNDFLQSILQEGSYKLQQVHQYMKALREEYFDPSMVGWTVKYYEIEENMVELIKTLLVSFRDVYSEYSVTAADFASKMSTQVEQFVSRDIREYLSMLTDINGKWMEKIAELSIVAKETMKSWVTAVAKIMSDYPQQFHSNLQDFSDQLSSYYEKFVGESTRLIDLSIQNYHVFLRYITELLRKLQVATANNVSPYIKLAQGELMITF", "length": 4505 }, "evidence": [ { "id": "45921601", "url": "http://www.informatics.jax.org/homology/45921601", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TMA5-1", "protein_name": "Apolipoprotein B-100", "gene_name": "Apob", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGPQRPALRAPLLLLFLLLFLDTSVWAQDATRFKHLRKYVYSYEAESSSGVRGTADSRSATKINCKVELEVPQVCTLIMRTSQCTLKEVYGFNPEGKALMKKTKNSEEFASAMSRYELKLAFPEGKRVALYPDLGEPNYILNIKRGIISALLVPPETEEDKQVLFQDTVYGNCSTQVTVNSRKGTVATEMSTERNLQHCDGFQPISTSVSPLALIKGLVRPLSTLISSSQSCQYTLEPKRKHVSEAICNEQHLFLPFSYKNKYGIMTHVTQKLSLEDTPKINSRFFRGGINQVGLAFESTKSTSPPKQADAVLKTLQELKKLSISEQNAQRANLFHKLVTELRGLSGEAITSLLPQLIEVSSPITLQALIQCGQPECYTHILQWLKTEKAHPLLIDIVTYLMALIPNPSVQRLQEIFNTAKELQSRATLYALSHAVNSYYAIMDHSRSPVLEDIAGYLMKQIDNECMGDEDRTFLILRVIGNMGRTMERVMPALKSSVLNCVRSTKPSLQIQKAALQALRKMEMGDEVRTILFDTFVNDVAPVEKRLAAYLLLMRSPSSSDINKIAKLLQWEQSEQVKNFVASHIANILNSEELYVQDLKNLIKNALVNSRLPTIMDFRKFSRNYQISKSVSIPLFDPVSAKIEGNLVFDPSSYLPKESMLKTTLTVFGIASLDLFEIGLEGKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDRVSKVLVDHFGYTKDDKHEQDMVNGIMPIVDKLIKELKSKEIPEARAYLRILGKELGFVRLQDLQVLGKLLLNGAQTFRGVPQMIVQAIREGSKDDLFLHYIFMENAFELPTGVGLQLQVSSSGVFTPGIKAGVRLELANIQAELVAKPSVSLEFVTNMGIIIPDFAKSGVQMNTNFFHESGLEARVALKAGQLKVIIPSPKRPVKLFSGSNTLHLVSTTKTEVIPPLIENRKSWSTCKPFFTGMNYCTTGAYSNASSTESASYYPLTGDTRYELELKPTGEVEQYSASATYELLKEDKSLVDTLKFLVQAEGVQQSEATAMFKYNRRSRTLSSEVLIPGFDVNFGTILRVNDESSKDKNTYKLILDIQNKKITEVSVVGHVSYDKKGDGKVKGVVSIPRLQAEARSEVHTHWSPTKLLFQMDSSATAYGSTISKRVAWRYDNEKIEFDWNTGTNVDTKKVASNFPVDLSRYPRMVHEYANGLLDHRVPQTDMTFRHMGSKLIVDHLNGLSELNLPKVGLPDFHIPDNLFLKTDGRVKYTLNKNRIEIDIPLPLGGKSSKDLKVPESVRTPALNFKSVGFHLPSQEVQIPTFTIPKTHQLQVPLLGILDLSTNVYSNLYNWSVSYTGGNTSRDHFSLQAQYRMKADSVVDLFSYSVQGSGETTYDSKSTFTLSCDGSLHHKFLDSKFKVSHVEKFGNNPVSKGLLTFETSSALGPQMSATVQLDSKKKQHLYVKDIKVDGQFRVFSLYAQGEYGLSYERDSMTGQMSGESNMKFNSTYFQGTNQIVGMYQDGMLSVTSTSDLQDGIFKNTASLKYENYELTLKSDSSGQYENFAASNKLDMTFSKQSALLRSEHQANYKSLRLVTLLSGSLTSQGVELNADILGTDKINTGAHKSTLKIAQDGVSTSATTNLKYSPLLLENELNAELGLSGASMKLSTSGRFKEHHAKFSLDGRAALTEVSLGSIYQAMILGADSKNVFNFKLSREGLKLSNDMMGSYAEMKLDHTHSLRISGLSLDFFSKMDNIYSGDKFYKQNFNLQLQPYSFGITLSNDLKYDALVLTNNGRLRLEPLKLNVGGNFKGTYQNNELKHIYTISYTDLVVASYRADTVATVQGVEFSHRLNADIEGLASSVDVTTSYSSDPLHFNNVFRFVLAPFTLGVDTHTSGDGKMSLWGEHTGQMYSKFLLKAEPLALTFSHDYKGSTSHNLLYKNSVSTALEHTLSALLTPAEQTSSWKFKTSLNDKVYSQEFEAYNTKDKIGIELSGRADLSGLYSPIKVPFFYSEPVNVLNSLEINDAFDEPREFTIDAVVKYDKNQDVHTISLPFFQSLPDYLERNRRGIISLLEAMKGELQRLSVDQFVRKYRVALSRLPQQIHDYLNASDWERQVAGAKEKLTSFMENYRITDNDVLIALDSAKINLNEKLSQLETYAIQFDQYIRDNYDAQDLKRTIAQIIDRIIEKLKMLDEQYHIRVNLAKSIHNLYLFVENVDLNQISSSGASWIQNVDTKYQIRIQIQEKLQHLRTQIHNIDIQQLAAELKQQIEALDVPMHLDQLRTAILFQRISVIIERVKYFVMNLIEDFKVTEKINTFRVIVRELIEKYEVDRQIQVLMDKSIELAHRYSLSEPLQKLSNVLQQIEIKDYYDKLVGFIDDTVEWIKAVSFKNIIEELNRLIDMSVKKLKAFDYHQFVDKTNSKIREMTQRINAEIQALELPQKTEALKLWVEDFKTTVSNSLEKLKDTKVTVVVDWLQDGLAQIKAQFQDALEDVRDRIYQMDIQGELERCLSLVSQVYSTVVTYISDWWTLTAKNITDFAEQYSTQKWAESVKALVEQGFIVPEIQTFLGTMPAFEVSLHALQEANFQTPDFIVPLTDLRIPSIWINFKMLKNVKIPLRFSTPEFTLLNTFRVRSFTIDLLEIKAKIIRTIDQMLSSELQWPLPEVYLRDLEMVNISLARLSLPDFHVPEITIPEFTIPNVNLKDLQVPDLHIPEFQLPHLSCTTEIPAFGKLHSVLKIQSPLFILDASANIQNITTSENKAEIVASVTARGESKFEALNFDFQAQAQFLELNANPLVLKESVNFSSKHVRMEHEGKILVSGKALEGKSDTVARLHTEKNTVEFNNGIVVKINNQFTLDSQTKYFHKLSVPRLDFSSKASLNNEIKTLLEAGHMAWTSSGTGSWNWACPNFSDEGIHSSKISFIVDGPIASFGLSNNINGKHLRVVQKLTSESGFLNYSRFEVESKVESQHVGSSILTAEGRALLGDAKAEMTGEHNANLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVSFPLKLTGKIDFLNNYALFLSPHAQQASWQLSTRFNQYKYNQNFSAINNEHNMEASIVMNGDANLDFLNIPLTIPEINLPYTRFTTPLLKDFSIWEETGLKEFLKTTKQSFDLSIKAQYKKNRDKHSVVIPLKMFYEFMLNNVNSWDRKFEKVRDNALHFLTASYNETKIKFDKYKTENSLNQPSRTFQNRGHTIPVLNIEVSPFAVETLASSHVIPKAIRTPSVTIPGPNIIVPSYRLVLPSLQLPVFHIPRTLFKFSLPDFKKLSTIDNIYIPAMGNFTYDFSFKSSVITLNTNAGLYNQSDLVARFLSSSSFVTDALQYKLEGTSRLMRKKVLKLATAVSLTNKFLKGSHDSTISLTKKNMEASVKTTANLHAPIFTMNFKQELNGNTKSKPTVSSSIELNYDFNSSKLHSAAKGGVDHKFSLESLTSYLSIESFTKGNIKGSFLSQEYSGSVANEANVYLNSKGTRSSVRLQGASNFAGIWNFEVGENFAGEATLRRIYGTWEHNMINHLQVFSYFDTKGKQTCRATLELSPWTMSTLLQVHVSQPSPLFDLHHFDQEVILKASTKNQKVSWKSEVQVESQVLQHNAHFSNDQEEVRLDIAGSLEGQLWDLENFFLPAFGKSLRELLQIDGKRQYLQASTSLHYTKNPNGYLLSLPVQELTDRFIIPGLKLNDFSGIKIYKKLSTSPFALNLTMLPKVKFPGVDLLTQYSKPEGSSVPTFETTIPEIQLTVSQFTLPKSFPVGNTVFDLNKLTNLIADVDLPSITLPEQTIEIPSLEFSVPAGIFIPFFGELTAHVGMASPLYNVTWSTGWKNKADHVETFLDSTCSSTLQFLEYALKVVGTHRIENDKFIYKIKGTLQHCDFNVKYNEDGIFEGLWDLEGEAHLDITSPALTDFHLHYKEDKTSVSASAASPAIGTVSLDASTDDQSVRLNVYFRPQSPPDNKLSIFKMEWRDKESDGETYIKINWEEEAAFRLLDSLKSNVPKASEAVYDYVKKYHLGHASSELRKSLQNDAEHAIRMVDEMNVNAQRVTRDTYQSLYKKMLAQESQSIPEKLKKMVLGSLVRITQKYHMAVTWLMDSVIHFLKFNRVQFPGNAGTYTVDELYTIAMRETKKLLSQLFNGLGHLFSYVQDQVEKSRVINDITFKCPFSPTPCKLKDVLLIFREDLNILSNLGQQDINFTTILSDFQSFLERLLDIIEEKIECLKNNESTCVPDHINMFFKTHIPFAFKSLRENIYSVFSEFNDFVQSILQEGSYKLQQVHQYMKAFREEYFDPSVVGWTVKYYEIEEKMVDLIKTLLAPLRDFYSEYSVTAADFASKMSTQVEQFVSRDIREYLSMLADINGKGREKVAELSIVVKERIKSWSTAVAEITSDYLRQLHSKLQDFSDQLSGYYEKFVAESTRLIDLSIQNYHMFLRYIAELLKKLQVATANNGLLKRGDFEAAVKLGIACLYNEGLSVSDEAYAEVNGLKASRFFSMDERLNMGSDPFIWLSICPPCFRKLRDFAGKGCWEAQPALAKDCAGGSQLGLEGKAFSESVCQLFQASQAVNKQQIFSVQKGLSDTVRYILIGWLVEVAPMKDFTSLCLHLTVECVGRYLQRKLVPRYKLQLLGIACMVICTWFISKEILTIREAVRLTDNTYKYKDLVRVKREIISALEGKIRIPTVVDYKEVLLTLVPVTPRTQYLCSFLCELTLSVYTPAHLASAALLLARLMHGQTQP", "length": 4743 }, "evidence": [ { "id": "45921601", "url": "http://www.informatics.jax.org/homology/45921601", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "lipid transporter activity", "id": "GO:0005319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005319", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "phospholipid binding", "id": "GO:0005543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "low-density lipoprotein particle receptor binding", "id": "GO:0050750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050750", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lipase binding", "id": "GO:0035473", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035473", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cholesterol transfer activity", "id": "GO:0120020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120020", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 25, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "smooth endoplasmic reticulum", "id": "GO:0005790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005790", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lipid droplet", "id": "GO:0005811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endosome lumen", "id": "GO:0031904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031904", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "intermediate-density lipoprotein particle", "id": "GO:0034363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034363", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle membrane", "id": "GO:0030669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030669", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endoplasmic reticulum exit site", "id": "GO:0070971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070971", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle", "id": "GO:0034361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034361", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "chylomicron", "id": "GO:0042627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042627", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "low-density lipoprotein particle", "id": "GO:0034362", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034362", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "endocytic vesicle lumen", "id": "GO:0071682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071682", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "mature chylomicron", "id": "GO:0034359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034359", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "chylomicron remnant", "id": "GO:0034360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034360", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 26, "go_terms": [ { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "fertilization", "id": "GO:0009566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009566", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lipoprotein biosynthetic process", "id": "GO:0042158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042158", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lipoprotein transport", "id": "GO:0042953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042953", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "positive regulation of lipid storage", "id": "GO:0010884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010884", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "flagellated sperm motility", "id": "GO:0030317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030317", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "regulation of cholesterol biosynthetic process", "id": "GO:0045540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045540", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cholesterol efflux", "id": "GO:0033344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033344", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "low-density lipoprotein particle remodeling", "id": "GO:0034374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034374", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle assembly", "id": "GO:0034379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034379", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "post-embryonic development", "id": "GO:0009791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "positive regulation of macrophage derived foam cell differentiation", "id": "GO:0010744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010744", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "low-density lipoprotein particle clearance", "id": "GO:0034383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034383", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "triglyceride catabolic process", "id": "GO:0019433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019433", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "cholesterol transport", "id": "GO:0030301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030301", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "triglyceride mobilization", "id": "GO:0006642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006642", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "positive regulation of cholesterol storage", "id": "GO:0010886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010886", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "lipoprotein catabolic process", "id": "GO:0042159", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042159", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "artery morphogenesis", "id": "GO:0048844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048844", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" }, { "name": "establishment of localization in cell", "id": "GO:0051649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "apolipoprotein B-100 N-glycosylated 1 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-1523 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-1523, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053267", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053267" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 2 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-1523 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P04114-1, Asn-1523, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053268", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053268" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 3 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-1523 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P04114-1, Asn-1523, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053269", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053269" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 4 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-1523 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P04114-1, Asn-1523, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053270", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053270" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 5 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-1523 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-1523, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053271", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053271" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 6 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-185 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:P04114-1, Asn-185, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053272", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053272" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 7 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-185 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G31852PQ. Example: UniProtKB:P04114-1, Asn-185, MOD:00160~GNO:G31852PQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053273", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053273" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 8 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-185 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G62765YT. Example: UniProtKB:P04114-1, Asn-185, MOD:00160~GNO:G62765YT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053274", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053274" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 9 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-185 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G80920RR. Example: UniProtKB:P04114-1, Asn-185, MOD:00160~GNO:G80920RR. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053275", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053275" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 10 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-2982 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-2982, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053276", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053276" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 11 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-2982 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-2982, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053277", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053277" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 12 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053278", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053278" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 13 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053279", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053279" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 14 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G02815KT. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G02815KT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053280", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053280" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 15 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G05428EU. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G05428EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053281", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053281" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 16 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053282", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053282" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 17 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053283", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053283" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 18 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053284", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053284" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 19 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053285", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053285" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 20 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053286", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053286" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 21 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G39446WN. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G39446WN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053287", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053287" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 22 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053288", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053288" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 23 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053289", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053289" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 24 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G55070DG. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G55070DG. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053290", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053290" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 25 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G57776ZU. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G57776ZU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053291", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053291" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 26 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053292", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053292" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 27 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G62765YT. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G62765YT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053293", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053293" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 28 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G72787SB. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G72787SB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053294", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053294" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 29 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053295", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053295" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 30 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3411 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G95865ZB. Example: UniProtKB:P04114-1, Asn-3411, MOD:00160~GNO:G95865ZB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053296", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053296" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 31 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053297", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053297" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 32 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053298", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053298" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 33 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053299", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053299" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 34 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053300", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053300" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 35 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053301", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053301" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 36 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3465 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-3465, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053302", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053302" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 37 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3895 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-3895, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053303", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053303" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 38 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-3895 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-3895, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053304", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053304" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 39 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-983 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04114-1, Asn-983, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053305", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053305" } ] }, { "name": "apolipoprotein B-100 N-glycosylated 40 (human)", "definition": "An apolipoprotein B-100 (human) that has been N-glycosylated at the residue equivalent to Asn-983 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04114-1, Asn-983, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053306", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053306" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 1 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Ser-3605 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Ser-3605, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053307", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053307" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 2 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-3264 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-3264, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053308", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053308" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 3 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-3512 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-3512, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053309", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053309" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 4 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-3748 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-3748, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053310", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053310" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 5 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-3854 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-3854, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053311", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053311" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 6 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-4137 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-4137, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053312", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053312" } ] }, { "name": "apolipoprotein B-100 O-glycosylated 7 (human)", "definition": "An apolipoprotein B-100 (human) that has been O-glycosylated at the residue equivalent to Thr-4138 of the amino acid sequence represented by UniProtKB:P04114-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04114-1, Thr-4138, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053313", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053313" } ] } ], "site_annotation": [ { "start_pos": 1368, "end_pos": 1370, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1377, "end_pos": 1379, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1523, "end_pos": 1525, "annotation": "n_glycosylation_sequon" }, { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2239, "end_pos": 2241, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2560, "end_pos": 2562, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2779, "end_pos": 2781, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2982, "end_pos": 2984, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3101, "end_pos": 3103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3224, "end_pos": 3226, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3336, "end_pos": 3338, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3358, "end_pos": 3360, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3411, "end_pos": 3413, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3465, "end_pos": 3467, "annotation": "n_glycosylation_sequon" }, { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3895, "end_pos": 3897, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4237, "end_pos": 4239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4431, "end_pos": 4433, "annotation": "n_glycosylation_sequon" }, { "start_pos": 983, "end_pos": 985, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylated; structural requirement for proper assembly of the hydrophobic core of the lipoprotein particle.", "evidence": [ { "database": "UniProtKB", "id": "P04114", "url": "https://www.uniprot.org/uniprot/P04114" }, { "database": "PubMed", "id": "10679026", "url": "https://glygen.org/publication/PubMed/10679026" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 34, 185, 983, 1368, 1377, 1523, 2239, 2560, 2779, 2982, 3101, 3224, 3336, 3358, 3411, 3465, 3895, 4237, 4351, 4431 ], "o_linked_sites": [ 1318, 3213, 3220, 3264, 3512, 3605, 3748, 3854, 4133, 4137, 4138 ], "snv_sites": [ 34, 60, 200 ], "glycation_sites": [], "phosphorylation_sites": [ 520, 928, 1242, 1714, 1723, 2018, 2022, 2515, 2707, 2759, 3279, 3776, 3778, 4048, 4052, 4409, 4507, 4510 ], "sequon_annotation_sites": [ { "start_pos": 1368, "end_pos": 1370 }, { "start_pos": 1377, "end_pos": 1379 }, { "start_pos": 1523, "end_pos": 1525 }, { "start_pos": 185, "end_pos": 187 }, { "start_pos": 2239, "end_pos": 2241 }, { "start_pos": 2560, "end_pos": 2562 }, { "start_pos": 2779, "end_pos": 2781 }, { "start_pos": 2982, "end_pos": 2984 }, { "start_pos": 3101, "end_pos": 3103 }, { "start_pos": 3224, "end_pos": 3226 }, { "start_pos": 3336, "end_pos": 3338 }, { "start_pos": 3358, "end_pos": 3360 }, { "start_pos": 3411, "end_pos": 3413 }, { "start_pos": 3465, "end_pos": 3467 }, { "start_pos": 34, "end_pos": 36 }, { "start_pos": 3895, "end_pos": 3897 }, { "start_pos": 4237, "end_pos": 4239 }, { "start_pos": 4431, "end_pos": 4433 }, { "start_pos": 983, "end_pos": 985 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 207 }, { "field": "total_sites", "count": 30 }, { "field": "n_linked_glycans", "count": 84 }, { "field": "n_linked_glycan_sites", "count": 34 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 10 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 188 }, { "field": "total_sites", "count": 25 }, { "field": "n_linked_glycans", "count": 84 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 10 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 643 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }