{
"uniprot_canonical_ac": "P04070-1",
"uniprot_ac": "P04070",
"uniprot_id": "PROC_HUMAN",
"mass": {
"chemical_mass": 52071.0,
"monoisotopic_mass": 52071.0
},
"refseq": {
"ac": "NP_000303",
"name": "vitamin K-dependent protein C isoform 10 preproprotein",
"summary": "This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
},
"gene_names": [
{
"name": "PROC",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P04070",
"id": "P04070"
},
{
"name": "APC; PC; PROC1; THPH3; THPH4",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303",
"id": "NP_000303"
},
{
"name": "PROC",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303",
"id": "NP_000303"
}
],
"protein_names": [
{
"name": "Vitamin K-dependent protein C",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P04070"
},
{
"name": "3.4.21.69",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P04070"
},
{
"name": "Anticoagulant protein C",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P04070"
},
{
"name": "Autoprothrombin IIA",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P04070"
},
{
"name": "Blood coagulation factor XIV",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P04070"
},
{
"name": "vitamin K-dependent protein C isoform 10 preproprotein",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303",
"id": "NP_000303"
},
{
"name": "vitamin K-dependent protein C; autoprothrombin IIA; anticoagulant protein C; blood coagulation factor XIV; prepro-protein C; type I protein C; Protein C-Nagoya; activated protein C",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303",
"id": "NP_000303"
}
],
"function": [
{
"annotation": "Activated Protein C Prevents Neuronal Apoptosis via Protease Activated Receptors 1 and 3.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
},
{
"database": "PubMed",
"id": "38135361",
"url": "https://glygen.org/publication/PubMed/38135361"
}
]
},
{
"annotation": "Activated protein C, protein S, and tissue factor pathway inhibitor cooperate to inhibit thrombin activation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
},
{
"database": "PubMed",
"id": "37660436",
"url": "https://glygen.org/publication/PubMed/37660436"
}
]
},
{
"annotation": "Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids (PubMed:25618265). Exerts a protective effect on the endothelial cell barrier function (PubMed:25651845).",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070#function"
},
{
"database": "PubMed",
"id": "25618265",
"url": "https://glygen.org/publication/PubMed/25618265"
},
{
"database": "PubMed",
"id": "25651845",
"url": "https://glygen.org/publication/PubMed/25651845"
}
]
},
{
"annotation": "This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0111904",
"recommended_name": {
"id": "DOID:0111904",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111904",
"name": "autosomal recessive thrombophilia due to protein C deficiency",
"description": "A protein C deficiency characterized by typically early onset of venous thrombosis although in some cases it may have a milder, later onset that has_material_basis_in homozygous or compound heterozygous mutation in the PROC gene on chromosome 2q14.3."
},
"synonyms": [
{
"id": "DOID:0111904",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111904",
"name": "THPH4",
"description": ""
},
{
"id": "DOID:0111904",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111904",
"name": "autosomal recessive PROC deficiency",
"description": ""
},
{
"id": "DOID:0111904",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111904",
"name": "autosomal recessive protein C deficiency",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "thrombophilia due to protein C deficiency, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "thrombophilia 3 due to protein C deficiency, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "thrombophilia due to protein C deficiency, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "Proc deficiency, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "Protein C deficiency, autosomal recessive",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "THPH4",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "autosomal recessive hereditary thrombophilia due to protein C deficiency",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "autosomal recessive protein C deficiency",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "hereditary thrombophilia due to PC deficiency",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "hereditary thrombophilia due to congenital protein C deficiency",
"description": ""
},
{
"id": "MONDO:0012860",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012860",
"name": "thrombophilia due to PROTEIN C deficiency, autosomal recessive",
"description": ""
},
{
"id": "MIM:612304",
"resource": "MIM",
"url": "https://www.omim.org/entry/612304",
"name": "Thrombophilia due to protein C deficiency, autosomal recessive",
"description": "Thrombophilia due to protein C deficiency, autosomal recessive"
}
],
"evidence": [
{
"id": "612304",
"database": "MIM",
"url": "https://www.omim.org/entry/612304"
}
]
},
{
"disease_id": "DOID:0111909",
"recommended_name": {
"id": "DOID:0111909",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111909",
"name": "autosomal dominant thrombophilia due to protein C deficiency",
"description": "A thrombophilia characterized by reduced serum levels or impaired activity of PROC and in some patients recurrent venous thrombosis that has_material_basis_in heterozygous mutation in the PROC gene on chromosome 2q14.3."
},
"synonyms": [
{
"id": "DOID:0111909",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111909",
"name": "THPH3",
"description": ""
},
{
"id": "DOID:0111909",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111909",
"name": "autosomal dominant PROC deficiency",
"description": ""
},
{
"id": "DOID:0111909",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0111909",
"name": "autosomal dominant protein C deficiency",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "thrombophilia due to protein C deficiency, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "thrombophilia 3 due to protein C deficiency, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "thrombophilia due to protein C deficiency, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "Proc deficiency, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "Protein C deficiency, acquired",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "Protein C deficiency, autosomal dominant",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "THPH3",
"description": ""
},
{
"id": "MONDO:0008316",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008316",
"name": "thrombophilia due to PROTEIN C deficiency, autosomal dominant",
"description": ""
},
{
"id": "MIM:176860",
"resource": "MIM",
"url": "https://www.omim.org/entry/176860",
"name": "Thrombophilia due to protein C deficiency, autosomal dominant",
"description": "Thrombophilia due to protein C deficiency, autosomal dominant"
}
],
"evidence": [
{
"id": "176860",
"database": "MIM",
"url": "https://www.omim.org/entry/176860"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "rs202150408",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202150408"
},
{
"id": "rs202150408",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs202150408"
},
{
"id": "rs202150408",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202150408"
},
{
"id": "rs202150408",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs202150408"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 292,
"end_pos": 292,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SKS->NKS); n-glyco-sequon-loss (NYS->NYN).",
"chr_id": "2",
"chr_pos": "127428435",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "0.0002",
"site_lbl": "S292",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs200234655",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234655"
},
{
"id": "rs200234655",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200234655"
},
{
"id": "rs200234655",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs200234655#frequency_tab"
},
{
"id": "rs200234655",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs200234655"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 108,
"end_pos": 108,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HGT->NGT).",
"chr_id": "2",
"chr_pos": "127423093",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "H108",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs748411379",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748411379"
},
{
"id": "rs748411379",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748411379"
},
{
"id": "rs748411379",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs748411379"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 115,
"end_pos": 115,
"sequence_org": "I",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IGS->NGS).",
"chr_id": "2",
"chr_pos": "127423115",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "I115",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs780527584",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584"
},
{
"id": "rs780527584",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780527584"
},
{
"id": "rs780527584",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs780527584"
}
],
"glycoeffect": [
"n-glyco-sequon-loss"
],
"start_pos": 139,
"end_pos": 139,
"sequence_org": "N",
"sequence_mut": "D",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->DCS).",
"chr_id": "2",
"chr_pos": "127423288",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N139",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs950862727",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs950862727"
},
{
"id": "rs950862727",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs950862727#frequency_tab"
},
{
"id": "rs950862727",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs950862727"
}
],
"glycoeffect": [
"n-glyco-sequon-loss"
],
"start_pos": 139,
"end_pos": 139,
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).",
"chr_id": "2",
"chr_pos": "127423289",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N139",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs772880922",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772880922"
},
{
"id": "rs772880922",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772880922"
},
{
"id": "rs772880922",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs772880922#frequency_tab"
},
{
"id": "rs772880922",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs772880922"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 141,
"end_pos": 141,
"sequence_org": "S",
"sequence_mut": "*",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NC*).",
"chr_id": "2",
"chr_pos": "127423295",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S141",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1573444020",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1573444020"
},
{
"id": "rs1573444020",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1573444020"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 141,
"end_pos": 141,
"sequence_org": "S",
"sequence_mut": "P",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCP).",
"chr_id": "2",
"chr_pos": "127423294",
"ref_nt": "C",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S141",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs772880922",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772880922"
},
{
"id": "rs772880922",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772880922"
},
{
"id": "rs772880922",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs772880922#frequency_tab"
},
{
"id": "rs772880922",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs772880922"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 141,
"end_pos": 141,
"sequence_org": "S",
"sequence_mut": "W",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCW).",
"chr_id": "2",
"chr_pos": "127423295",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S141",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1178818583",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1178818583"
},
{
"id": "rs1178818583",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1178818583#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-loss"
],
"start_pos": 290,
"end_pos": 290,
"sequence_org": "N",
"sequence_mut": "D",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).",
"chr_id": "2",
"chr_pos": "127428428",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N290",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1558717703",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1558717703"
},
{
"id": "rs1558717703",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1558717703"
}
],
"glycoeffect": [
"n-glyco-sequon-loss"
],
"start_pos": 290,
"end_pos": 290,
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).",
"chr_id": "2",
"chr_pos": "127428429",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N290",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs200721675",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200721675"
},
{
"id": "rs200721675",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200721675"
},
{
"id": "rs200721675",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs200721675#frequency_tab"
},
{
"id": "rs200721675",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs200721675"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 294,
"end_pos": 294,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STT->NTT).",
"chr_id": "2",
"chr_pos": "127428441",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S294",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P04070",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04070"
}
],
"glycoeffect": [],
"start_pos": 301,
"end_pos": 301,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "2",
"chr_pos": "127428461",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "A301",
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
},
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs752782202",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752782202"
},
{
"id": "rs752782202",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752782202"
},
{
"id": "rs752782202",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs752782202"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 344,
"end_pos": 344,
"sequence_org": "Y",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YHS->NHS).",
"chr_id": "2",
"chr_pos": "127428590",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "Y344",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1266965698",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1266965698"
},
{
"id": "rs1266965698",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1266965698"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 433,
"end_pos": 433,
"sequence_org": "G",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYG->NYS).",
"chr_id": "2",
"chr_pos": "127428857",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "G433",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P04070",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04070"
}
],
"glycoeffect": [],
"start_pos": 448,
"end_pos": 448,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "H",
"sequence_mut": "Y",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "2",
"chr_pos": "127428902",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "H448",
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
},
{
"disease_id": "DOID:1793",
"recommended_name": {
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "pancreatic cancer",
"description": "An endocrine gland cancer located_in the pancreas."
},
"synonyms": [
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "Ca body of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "Ca head of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "Ca tail of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "malignant neoplasm of body of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "malignant neoplasm of head of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "malignant neoplasm of tail of pancreas",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "pancreas neoplasm",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "pancreatic neoplasm",
"description": ""
},
{
"id": "DOID:1793",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1793",
"name": "pancreatic tumor",
"description": ""
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "78.07",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "42.57",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "54.04",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "62.74",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "63.15",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "47.76",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "56.09",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "60.25",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "47.6",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "97.92",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "61.89",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "56.5",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04070"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "PROC",
"url": "https://www.uniprot.org/uniprot/P04070",
"locus": {
"chromosome": "2",
"start_pos": 127429242,
"end_pos": 127418427,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000115718",
"url": "https://www.ensembl.org/id/ENSG00000115718"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000115718",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000115718",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P04070",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P04070",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "3.4.21.69",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.21.69&UniProtAcc=P04070",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00054",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd00190",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL4444",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4444",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "PROC",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PROC",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "5624",
"url": "https://www.ncbi.nlm.nih.gov/gene/5624",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620",
"database": "GlyConnect",
"categories": [
"Glycoproteomics",
"Glycan"
]
},
{
"id": "9451",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9451",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P04070",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P04070*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000152",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000152",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR000294",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000294",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR000742",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000742",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001254",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001254",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001314",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001314",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001881",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001881",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR009003",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR009003",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR012224",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR012224",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR017857",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR017857",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018097",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018097",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018114",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018114",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR033116",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR033116",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR035972",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR035972",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR043504",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR043504",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:5624",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5624",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "176860",
"url": "http://www.omim.org/entry/176860",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "612283",
"url": "http://www.omim.org/entry/612283",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "612304",
"url": "http://www.omim.org/entry/612304",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P04070",
"url": "https://www.nextprot.org/entry/NX_P04070",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P04070",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04070",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "VAPHNEC",
"url": "https://omabrowser.org/oma/group/VAPHNEC/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "4629979at2759",
"url": "http://www.orthodb.org/?query=4629979at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24278",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24278",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR24278:SF0",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24278:SF0",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1AUT",
"url": "https://www.rcsb.org/structure/1AUT",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1LQV",
"url": "https://www.rcsb.org/structure/1LQV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3F6U",
"url": "https://www.rcsb.org/structure/3F6U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3JTC",
"url": "https://www.rcsb.org/structure/3JTC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4DT7",
"url": "https://www.rcsb.org/structure/4DT7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6M3B",
"url": "https://www.rcsb.org/structure/6M3B",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6M3C",
"url": "https://www.rcsb.org/structure/6M3C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8JRU",
"url": "https://www.rcsb.org/structure/8JRU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "8JRV",
"url": "https://www.rcsb.org/structure/8JRV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00008",
"url": "http://pfam.xfam.org/family/PF00008",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00089",
"url": "http://pfam.xfam.org/family/PF00089",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00594",
"url": "http://pfam.xfam.org/family/PF00594",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF14670",
"url": "http://pfam.xfam.org/family/PF14670",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P04070",
"url": "https://pharos.nih.gov/targets/P04070",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR:000053224",
"url": "https://proconsortium.org/app/entry/PR:000053224",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053225",
"url": "https://proconsortium.org/app/entry/PR:000053225",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053226",
"url": "https://proconsortium.org/app/entry/PR:000053226",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053227",
"url": "https://proconsortium.org/app/entry/PR:000053227",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053228",
"url": "https://proconsortium.org/app/entry/PR:000053228",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053229",
"url": "https://proconsortium.org/app/entry/PR:000053229",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053230",
"url": "https://proconsortium.org/app/entry/PR:000053230",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053231",
"url": "https://proconsortium.org/app/entry/PR:000053231",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053232",
"url": "https://proconsortium.org/app/entry/PR:000053232",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053233",
"url": "https://proconsortium.org/app/entry/PR:000053233",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053234",
"url": "https://proconsortium.org/app/entry/PR:000053234",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053235",
"url": "https://proconsortium.org/app/entry/PR:000053235",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053236",
"url": "https://proconsortium.org/app/entry/PR:000053236",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053237",
"url": "https://proconsortium.org/app/entry/PR:000053237",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053238",
"url": "https://proconsortium.org/app/entry/PR:000053238",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053239",
"url": "https://proconsortium.org/app/entry/PR:000053239",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053240",
"url": "https://proconsortium.org/app/entry/PR:000053240",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053241",
"url": "https://proconsortium.org/app/entry/PR:000053241",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053242",
"url": "https://proconsortium.org/app/entry/PR:000053242",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053243",
"url": "https://proconsortium.org/app/entry/PR:000053243",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053244",
"url": "https://proconsortium.org/app/entry/PR:000053244",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053245",
"url": "https://proconsortium.org/app/entry/PR:000053245",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053246",
"url": "https://proconsortium.org/app/entry/PR:000053246",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053247",
"url": "https://proconsortium.org/app/entry/PR:000053247",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053248",
"url": "https://proconsortium.org/app/entry/PR:000053248",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053249",
"url": "https://proconsortium.org/app/entry/PR:000053249",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053250",
"url": "https://proconsortium.org/app/entry/PR:000053250",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053251",
"url": "https://proconsortium.org/app/entry/PR:000053251",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053252",
"url": "https://proconsortium.org/app/entry/PR:000053252",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053253",
"url": "https://proconsortium.org/app/entry/PR:000053253",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053254",
"url": "https://proconsortium.org/app/entry/PR:000053254",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053255",
"url": "https://proconsortium.org/app/entry/PR:000053255",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053256",
"url": "https://proconsortium.org/app/entry/PR:000053256",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053257",
"url": "https://proconsortium.org/app/entry/PR:000053257",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053258",
"url": "https://proconsortium.org/app/entry/PR:000053258",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053259",
"url": "https://proconsortium.org/app/entry/PR:000053259",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053260",
"url": "https://proconsortium.org/app/entry/PR:000053260",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053261",
"url": "https://proconsortium.org/app/entry/PR:000053261",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053262",
"url": "https://proconsortium.org/app/entry/PR:000053262",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053263",
"url": "https://proconsortium.org/app/entry/PR:000053263",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053264",
"url": "https://proconsortium.org/app/entry/PR:000053264",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053265",
"url": "https://proconsortium.org/app/entry/PR:000053265",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053266",
"url": "https://proconsortium.org/app/entry/PR:000053266",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR_P04070",
"url": "http://purl.obolibrary.org/obo/PR_P04070",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-159763",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159763",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-159782",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159782",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-8957275",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "P04070",
"url": "DISABLED",
"database": "UniCarbKB",
"categories": [
"Glycoproteomics"
]
},
{
"id": "E7END6",
"url": "https://www.uniprot.org/uniprot/E7END6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7END6-1",
"url": "https://www.uniprot.org/uniprot/E7END6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7ENR9",
"url": "https://www.uniprot.org/uniprot/E7ENR9",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7ENR9-1",
"url": "https://www.uniprot.org/uniprot/E7ENR9-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EU72",
"url": "https://www.uniprot.org/uniprot/E7EU72",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EU72-1",
"url": "https://www.uniprot.org/uniprot/E7EU72-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EVH6",
"url": "https://www.uniprot.org/uniprot/E7EVH6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "E7EVH6-1",
"url": "https://www.uniprot.org/uniprot/E7EVH6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F2Z2A0",
"url": "https://www.uniprot.org/uniprot/F2Z2A0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F2Z2A0-1",
"url": "https://www.uniprot.org/uniprot/F2Z2A0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H7BYX9",
"url": "https://www.uniprot.org/uniprot/H7BYX9",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H7BYX9-1",
"url": "https://www.uniprot.org/uniprot/H7BYX9-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P04070-1",
"url": "https://www.uniprot.org/uniprot/P04070-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P04070-2",
"url": "https://www.uniprot.org/uniprot/P04070-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP",
"length": 461,
"header": "sp|P04070-1|PROC_HUMAN Isoform 1 of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"isoforms": [
{
"isoform_ac": "E7END6-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQRGEGERWMLAGGGAGLGPGWGRGTSTSCPRPPLPAEVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP",
"length": 495,
"header": "tr|E7END6-1|PROC_HUMAN Computationally mapped isoform of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127428943,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000409048.1",
"url": "https://www.ensembl.org/id/ENST00000409048.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000386679.1",
"url": "https://www.ensembl.org/id/ENSP00000386679.1"
}
]
}
},
{
"isoform_ac": "E7ENR9-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKR",
"length": 175,
"header": "tr|E7ENR9-1|E7ENR9_HUMAN Computationally mapped isoform of Protein C, inactivator of coagulation factors Va and VIIIa OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127426131,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000442644.5",
"url": "https://www.ensembl.org/id/ENST00000442644.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000411241.1",
"url": "https://www.ensembl.org/id/ENSP00000411241.1"
}
]
}
},
{
"isoform_ac": "E7EU72-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG",
"length": 116,
"header": "tr|E7EU72-1|E7EU72_HUMAN Computationally mapped isoform of Protein C, inactivator of coagulation factors Va and VIIIa OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127423119,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000427769.5",
"url": "https://www.ensembl.org/id/ENST00000427769.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000406295.1",
"url": "https://www.ensembl.org/id/ENSP00000406295.1"
}
]
}
},
{
"isoform_ac": "E7EVH6-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGW",
"length": 126,
"header": "tr|E7EVH6-1|PROC_HUMAN Computationally mapped isoform of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127423149,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000429925.5",
"url": "https://www.ensembl.org/id/ENST00000429925.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000412697.1",
"url": "https://www.ensembl.org/id/ENSP00000412697.1"
}
]
}
},
{
"isoform_ac": "F2Z2A0-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLGAADPQTCQLLPGGAPSQQPGAGVHRGDL",
"length": 52,
"header": "tr|F2Z2A0-1|F2Z2A0_HUMAN Computationally mapped isoform of Protein C, inactivator of coagulation factors Va and VIIIa OS=Homo sapiens OX=9606 GN=PROC PE=4 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127421403,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000419985.5",
"url": "https://www.ensembl.org/id/ENST00000419985.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000392606.1",
"url": "https://www.ensembl.org/id/ENSP00000392606.1"
}
]
}
},
{
"isoform_ac": "H7BYX9-1",
"url": "",
"sequence": {
"sequence": "XCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP",
"length": 236,
"header": "tr|H7BYX9-1|PROC_HUMAN Computationally mapped isoform of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127428944,
"end_pos": 127423289,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000402125.2",
"url": "https://www.ensembl.org/id/ENST00000402125.2"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000384225.2",
"url": "https://www.ensembl.org/id/ENSP00000384225.2"
}
]
}
},
{
"isoform_ac": "P04070-1",
"url": "",
"sequence": {
"sequence": "MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP",
"length": 461,
"header": "sp|P04070-1|PROC_HUMAN Isoform 1 of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {
"chromosome": "2",
"start_pos": 127428943,
"end_pos": 127419943,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000234071.8",
"url": "https://www.ensembl.org/id/ENST00000234071.8"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000234071.4",
"url": "https://www.ensembl.org/id/ENSP00000234071.4"
}
]
}
},
{
"isoform_ac": "P04070-2",
"url": "",
"sequence": {
"sequence": "MAAGRRTCSISTTRPCASASRMWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQRGEGERWMLAGGGAGLGPGWGRGTSTSCPRPPLPAEVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP",
"length": 516,
"header": "sp|P04070-2|PROC_HUMAN Isoform 2 of Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1 CANONICAL=P04070-1"
},
"locus": {}
}
],
"glycosylation": [
{
"glytoucan_ac": "G08146BT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G17409FQ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G32246SI",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G34306IB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G37868ZX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42358LZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42440OJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G45495MK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G48414YA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"glytoucan_ac": "G51941GC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G61726TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G79939YZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 139,
"start_aa": "Asn",
"end_pos": 139,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn139",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
},
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"id": "25326145",
"database": "Automatic Literature Mining",
"url": "https://research.bioinformatics.udel.edu/glyco/pmid/25326145"
},
{
"id": "25326145",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/25326145"
}
]
},
{
"glytoucan_ac": "G29931IJ",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 19,
"start_aa": "Thr",
"end_pos": 19,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr19",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "22171320",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/22171320"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "",
"start_pos": 19,
"start_aa": "Thr",
"end_pos": 19,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr19",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "22171320",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/22171320"
}
]
},
{
"glytoucan_ac": "",
"type": "O-linked",
"subtype": "O-GalNAcylation",
"site_category": "reported",
"site_seq": "T",
"relation": "attached",
"comment": "O-linked (GalNAc...) threonine O-GalNAcylation",
"start_pos": 19,
"start_aa": "Thr",
"end_pos": 19,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr19",
"evidence": [
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"id": "22171320",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/22171320"
}
]
},
{
"glytoucan_ac": "G00912UN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"glytoucan_ac": "G08146BT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G34306IB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G37868ZX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42358LZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42440OJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G45495MK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G48414YA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
},
{
"id": "29391424",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29391424"
},
{
"id": "29671580",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29671580"
},
{
"id": "34725484",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34725484"
}
]
},
{
"glytoucan_ac": "G51941GC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G61726TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 290,
"start_aa": "Asn",
"end_pos": 290,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn290",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
},
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"id": "16335952",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/16335952"
},
{
"id": "2991887",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2991887"
}
]
},
{
"glytoucan_ac": "G08146BT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G34306IB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G37868ZX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42358LZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42440OJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G45495MK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G51941GC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G61726TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 355,
"start_aa": "Asn",
"end_pos": 355,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn355",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
},
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"id": "2991887",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2991887"
}
]
},
{
"glytoucan_ac": "G08146BT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G13661YX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G16758MX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G17409FQ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G30939HN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G34306IB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G37868ZX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42358LZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G42440OJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G45495MK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G51941GC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G61726TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"glytoucan_ac": "G93860XO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: AsnAsn371 ; AsnAsn371",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 371,
"start_aa": "Asn",
"end_pos": 371,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn371",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "19343721",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/19343721"
},
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"id": "2991887",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/2991887"
},
{
"id": "1694179",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/1694179"
}
]
},
{
"glytoucan_ac": "G43417UB",
"type": "O-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "",
"start_pos": 382,
"start_aa": "Ser",
"end_pos": 382,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser382",
"evidence": [
{
"id": "P04070",
"database": "UniCarbKB",
"url": ""
},
{
"id": "30459171",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"glytoucan_ac": "G00743WU",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G02628JF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G08110WX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G22310AV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G23626NI",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G25297CU",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G37570AP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G43346PX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P04070",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04070"
},
{
"id": "33214551",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/33214551"
}
]
},
{
"glytoucan_ac": "G54499BT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G54740VA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G54956ME",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G56284ZY",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G59655SA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G61467QZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G69834CE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G73418FX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G76136FD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G76630AE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G80735WD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G81198YO",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G82592ZH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G86102AA",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G94531EZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G95658PH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G95977AE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"glytoucan_ac": "G96921ZU",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "620",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
},
{
"id": "8130392",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
}
],
"phosphorylation": [
{
"start_pos": 347,
"end_pos": 347,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by FAM20C",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
},
{
"database": "iPTMnet",
"id": "P04070",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04070"
},
{
"database": "PubMed",
"id": "26091039",
"url": "https://glygen.org/publication/PubMed/26091039"
}
],
"site_lbl": "Ser347"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10026136",
"url": "https://glygen.org/publication/PubMed/10026136"
}
]
},
{
"title": "Relocating the active site of activated protein C eliminates the need for its protein S cofactor. A fluorescence resonance energy transfer study.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Yegneswaran S, Smirnov MD, Safa O, Esmon NL, Esmon CT, Johnson AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "10026158",
"url": "https://glygen.org/publication/PubMed/10026158"
}
]
},
{
"title": "Vitamin K-dependent biosynthesis of gamma-carboxyglutamic acid.",
"journal": "Blood",
"date": "1999",
"authors": "Furie B, Bouchard BA, Furie BC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "10068650",
"url": "https://glygen.org/publication/PubMed/10068650"
}
]
},
{
"title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10077652",
"url": "https://glygen.org/publication/PubMed/10077652"
}
]
},
{
"title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Okabe E, Kajihara J, Usami Y, Hirano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10218588",
"url": "https://glygen.org/publication/PubMed/10218588"
}
]
},
{
"title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1999",
"authors": "Gibson TL, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10512690",
"url": "https://glygen.org/publication/PubMed/10512690"
}
]
},
{
"title": "The biology of the 17-1A antigen (Ep-CAM).",
"journal": "Journal of molecular medicine (Berlin, Germany)",
"date": "1999",
"authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "10606205",
"url": "https://glygen.org/publication/PubMed/10606205"
}
]
},
{
"title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.",
"journal": "Endocrinology",
"date": "2000",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10614670",
"url": "https://glygen.org/publication/PubMed/10614670"
}
]
},
{
"title": "Mechanisms for the involvement of high molecular weight kininogen in surface-dependent reactions of Hageman factor.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1976",
"authors": "Griffin JH, Cochrane CG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1066663",
"url": "https://glygen.org/publication/PubMed/1066663"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.",
"journal": "Hormone research",
"date": "1999",
"authors": "Belgorosky A, Rivarola MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10681634",
"url": "https://glygen.org/publication/PubMed/10681634"
}
]
},
{
"title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.",
"journal": "Seminars in immunology",
"date": "2000",
"authors": "Tangye SG, Phillips JH, Lanier LL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "10764623",
"url": "https://glygen.org/publication/PubMed/10764623"
}
]
},
{
"title": "Thrombin-mediated feedback activation of factor XI on the activated platelet surface is preferred over contact activation by factor XIIa or factor XIa.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Baglia FA, Walsh PN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "10781579",
"url": "https://glygen.org/publication/PubMed/10781579"
}
]
},
{
"title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.",
"journal": "The Journal of endocrinology",
"date": "2000",
"authors": "Bond JJ, Meka S, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10810289",
"url": "https://glygen.org/publication/PubMed/10810289"
}
]
},
{
"title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10898936",
"url": "https://glygen.org/publication/PubMed/10898936"
}
]
},
{
"title": "Effects of IGFBP-2 overexpression in vitro and in vivo.",
"journal": "Pediatric nephrology (Berlin, Germany)",
"date": "2000",
"authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10912521",
"url": "https://glygen.org/publication/PubMed/10912521"
}
]
},
{
"title": "The vitamin K-dependent carboxylase.",
"journal": "The Journal of nutrition",
"date": "2000",
"authors": "Berkner KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "10917896",
"url": "https://glygen.org/publication/PubMed/10917896"
}
]
},
{
"title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.",
"journal": "European journal of biochemistry",
"date": "2000",
"authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10951195",
"url": "https://glygen.org/publication/PubMed/10951195"
}
]
},
{
"title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1998",
"authors": "Angelloz-Nicoud P, Lalou C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10990447",
"url": "https://glygen.org/publication/PubMed/10990447"
}
]
},
{
"title": "The soluble endothelial protein C receptor binds to activated neutrophils: involvement of proteinase-3 and CD11b/CD18.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2000",
"authors": "Kurosawa S, Esmon CT, Stearns-Kurosawa DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "11035113",
"url": "https://glygen.org/publication/PubMed/11035113"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2001",
"authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11158056",
"url": "https://glygen.org/publication/PubMed/11158056"
}
]
},
{
"title": "Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.",
"journal": "Thrombosis and haemostasis",
"date": "2001",
"authors": "Joseph K, Shibayama Y, Ghebrehiwet B, Kaplan AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11204562",
"url": "https://glygen.org/publication/PubMed/11204562"
}
]
},
{
"title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.",
"journal": "Cellular microbiology",
"date": "1999",
"authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "11207550",
"url": "https://glygen.org/publication/PubMed/11207550"
}
]
},
{
"title": "Endothelial cell protein C receptor plays an important role in protein C activation in vivo.",
"journal": "Blood",
"date": "2001",
"authors": "Taylor FB Jr, Peer GT, Lockhart MS, Ferrell G, Esmon CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "11238108",
"url": "https://glygen.org/publication/PubMed/11238108"
}
]
},
{
"title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.",
"journal": "The Journal of endocrinology",
"date": "2001",
"authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11250653",
"url": "https://glygen.org/publication/PubMed/11250653"
}
]
},
{
"title": "Three ways to make a vesicle.",
"journal": "Nature reviews. Molecular cell biology",
"date": "2000",
"authors": "Kirchhausen T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159763",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159763"
}
],
"reference": [
{
"type": "PubMed",
"id": "11252894",
"url": "https://glygen.org/publication/PubMed/11252894"
}
]
},
{
"title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.",
"journal": "Journal of cell science",
"date": "2001",
"authors": "Shi X, Niimi S, Ohtani T, Machida S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "11256994",
"url": "https://glygen.org/publication/PubMed/11256994"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11264294",
"url": "https://glygen.org/publication/PubMed/11264294"
}
]
},
{
"title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.",
"journal": "Endocrinology",
"date": "2001",
"authors": "Firth SM, Clemmons DR, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11316783",
"url": "https://glygen.org/publication/PubMed/11316783"
}
]
},
{
"title": "Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential.",
"journal": "Blood",
"date": "2001",
"authors": "Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11342438",
"url": "https://glygen.org/publication/PubMed/11342438"
}
]
},
{
"title": "Tethered processivity of the vitamin K-dependent carboxylase: factor IX is efficiently modified in a mechanism which distinguishes Gla's from Glu's and which accounts for comprehensive carboxylation in vivo.",
"journal": "Biochemistry",
"date": "2001",
"authors": "Stenina O, Pudota BN, McNally BA, Hommema EL, Berkner KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "11513608",
"url": "https://glygen.org/publication/PubMed/11513608"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.",
"journal": "FEBS letters",
"date": "2001",
"authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11522292",
"url": "https://glygen.org/publication/PubMed/11522292"
}
]
},
{
"title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2001",
"authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "11564780",
"url": "https://glygen.org/publication/PubMed/11564780"
}
]
},
{
"title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11606061",
"url": "https://glygen.org/publication/PubMed/11606061"
}
]
},
{
"title": "Factor XI binding to the platelet glycoprotein Ib-IX-V complex promotes factor XI activation by thrombin.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Baglia FA, Badellino KO, Li CQ, Lopez JA, Walsh PN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11696542",
"url": "https://glygen.org/publication/PubMed/11696542"
}
]
},
{
"title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.",
"journal": "American journal of physiology. Endocrinology and metabolism",
"date": "2002",
"authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11739083",
"url": "https://glygen.org/publication/PubMed/11739083"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?",
"journal": "Cancer research",
"date": "2001",
"authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11751371",
"url": "https://glygen.org/publication/PubMed/11751371"
}
]
},
{
"title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.",
"journal": "Biochemical and biophysical research communications",
"date": "2002",
"authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "11779189",
"url": "https://glygen.org/publication/PubMed/11779189"
}
]
},
{
"title": "Molecular distribution of IGF binding protein-5 in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2002",
"authors": "Baxter RC, Meka S, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11788658",
"url": "https://glygen.org/publication/PubMed/11788658"
}
]
},
{
"title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.",
"journal": "Nature immunology",
"date": "2002",
"authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "11812992",
"url": "https://glygen.org/publication/PubMed/11812992"
}
]
},
{
"title": "Identification and characterization of prolylcarboxypeptidase as an endothelial cell prekallikrein activator.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Shariat-Madar Z, Mahdi F, Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11830581",
"url": "https://glygen.org/publication/PubMed/11830581"
}
]
},
{
"title": "Bivalirudin: a direct thrombin inhibitor.",
"journal": "Clinical therapeutics",
"date": "2002",
"authors": "Gladwell TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11833835",
"url": "https://glygen.org/publication/PubMed/11833835"
}
]
},
{
"title": "Factor XII interacts with the multiprotein assembly of urokinase plasminogen activator receptor, gC1qR, and cytokeratin 1 on endothelial cell membranes.",
"journal": "Blood",
"date": "2002",
"authors": "Mahdi F, Madar ZS, Figueroa CD, Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "11986212",
"url": "https://glygen.org/publication/PubMed/11986212"
}
]
},
{
"title": "Activation of endothelial cell protease activated receptor 1 by the protein C pathway.",
"journal": "Science (New York, N.Y.)",
"date": "2002",
"authors": "Riewald M, Petrovan RJ, Donner A, Mueller BM, Ruf W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "12052963",
"url": "https://glygen.org/publication/PubMed/12052963"
}
]
},
{
"title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "12070135",
"url": "https://glygen.org/publication/PubMed/12070135"
}
]
},
{
"title": "Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.",
"journal": "FEBS letters",
"date": "2002",
"authors": "Moreira CR, Schmaier AH, Mahdi F, da Motta G, Nader HB, Shariat-Madar Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "12123826",
"url": "https://glygen.org/publication/PubMed/12123826"
}
]
},
{
"title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.",
"journal": "The Journal of experimental medicine",
"date": "2002",
"authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "12208882",
"url": "https://glygen.org/publication/PubMed/12208882"
}
]
},
{
"title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12241545",
"url": "https://glygen.org/publication/PubMed/12241545"
}
]
},
{
"title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.",
"journal": "The Journal of endocrinology",
"date": "2002",
"authors": "Mohan S, Baylink DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12379487",
"url": "https://glygen.org/publication/PubMed/12379487"
}
]
},
{
"title": "Localization of the adhesion receptor glycoprotein Ib-IX-V complex to lipid rafts is required for platelet adhesion and activation.",
"journal": "The Journal of experimental medicine",
"date": "2002",
"authors": "Shrimpton CN, Borthakur G, Larrucea S, Cruz MA, Dong JF, Lopez JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "12391017",
"url": "https://glygen.org/publication/PubMed/12391017"
}
]
},
{
"title": "Cellular actions of the insulin-like growth factor binding proteins.",
"journal": "Endocrine reviews",
"date": "2002",
"authors": "Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12466191",
"url": "https://glygen.org/publication/PubMed/12466191"
}
]
},
{
"title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.",
"journal": "Nature medicine",
"date": "2003",
"authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "12469115",
"url": "https://glygen.org/publication/PubMed/12469115"
}
]
},
{
"title": "MIF signal transduction initiated by binding to CD74.",
"journal": "The Journal of experimental medicine",
"date": "2003",
"authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "12782713",
"url": "https://glygen.org/publication/PubMed/12782713"
}
]
},
{
"title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.",
"journal": "Endocrinology",
"date": "2003",
"authors": "Payet LD, Wang XH, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12810533",
"url": "https://glygen.org/publication/PubMed/12810533"
}
]
},
{
"title": "IGF-binding protein-4: biochemical characteristics and functional consequences.",
"journal": "The Journal of endocrinology",
"date": "2003",
"authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12904166",
"url": "https://glygen.org/publication/PubMed/12904166"
}
]
},
{
"title": "Heparin-induced substrate behavior of antithrombin Cambridge II.",
"journal": "Blood",
"date": "2003",
"authors": "Mushunje A, Zhou A, Carrell RW, Huntington JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "12907439",
"url": "https://glygen.org/publication/PubMed/12907439"
}
]
},
{
"title": "The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Mahdi F, Shariat-Madar Z, Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "12944405",
"url": "https://glygen.org/publication/PubMed/12944405"
}
]
},
{
"title": "Two novel mutations responsible for hereditary type I protein C deficiency: characterization by denaturing gradient gel electrophoresis.",
"journal": "Human mutation",
"date": "1992",
"authors": "Gandrille S, Vidaud M, Aiach M, Alhenc-Gelas M, Fischer AM, Gouault-Heilman M, Toulon P, Fiessinger JN, Goossens M",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1301959",
"url": "https://glygen.org/publication/PubMed/1301959"
}
]
},
{
"title": "Protein CVermont: symptomatic type II protein C deficiency associated with two GLA domain mutations.",
"journal": "Blood",
"date": "1992",
"authors": "Bovill EG, Tomczak JA, Grant B, Bhushan F, Pillemer E, Rainville IR, Long GL",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1347706",
"url": "https://glygen.org/publication/PubMed/1347706"
}
]
},
{
"title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Baxter RC, Bayne ML, Cascieri MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1370451",
"url": "https://glygen.org/publication/PubMed/1370451"
}
]
},
{
"title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1992",
"authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1383255",
"url": "https://glygen.org/publication/PubMed/1383255"
}
]
},
{
"title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.",
"journal": "Current protein & peptide science",
"date": "2003",
"authors": "Wilkins AL, Yang W, Yang JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "14529530",
"url": "https://glygen.org/publication/PubMed/14529530"
}
]
},
{
"title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2004",
"authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "14615387",
"url": "https://glygen.org/publication/PubMed/14615387"
}
]
},
{
"title": "The physiologic basis of assembly and activation of the plasma kallikrein/kinin system.",
"journal": "Thrombosis and haemostasis",
"date": "2004",
"authors": "Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "14691562",
"url": "https://glygen.org/publication/PubMed/14691562"
}
]
},
{
"title": "The factor V activation paradox.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Orfeo T, Brufatto N, Nesheim ME, Xu H, Butenas S, Mann KG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "14982929",
"url": "https://glygen.org/publication/PubMed/14982929"
}
]
},
{
"title": "Recombinant prolylcarboxypeptidase activates plasma prekallikrein.",
"journal": "Blood",
"date": "2004",
"authors": "Shariat-Madar Z, Mahdi F, Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "14996700",
"url": "https://glygen.org/publication/PubMed/14996700"
}
]
},
{
"title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.",
"journal": "DNA and cell biology",
"date": "2004",
"authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "15000751",
"url": "https://glygen.org/publication/PubMed/15000751"
}
]
},
{
"title": "A novel homozygous missense mutation in the protein C (PROC) gene causing recurrent venous thrombosis.",
"journal": "Human genetics",
"date": "1992",
"authors": "Grundy CB, Chisholm M, Kakkar VV, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1511988",
"url": "https://glygen.org/publication/PubMed/1511988"
}
]
},
{
"title": "Two different missense mutations at Arg 178 of the protein C (PROC) gene causing recurrent venous thrombosis.",
"journal": "Human genetics",
"date": "1992",
"authors": "Grundy CB, Schulman S, Tengborn L, Kakkar VV, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1511989",
"url": "https://glygen.org/publication/PubMed/1511989"
}
]
},
{
"title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2004",
"authors": "Payet LD, Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15126567",
"url": "https://glygen.org/publication/PubMed/15126567"
}
]
},
{
"title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2004",
"authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15308688",
"url": "https://glygen.org/publication/PubMed/15308688"
}
]
},
{
"title": "O-linked fucose is present in the first epidermal growth factor domain of factor XII but not protein C.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Harris RJ, Ling VT, Spellman MW",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1544894",
"url": "https://glygen.org/publication/PubMed/1544894"
}
]
},
{
"title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.",
"journal": "Journal of biochemistry and molecular biology",
"date": "2004",
"authors": "Choi KY, Kyung YJ, Lee CY, Lee DH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15469690",
"url": "https://glygen.org/publication/PubMed/15469690"
}
]
},
{
"title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485880",
"url": "https://glygen.org/publication/PubMed/15485880"
}
]
},
{
"title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.",
"journal": "Journal of molecular endocrinology",
"date": "2004",
"authors": "Headey SJ, Leeding KS, Norton RS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15525596",
"url": "https://glygen.org/publication/PubMed/15525596"
}
]
},
{
"title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2004",
"authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "15528364",
"url": "https://glygen.org/publication/PubMed/15528364"
}
]
},
{
"title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.",
"journal": "Structure (London, England : 1993)",
"date": "2005",
"authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15642270",
"url": "https://glygen.org/publication/PubMed/15642270"
}
]
},
{
"title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2005",
"authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "15681301",
"url": "https://glygen.org/publication/PubMed/15681301"
}
]
},
{
"title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Farias E, Lu M, Li X, Schnapp LM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "15721307",
"url": "https://glygen.org/publication/PubMed/15721307"
}
]
},
{
"title": "Human erythrocyte glycophorins: protein and gene structure analyses.",
"journal": "Transfusion medicine reviews",
"date": "1992",
"authors": "Cartron JP, Rahuel C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "1591491",
"url": "https://glygen.org/publication/PubMed/1591491"
}
]
},
{
"title": "Homozygous protein C deficiency: identification of a novel missense mutation that causes impaired secretion of the mutant protein C.",
"journal": "The Journal of laboratory and clinical medicine",
"date": "1992",
"authors": "Yamamoto K, Matsushita T, Sugiura I, Takamatsu J, Iwasaki E, Wada H, Deguchi K, Shirakawa S, Saito H",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1593215",
"url": "https://glygen.org/publication/PubMed/1593215"
}
]
},
{
"title": "Protein C deficiency Hong Kong 1 and 2: hereditary protein C deficiency caused by two mutant alleles, a 5-nucleotide deletion and a missense mutation.",
"journal": "Blood",
"date": "1992",
"authors": "Sugahara Y, Miura O, Yuen P, Aoki N",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1611081",
"url": "https://glygen.org/publication/PubMed/1611081"
}
]
},
{
"title": "Discovery of the novel antithrombotic agent 5-chloro-N-({(5S)-2-oxo-3- [4-(3-oxomorpholin-4-yl)phenyl]-1,3-oxazolidin-5-yl}methyl)thiophene- 2-carboxamide (BAY 59-7939): an oral, direct factor Xa inhibitor.",
"journal": "Journal of medicinal chemistry",
"date": "2005",
"authors": "Roehrig S, Straub A, Pohlmann J, Lampe T, Pernerstorfer J, Schlemmer KH, Reinemer P, Perzborn E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "16161994",
"url": "https://glygen.org/publication/PubMed/16161994"
}
]
},
{
"title": "Characterization of the interaction between the A2 subunit and A1/A3-C1-C2 dimer in human factor VIIIa.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Fay PJ, Smudzin TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1618828",
"url": "https://glygen.org/publication/PubMed/1618828"
}
]
},
{
"title": "beta 1 integrin function in vivo: adhesion, migration and more.",
"journal": "Cancer metastasis reviews",
"date": "2005",
"authors": "Brakebusch C, Fassler R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16258728",
"url": "https://glygen.org/publication/PubMed/16258728"
}
]
},
{
"title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.",
"journal": "The Journal of investigative dermatology",
"date": "2005",
"authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16297198",
"url": "https://glygen.org/publication/PubMed/16297198"
}
]
},
{
"title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.",
"journal": "Journal of proteome research",
"date": "2005",
"authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "16335952",
"url": "https://glygen.org/publication/PubMed/16335952"
}
]
},
{
"title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2006",
"authors": "Messmer B, Eissmann P, Stark S, Watzl C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16585556",
"url": "https://glygen.org/publication/PubMed/16585556"
}
]
},
{
"title": "The SIRP family of receptors and immune regulation.",
"journal": "Nature reviews. Immunology",
"date": "2006",
"authors": "Barclay AN, Brown MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16691243",
"url": "https://glygen.org/publication/PubMed/16691243"
}
]
},
{
"title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.",
"journal": "Cytokine & growth factor reviews",
"date": "2006",
"authors": "Hafizi S, Dahlback B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16737840",
"url": "https://glygen.org/publication/PubMed/16737840"
}
]
},
{
"title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.",
"journal": "Journal of cellular physiology",
"date": "2006",
"authors": "Huang H, Cruz F, Bazzoni G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "16783819",
"url": "https://glygen.org/publication/PubMed/16783819"
}
]
},
{
"title": "Beta protein C is not glycosylated at asparagine 329. The rate of translation may influence the frequency of usage at asparagine-X-cysteine sites.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Miletich JP, Broze GJ Jr",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1694179",
"url": "https://glygen.org/publication/PubMed/1694179"
}
]
},
{
"title": "The role of insulin-like growth factor binding proteins.",
"journal": "Neuroendocrinology",
"date": "2006",
"authors": "Holly J, Perks C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17047378",
"url": "https://glygen.org/publication/PubMed/17047378"
}
]
},
{
"title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.",
"journal": "The FEBS journal",
"date": "2006",
"authors": "Hafizi S, Dahlback B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17064312",
"url": "https://glygen.org/publication/PubMed/17064312"
}
]
},
{
"title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17099249",
"url": "https://glygen.org/publication/PubMed/17099249"
}
]
},
{
"title": "PECAM-1, a key player in neuroinflammation.",
"journal": "European journal of neurology",
"date": "2006",
"authors": "Kalinowska A, Losy J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17116209",
"url": "https://glygen.org/publication/PubMed/17116209"
}
]
},
{
"title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.",
"journal": "Journal of cellular physiology",
"date": "2007",
"authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17167768",
"url": "https://glygen.org/publication/PubMed/17167768"
}
]
},
{
"title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17172599",
"url": "https://glygen.org/publication/PubMed/17172599"
}
]
},
{
"title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Gyrup C, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17249697",
"url": "https://glygen.org/publication/PubMed/17249697"
}
]
},
{
"title": "Glycoproteins V and Ib-IX form a noncovalent complex in the platelet membrane.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Modderman PW, Admiraal LG, Sonnenberg A, von dem Borne AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1730602",
"url": "https://glygen.org/publication/PubMed/1730602"
}
]
},
{
"title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2007",
"authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17312271",
"url": "https://glygen.org/publication/PubMed/17312271"
}
]
},
{
"title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2007",
"authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17322099",
"url": "https://glygen.org/publication/PubMed/17322099"
}
]
},
{
"title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2007",
"authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17379836",
"url": "https://glygen.org/publication/PubMed/17379836"
}
]
},
{
"title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2007",
"authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17442946",
"url": "https://glygen.org/publication/PubMed/17442946"
}
]
},
{
"title": "TREM-1 ligand expression on platelets enhances neutrophil activation.",
"journal": "Blood",
"date": "2007",
"authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17452516",
"url": "https://glygen.org/publication/PubMed/17452516"
}
]
},
{
"title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.",
"journal": "Blood",
"date": "2007",
"authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17505016",
"url": "https://glygen.org/publication/PubMed/17505016"
}
]
},
{
"title": "The pharmacokinetics, pharmacodynamics and tolerability of dabigatran etexilate, a new oral direct thrombin inhibitor, in healthy male subjects.",
"journal": "British journal of clinical pharmacology",
"date": "2007",
"authors": "Stangier J, Rathgen K, Stahle H, Gansser D, Roth W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "17506785",
"url": "https://glygen.org/publication/PubMed/17506785"
}
]
},
{
"title": "The role of junctional adhesion molecules in vascular inflammation.",
"journal": "Nature reviews. Immunology",
"date": "2007",
"authors": "Weber C, Fraemohs L, Dejana E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17525755",
"url": "https://glygen.org/publication/PubMed/17525755"
}
]
},
{
"title": "Structure of CD84 provides insight into SLAM family function.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2007",
"authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17563375",
"url": "https://glygen.org/publication/PubMed/17563375"
}
]
},
{
"title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17580308",
"url": "https://glygen.org/publication/PubMed/17580308"
}
]
},
{
"title": "In-vitro profile and ex-vivo anticoagulant activity of the direct thrombin inhibitor dabigatran and its orally active prodrug, dabigatran etexilate.",
"journal": "Thrombosis and haemostasis",
"date": "2007",
"authors": "Wienen W, Stassen JM, Priepke H, Ries UJ, Hauel N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "17598008",
"url": "https://glygen.org/publication/PubMed/17598008"
}
]
},
{
"title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.",
"journal": "The American journal of pathology",
"date": "2007",
"authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17600130",
"url": "https://glygen.org/publication/PubMed/17600130"
}
]
},
{
"title": "JAM family and related proteins in leukocyte migration (Vestweber series).",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2007",
"authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17615384",
"url": "https://glygen.org/publication/PubMed/17615384"
}
]
},
{
"title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.",
"journal": "Blood",
"date": "2007",
"authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "17625065",
"url": "https://glygen.org/publication/PubMed/17625065"
}
]
},
{
"title": "Activated protein C.",
"journal": "Journal of thrombosis and haemostasis : JTH",
"date": "2007",
"authors": "Griffin JH, Fernandez JA, Gale AJ, Mosnier LO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "17635713",
"url": "https://glygen.org/publication/PubMed/17635713"
}
]
},
{
"title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17985932",
"url": "https://glygen.org/publication/PubMed/17985932"
}
]
},
{
"title": "The spectrum of genetic defects in a panel of 40 Dutch families with symptomatic protein C deficiency type I: heterogeneity and founder effects.",
"journal": "Blood",
"date": "1991",
"authors": "Reitsma PH, Poort SR, Allaart CF, Briet E, Bertina RM",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "1868249",
"url": "https://glygen.org/publication/PubMed/1868249"
}
]
},
{
"title": "Human factor VIIIa subunit structure. Reconstruction of factor VIIIa from the isolated A1/A3-C1-C2 dimer and A2 subunit.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Fay PJ, Haidaris PJ, Smudzin TM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1902833",
"url": "https://glygen.org/publication/PubMed/1902833"
}
]
},
{
"title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2009",
"authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "19279206",
"url": "https://glygen.org/publication/PubMed/19279206"
}
]
},
{
"title": "Discovery of betrixaban (PRT054021), N-(5-chloropyridin-2-yl)-2-(4-(N,N-dimethylcarbamimidoyl)benzamido)-5-methoxybenz amide, a highly potent, selective, and orally efficacious factor Xa inhibitor.",
"journal": "Bioorganic & medicinal chemistry letters",
"date": "2009",
"authors": "Zhang P, Huang W, Wang L, Bao L, Jia ZJ, Bauer SM, Goldman EA, Probst GD, Song Y, Su T, Fan J, Wu Y, Li W, Woolfrey J, Sinha U, Wong PW, Edwards ST, Arfsten AE, Clizbe LA, Kanter J, Pandey A, Park G, Hutchaleelaha A, Lambing JL, Hollenbach SJ, Scarborough RM, Zhu BY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "19297154",
"url": "https://glygen.org/publication/PubMed/19297154"
}
]
},
{
"title": "Inhibition of the thrombin-platelet reactions by DuP 714.",
"journal": "Biochemical and biophysical research communications",
"date": "1991",
"authors": "Chiu AT, Mousa SA, Pease LJ, Roscoe WA, Bozarth JM, Reilly TM, Smith RD, Timmermans PB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1930190",
"url": "https://glygen.org/publication/PubMed/1930190"
}
]
},
{
"title": "N-glycosylation microheterogeneity and site occupancy of an Asn-X-Cys sequon in plasma-derived and recombinant protein C.",
"journal": "Proteomics",
"date": "2009",
"authors": "Gil GC, Velander WH, Van Cott KE",
"evidence": [
{
"database": "UniCarbKB",
"id": "P04070",
"url": ""
}
],
"reference": [
{
"type": "PubMed",
"id": "19343721",
"url": "https://glygen.org/publication/PubMed/19343721"
}
]
},
{
"title": "Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.",
"journal": "Biochemistry",
"date": "1991",
"authors": "McMullen BA, Fujikawa K, Davie EW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "1998667",
"url": "https://glygen.org/publication/PubMed/1998667"
}
]
},
{
"title": "Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Naito K, Fujikawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2019570",
"url": "https://glygen.org/publication/PubMed/2019570"
}
]
},
{
"title": "Binding of human factor VIII to phospholipid vesicles.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Gilbert GE, Furie BC, Furie B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2104832",
"url": "https://glygen.org/publication/PubMed/2104832"
}
]
},
{
"title": "Kinetics of coagulation factor X activation by platelet-bound factor IXa.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Rawala-Sheikh R, Ahmad SS, Ashby B, Walsh PN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2110473",
"url": "https://glygen.org/publication/PubMed/2110473"
}
]
},
{
"title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "21193412",
"url": "https://glygen.org/publication/PubMed/21193412"
}
]
},
{
"title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.",
"journal": "Blood",
"date": "2011",
"authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "21659548",
"url": "https://glygen.org/publication/PubMed/21659548"
}
]
},
{
"title": "Analysis of serpin secretion, misfolding, and surveillance in the endoplasmic reticulum.",
"journal": "Methods in enzymology",
"date": "2011",
"authors": "Pan S, Iannotti MJ, Sifers RN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "21683246",
"url": "https://glygen.org/publication/PubMed/21683246"
}
]
},
{
"title": "Desirudin: a review of the pharmacology and clinical application for the prevention of deep vein thrombosis.",
"journal": "Expert review of cardiovascular therapy",
"date": "2011",
"authors": "Graetz TJ, Tellor BR, Smith JR, Avidan MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "21932952",
"url": "https://glygen.org/publication/PubMed/21932952"
}
]
},
{
"title": "Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2012",
"authors": "Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
},
{
"database": "UniCarbKB",
"id": "P04070",
"url": ""
},
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "22171320",
"url": "https://glygen.org/publication/PubMed/22171320"
}
]
},
{
"title": "Homozygous protein C deficiency with late onset venous thrombosis: identification and in vitro expression study of a novel Pro275Ser mutation.",
"journal": "Pathology",
"date": "2012",
"authors": "Yu T, Dai J, Liu H, Wang J, Ding Q, Wang H, Wang X, Fu Q",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "22531345",
"url": "https://glygen.org/publication/PubMed/22531345"
}
]
},
{
"title": "Genetic background analysis of protein C deficiency demonstrates a recurrent mutation associated with venous thrombosis in Chinese population.",
"journal": "PloS one",
"date": "2012",
"authors": "Tang L, Guo T, Yang R, Mei H, Wang H, Lu X, Yu J, Wang Q, Hu Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "22545135",
"url": "https://glygen.org/publication/PubMed/22545135"
}
]
},
{
"title": "Crystal structures of protease nexin-1 in complex with heparin and thrombin suggest a 2-step recognition mechanism.",
"journal": "Blood",
"date": "2012",
"authors": "Li W, Huntington JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "22618708",
"url": "https://glygen.org/publication/PubMed/22618708"
}
]
},
{
"title": "A sequential mechanism for exosite-mediated factor IX activation by factor XIa.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Geng Y, Verhamme IM, Messer A, Sun MF, Smith SB, Bajaj SP, Gailani D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "22961984",
"url": "https://glygen.org/publication/PubMed/22961984"
}
]
},
{
"title": "Efficacy and toxicity of factor Xa inhibitors.",
"journal": "Journal of pharmacy & pharmaceutical sciences : a publication of the Canadian Society for Pharmaceutical Sciences, Societe canadienne des sciences pharmaceutiques",
"date": "2013",
"authors": "Bondarenko M, Curti C, Montana M, Rathelot P, Vanelle P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "23683607",
"url": "https://glygen.org/publication/PubMed/23683607"
}
]
},
{
"title": "Clot-bound thrombin is protected from inhibition by heparin-antithrombin III but is susceptible to inactivation by antithrombin III-independent inhibitors.",
"journal": "The Journal of clinical investigation",
"date": "1990",
"authors": "Weitz JI, Hudoba M, Massel D, Maraganore J, Hirsh J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2384594",
"url": "https://glygen.org/publication/PubMed/2384594"
}
]
},
{
"title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.",
"journal": "Mucosal immunology",
"date": "2014",
"authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "23945545",
"url": "https://glygen.org/publication/PubMed/23945545"
}
]
},
{
"title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.",
"journal": "The Journal of biological chemistry",
"date": "2013",
"authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "24043627",
"url": "https://glygen.org/publication/PubMed/24043627"
}
]
},
{
"title": "Hereditary thrombophilia: identification of nonsense and missense mutations in the protein C gene.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1987",
"authors": "Romeo G, Hassan HJ, Staempfli S, Roncuzzi L, Cianetti L, Leonardi A, Vicente V, Mannucci PM, Bertina R, Peschle C, et al.",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "2437584",
"url": "https://glygen.org/publication/PubMed/2437584"
}
]
},
{
"title": "The new factor Xa inhibitor: Apixaban.",
"journal": "Journal of pharmacology & pharmacotherapeutics",
"date": "2014",
"authors": "Bhanwra S, Ahluwalia K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "24554904",
"url": "https://glygen.org/publication/PubMed/24554904"
}
]
},
{
"title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "24764293",
"url": "https://glygen.org/publication/PubMed/24764293"
}
]
},
{
"title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Baxter RC, Martin JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2476804",
"url": "https://glygen.org/publication/PubMed/2476804"
}
]
},
{
"title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).",
"journal": "The EMBO journal",
"date": "1989",
"authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2479552",
"url": "https://glygen.org/publication/PubMed/2479552"
}
]
},
{
"title": "In situ-generated thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma.",
"journal": "Blood",
"date": "1989",
"authors": "Pieters J, Lindhout T, Hemker HC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2502206",
"url": "https://glygen.org/publication/PubMed/2502206"
}
]
},
{
"title": "Differential proteolytic activation of factor VIII-von Willebrand factor complex by thrombin.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Hill-Eubanks DC, Parker CG, Lollar P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2505252",
"url": "https://glygen.org/publication/PubMed/2505252"
}
]
},
{
"title": "Purification of protein C from canine plasma.",
"journal": "BMC veterinary research",
"date": "2014",
"authors": "Wong VM, Bienzle D, Hayes MA, Taylor P, Wood RD",
"evidence": [
{
"database": "Automatic Literature Mining",
"id": "25326145",
"url": "https://research.bioinformatics.udel.edu/glyco/pmid/25326145"
}
],
"reference": [
{
"type": "PubMed",
"id": "25326145",
"url": "https://glygen.org/publication/PubMed/25326145"
}
]
},
{
"title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Esmon CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "2538457",
"url": "https://glygen.org/publication/PubMed/2538457"
}
]
},
{
"title": "Molecular characterization of p.Asp77Gly and the novel p.Ala163Val and p.Ala163Glu mutations causing protein C deficiency.",
"journal": "Thrombosis research",
"date": "2015",
"authors": "Kovacs KB, Pataki I, Bardos H, Fekete A, Pfliegler G, Haramura G, Gindele R, Komaromi I, Balla G, Adany R, Muszbek L, Bereczky Z",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "25618265",
"url": "https://glygen.org/publication/PubMed/25618265"
}
]
},
{
"title": "Protein C Thr315Ala variant results in gain of function but manifests as type II deficiency in diagnostic assays.",
"journal": "Blood",
"date": "2015",
"authors": "Ding Q, Yang L, Dinarvand P, Wang X, Rezaie AR",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "25651845",
"url": "https://glygen.org/publication/PubMed/25651845"
}
]
},
{
"title": "Compound heterozygous protein C deficiency in a family with venous thrombosis: Identification and in vitro study of p.Asp297His and p.Val420Leu mutations.",
"journal": "Gene",
"date": "2015",
"authors": "Liu H, Wang HF, Tang L, Yang Y, Wang QY, Zeng W, Wu YY, Cheng ZP, Hu B, Guo T, Hu Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "25748729",
"url": "https://glygen.org/publication/PubMed/25748729"
}
]
},
{
"title": "GGCX and VKORC1 inhibit osteocalcin endocrine functions.",
"journal": "The Journal of cell biology",
"date": "2015",
"authors": "Ferron M, Lacombe J, Germain A, Oury F, Karsenty G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "25753038",
"url": "https://glygen.org/publication/PubMed/25753038"
}
]
},
{
"title": "The regulation of human factor XIIa by plasma proteinase inhibitors.",
"journal": "The Journal of biological chemistry",
"date": "1985",
"authors": "Pixley RA, Schapira M, Colman RW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2578463",
"url": "https://glygen.org/publication/PubMed/2578463"
}
]
},
{
"title": "Distribution of plasma kallikrein between C-1 inactivator and alpha 2-macroglobulin in plasma utilizing a new assay for alpha 2-macroglobulin-kallikrein complexes.",
"journal": "The Journal of biological chemistry",
"date": "1985",
"authors": "Harpel PC, Lewin MF, Kaplan AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "2579948",
"url": "https://glygen.org/publication/PubMed/2579948"
}
]
},
{
"title": "Edoxaban, a Novel Oral Factor Xa Inhibitor.",
"journal": "The Annals of pharmacotherapy",
"date": "2015",
"authors": "Minor C, Tellor KB, Armbruster AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "25855704",
"url": "https://glygen.org/publication/PubMed/25855704"
}
]
},
{
"title": "Protein C London 1: recurrent mutation at Arg 169 (CGG----TGG) in the protein C gene causing thrombosis.",
"journal": "Nucleic acids research",
"date": "1989",
"authors": "Grundy C, Chitolie A, Talbot S, Bevan D, Kakkar V, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "2602169",
"url": "https://glygen.org/publication/PubMed/2602169"
}
]
},
{
"title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.",
"journal": "Cell",
"date": "2015",
"authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
},
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
},
{
"database": "iPTMnet",
"id": "P04070",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "26091039",
"url": "https://glygen.org/publication/PubMed/26091039"
}
]
},
{
"title": "Factor VIII Is Synthesized in Human Endothelial Cells, Packaged in Weibel-Palade Bodies and Secreted Bound to ULVWF Strings.",
"journal": "PloS one",
"date": "2015",
"authors": "Turner NA, Moake JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "26473492",
"url": "https://glygen.org/publication/PubMed/26473492"
}
]
},
{
"title": "Osteocalcin and matrix Gla protein: vitamin K-dependent proteins in bone.",
"journal": "Physiological reviews",
"date": "1989",
"authors": "Hauschka PV, Lian JB, Cole DE, Gundberg CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "2664828",
"url": "https://glygen.org/publication/PubMed/2664828"
}
]
},
{
"title": "Factor IX San Dimas. Substitution of glutamine for Arg-4 in the propeptide leads to incomplete gamma-carboxylation and altered phospholipid binding properties.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Ware J, Diuguid DL, Liebman HA, Rabiet MJ, Kasper CK, Furie BC, Furie B, Stafford DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "2738071",
"url": "https://glygen.org/publication/PubMed/2738071"
}
]
},
{
"title": "High-resolution NMR studies of fibrinogen-like peptides in solution: interaction of thrombin with residues 1-23 of the A alpha chain of human fibrinogen.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Ni F, Konishi Y, Frazier RB, Scheraga HA, Lord ST",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "2742826",
"url": "https://glygen.org/publication/PubMed/2742826"
}
]
},
{
"title": "Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney.",
"journal": "The Journal of biological chemistry",
"date": "1978",
"authors": "Odya CE, Marinkovic DV, Hammon KJ, Stewart TA, Erdos EG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "28321",
"url": "https://glygen.org/publication/PubMed/28321"
}
]
},
{
"title": "Regulation of formation of factor XIIIa by its fibrin substrates.",
"journal": "Biochemistry",
"date": "1985",
"authors": "Lewis SD, Janus TJ, Lorand L, Shafer JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "2866798",
"url": "https://glygen.org/publication/PubMed/2866798"
}
]
},
{
"title": "An update on factor XI structure and function.",
"journal": "Thrombosis research",
"date": "2018",
"authors": "Mohammed BM, Matafonov A, Ivanov I, Sun MF, Cheng Q, Dickeson SK, Li C, Sun D, Verhamme IM, Emsley J, Gailani D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "29223926",
"url": "https://glygen.org/publication/PubMed/29223926"
}
]
},
{
"title": "Large-scale intact glycopeptide identification by Mascot database search.",
"journal": "Scientific reports",
"date": "2018",
"authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B",
"evidence": [
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "29391424",
"url": "https://glygen.org/publication/PubMed/29391424"
}
]
},
{
"title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.",
"journal": "Analytical chemistry",
"date": "2018",
"authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P04070",
"url": ""
},
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "29671580",
"url": "https://glygen.org/publication/PubMed/29671580"
}
]
},
{
"title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.",
"journal": "Analytical chemistry",
"date": "2018",
"authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H",
"evidence": [
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "29741879",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"title": "The structure and evolution of a 461 amino acid human protein C precursor and its messenger RNA, based upon the DNA sequence of cloned human liver cDNAs.",
"journal": "Nucleic Acids Res.",
"date": "1985",
"authors": "Beckmann RJ, Schmidt RJ, Santerre RF, Plutzky J, Crabtree GR, Long GL",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "2991859",
"url": "https://glygen.org/publication/PubMed/2991859"
}
]
},
{
"title": "The nucleotide sequence of the gene for human protein C.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1985",
"authors": "Foster DC, Yoshitake S, Davie EW",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "2991887",
"url": "https://glygen.org/publication/PubMed/2991887"
}
]
},
{
"title": "Binding of coagulation factor XI to washed human platelets.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Greengard JS, Heeb MJ, Ersdal E, Walsh PN, Griffin JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3017409",
"url": "https://glygen.org/publication/PubMed/3017409"
}
]
},
{
"title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).",
"journal": "Molecular systems biology",
"date": "2018",
"authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P04070",
"url": ""
}
],
"reference": [
{
"type": "PubMed",
"id": "30459171",
"url": "https://glygen.org/publication/PubMed/30459171"
}
]
},
{
"title": "Cofactor proteins in the assembly and expression of blood clotting enzyme complexes.",
"journal": "Annual review of biochemistry",
"date": "1988",
"authors": "Mann KG, Jenny RJ, Krishnaswamy S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "3052293",
"url": "https://glygen.org/publication/PubMed/3052293"
}
]
},
{
"title": "Proteolytic processing of human factor VIII. Correlation of specific cleavages by thrombin, factor Xa, and activated protein C with activation and inactivation of factor VIII coagulant activity.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Eaton D, Rodriguez H, Vehar GA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3082357",
"url": "https://glygen.org/publication/PubMed/3082357"
}
]
},
{
"title": "Biosynthesis of complement C1 inhibitor by Hep G2 cells. Reactivity of different glycosylated forms of the inhibitor with C1s.",
"journal": "The Biochemical journal",
"date": "1986",
"authors": "Prandini MH, Reboul A, Colomb MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3099750",
"url": "https://glygen.org/publication/PubMed/3099750"
}
]
},
{
"title": "Synthesis, processing, and secretion of recombinant human factor VIII expressed in mammalian cells.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Kaufman RJ, Wasley LC, Dorner AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3129422",
"url": "https://glygen.org/publication/PubMed/3129422"
}
]
},
{
"title": "Association of the factor VIII light chain with von Willebrand factor.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Lollar P, Hill-Eubanks DC, Parker CG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3134349",
"url": "https://glygen.org/publication/PubMed/3134349"
}
]
},
{
"title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.",
"journal": "Nature communications",
"date": "2020",
"authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P04070",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "33214551",
"url": "https://glygen.org/publication/PubMed/33214551"
}
]
},
{
"title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.",
"journal": "Nature methods",
"date": "2021",
"authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M",
"evidence": [
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "34725484",
"url": "https://glygen.org/publication/PubMed/34725484"
}
]
},
{
"title": "Completion of the primary structure of human high-molecular-mass kininogen. The amino acid sequence of the entire heavy chain and evidence for its evolution by gene triplication.",
"journal": "European journal of biochemistry",
"date": "1986",
"authors": "Kellermann J, Lottspeich F, Henschen A, Muller-Esterl W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3484703",
"url": "https://glygen.org/publication/PubMed/3484703"
}
]
},
{
"title": "Evolution and organization of the human protein C gene.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1986",
"authors": "Plutzky J, Hoskins J A, Long G L, Crabtree G R",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "3511471",
"url": "https://glygen.org/publication/PubMed/3511471"
}
]
},
{
"title": "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Chung DW, Fujikawa K, McMullen BA, Davie EW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3521732",
"url": "https://glygen.org/publication/PubMed/3521732"
}
]
},
{
"title": "Amino acid sequence of human von Willebrand factor.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Titani K, Kumar S, Takio K, Ericsson LH, Wade RD, Ashida K, Walsh KA, Chopek MW, Sadler JE, Fujikawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3524673",
"url": "https://glygen.org/publication/PubMed/3524673"
}
]
},
{
"title": "Expression, purification, and characterization of recombinant gamma-carboxylated factor IX synthesized in Chinese hamster ovary cells.",
"journal": "The Journal of biological chemistry",
"date": "1986",
"authors": "Kaufman RJ, Wasley LC, Furie BC, Furie B, Shoemaker CB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3733688",
"url": "https://glygen.org/publication/PubMed/3733688"
}
]
},
{
"title": "Heparin and its low molecular weight derivatives: anticoagulant and antithrombotic properties.",
"journal": "Haemostasis",
"date": "1986",
"authors": "Holmer E, Soderberg K, Bergqvist D, Lindahl U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "3744129",
"url": "https://glygen.org/publication/PubMed/3744129"
}
]
},
{
"title": "Human C1 inhibitor: primary structure, cDNA cloning, and chromosomal localization.",
"journal": "Biochemistry",
"date": "1986",
"authors": "Bock SC, Skriver K, Nielsen E, Thogersen HC, Wiman B, Donaldson VH, Eddy RL, Marrinan J, Radziejewska E, Huber R, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3756141",
"url": "https://glygen.org/publication/PubMed/3756141"
}
]
},
{
"title": "Activated protein C, protein S, and tissue factor pathway inhibitor cooperate to inhibit thrombin activation.",
"journal": "Thrombosis research",
"date": "2023-10",
"authors": "Li Xian, Song Xiaohong, Mahmood Dlovan F D, Sim Martha M S, Bidarian Sara J, Wood Jeremy P",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
}
],
"reference": [
{
"type": "PubMed",
"id": "37660436",
"url": "https://glygen.org/publication/PubMed/37660436"
}
]
},
{
"title": "Activated Protein C Prevents Neuronal Apoptosis via Protease Activated Receptors 1 and 3.",
"journal": "Neuron",
"date": "2023-12-20",
"authors": "Guo Huang, Liu Dong, Gelbard Harris, Cheng Tong, Insalaco Rae, Fern\u00e1ndez Jos\u00e9 A, Griffin John H, Zlokovic Berislav V",
"evidence": [
{
"database": "RefSeq",
"id": "NP_000303",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_000303"
}
],
"reference": [
{
"type": "PubMed",
"id": "38135361",
"url": "https://glygen.org/publication/PubMed/38135361"
}
]
},
{
"title": "Inhibition of chymotrypsin by heparin cofactor II.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1985",
"authors": "Church FC, Noyes CM, Griffith MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "3863104",
"url": "https://glygen.org/publication/PubMed/3863104"
}
]
},
{
"title": "Amino acid sequence of the heavy chain of human alpha-factor XIIa (activated Hageman factor).",
"journal": "The Journal of biological chemistry",
"date": "1985",
"authors": "McMullen BA, Fujikawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "3886654",
"url": "https://glygen.org/publication/PubMed/3886654"
}
]
},
{
"title": "The amino acid sequence of the light chain of human high-molecular-mass kininogen.",
"journal": "European journal of biochemistry",
"date": "1985",
"authors": "Lottspeich F, Kellermann J, Henschen A, Foertsch B, Muller-Esterl W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "4054110",
"url": "https://glygen.org/publication/PubMed/4054110"
}
]
},
{
"title": "The inhibition of plasmin, plasma kallikrein, plasma permeability factor, and the C'1r subcomponent of the first component of complement by serum C'1 esterase inhibitor.",
"journal": "The Journal of experimental medicine",
"date": "1969",
"authors": "Ratnoff OD, Pensky J, Ogston D, Naff GB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "4178758",
"url": "https://glygen.org/publication/PubMed/4178758"
}
]
},
{
"title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.",
"journal": "The Journal of clinical investigation",
"date": "1979",
"authors": "Kisiel W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "468991",
"url": "https://glygen.org/publication/PubMed/468991"
}
]
},
{
"title": "Inhibition by C1INH of Hagemann factor fragment activation of coagulation, fibrinolysis, and kinin generation.",
"journal": "The Journal of clinical investigation",
"date": "1973",
"authors": "Schreiber AD, Kaplan AP, Austen KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "4703226",
"url": "https://glygen.org/publication/PubMed/4703226"
}
]
},
{
"title": "Human high molecular weight kininogen. Studies of structure-function relationships and of proteolysis of the molecule occurring during contact activation of plasma.",
"journal": "The Journal of biological chemistry",
"date": "1979",
"authors": "Kerbiriou DM, Griffin JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "500690",
"url": "https://glygen.org/publication/PubMed/500690"
}
]
},
{
"title": "Activation of human factor XI (plasma thromboplastin antecedent) by factor XIIa (activated Hageman factor).",
"journal": "Biochemistry",
"date": "1977",
"authors": "Kurachi K, Davie EW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "588558",
"url": "https://glygen.org/publication/PubMed/588558"
}
]
},
{
"title": "Primary structure of human alpha 2-macroglobulin. V. The complete structure.",
"journal": "The Journal of biological chemistry",
"date": "1984",
"authors": "Sottrup-Jensen L, Stepanik TM, Kristensen T, Wierzbicki DM, Jones CM, Lonblad PB, Magnusson S, Petersen TE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "6203908",
"url": "https://glygen.org/publication/PubMed/6203908"
}
]
},
{
"title": "Mechanism of inhibition of activated protein C by protein C inhibitor.",
"journal": "Journal of biochemistry",
"date": "1984",
"authors": "Suzuki K, Nishioka J, Kusumoto H, Hashimoto S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "6323392",
"url": "https://glygen.org/publication/PubMed/6323392"
}
]
},
{
"title": "Binding of human blood-coagulation Factors IXa and X to phospholipid membranes.",
"journal": "The Biochemical journal",
"date": "1984",
"authors": "Mertens K, Cupers R, Van Wijngaarden A, Bertina RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "6334516",
"url": "https://glygen.org/publication/PubMed/6334516"
}
]
},
{
"title": "Structure of human factor VIII.",
"journal": "Nature",
"date": "1984",
"authors": "Vehar GA, Keyt B, Eaton D, Rodriguez H, O'Brien DP, Rotblat F, Oppermann H, Keck R, Wood WI, Harkins RN, Tuddenham EG, Lawn RM, Capon DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "6438527",
"url": "https://glygen.org/publication/PubMed/6438527"
}
]
},
{
"title": "Characterization of a cDNA coding for human protein C.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "1984",
"authors": "Foster D, Davie E W",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "6589623",
"url": "https://glygen.org/publication/PubMed/6589623"
}
]
},
{
"title": "Amino acid sequence of human beta-factor XIIa.",
"journal": "The Journal of biological chemistry",
"date": "1983",
"authors": "Fujikawa K, McMullen BA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "6604055",
"url": "https://glygen.org/publication/PubMed/6604055"
}
]
},
{
"title": "Isolation and sequence of the vitamin K-dependent protein from human bone. Undercarboxylation of the first glutamic acid residue.",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Poser JW, Esch FS, Ling NC, Price PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "6967872",
"url": "https://glygen.org/publication/PubMed/6967872"
}
]
},
{
"title": "Studies on synthetic peptides that bind to fibrinogen and prevent fibrin polymerization. Structural requirements, number of binding sites, and species differences.",
"journal": "Biochemistry",
"date": "1980",
"authors": "Laudano AP, Doolittle RF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "7356959",
"url": "https://glygen.org/publication/PubMed/7356959"
}
]
},
{
"title": "Autoactivation of human Hageman factor. Demonstration utilizing a synthetic substrate.",
"journal": "The Journal of biological chemistry",
"date": "1980",
"authors": "Silverberg M, Dunn JT, Garen L, Kaplan AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "7391081",
"url": "https://glygen.org/publication/PubMed/7391081"
}
]
},
{
"title": "Effects of protein S and factor Xa on peptide bond cleavages during inactivation of factor Va and factor VaR506Q by activated protein C.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Rosing J, Hoekema L, Nicolaes GA, Thomassen MC, Hemker HC, Varadi K, Schwarz HP, Tans G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "7499257",
"url": "https://glygen.org/publication/PubMed/7499257"
}
]
},
{
"title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.",
"journal": "Nature",
"date": "1994",
"authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "7509040",
"url": "https://glygen.org/publication/PubMed/7509040"
}
]
},
{
"title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Arai T, Parker A, Busby W Jr, Clemmons DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7519608",
"url": "https://glygen.org/publication/PubMed/7519608"
}
]
},
{
"title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "7521878",
"url": "https://glygen.org/publication/PubMed/7521878"
}
]
},
{
"title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7523391",
"url": "https://glygen.org/publication/PubMed/7523391"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Bach LA, Hsieh S, Brown AL, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525263",
"url": "https://glygen.org/publication/PubMed/7525263"
}
]
},
{
"title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1994",
"authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525634",
"url": "https://glygen.org/publication/PubMed/7525634"
}
]
},
{
"title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.",
"journal": "The Journal of endocrinology",
"date": "1994",
"authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525824",
"url": "https://glygen.org/publication/PubMed/7525824"
}
]
},
{
"title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7527330",
"url": "https://glygen.org/publication/PubMed/7527330"
}
]
},
{
"title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.",
"journal": "Growth regulation",
"date": "1994",
"authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7538844",
"url": "https://glygen.org/publication/PubMed/7538844"
}
]
},
{
"title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1995",
"authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7543116",
"url": "https://glygen.org/publication/PubMed/7543116"
}
]
},
{
"title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).",
"journal": "Endocrinology",
"date": "1995",
"authors": "Angelloz-Nicoud P, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7588299",
"url": "https://glygen.org/publication/PubMed/7588299"
}
]
},
{
"title": "Three novel mutations in the protein C (PROC) gene causing venous thrombosis.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1995",
"authors": "Millar DS, Bevan D, Chitolie A, Reynaud J, Chisholm M, Kakkar VV, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7605880",
"url": "https://glygen.org/publication/PubMed/7605880"
}
]
},
{
"title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7683646",
"url": "https://glygen.org/publication/PubMed/7683646"
}
]
},
{
"title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.",
"journal": "Experientia",
"date": "1993",
"authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7689487",
"url": "https://glygen.org/publication/PubMed/7689487"
}
]
},
{
"title": "Expression of the blood-clotting factor-VIII cDNA is repressed by a transcriptional silencer located in its coding region.",
"journal": "Blood",
"date": "1995",
"authors": "Hoeben RC, Fallaux FJ, Cramer SJ, van den Wollenberg DJ, van Ormondt H, Briet E, van der Eb AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "7727775",
"url": "https://glygen.org/publication/PubMed/7727775"
}
]
},
{
"title": "The affinity and stoichiometry of binding of human factor VIII to von Willebrand factor.",
"journal": "Blood",
"date": "1995",
"authors": "Vlot AJ, Koppelman SJ, van den Berg MH, Bouma BN, Sixma JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "7756647",
"url": "https://glygen.org/publication/PubMed/7756647"
}
]
},
{
"title": "Six different point mutations in seven Danish families with symptomatic protein C deficiency.",
"journal": "Thrombosis and haemostasis",
"date": "1995",
"authors": "Lind B, Schwartz M, Thorsen S",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7792728",
"url": "https://glygen.org/publication/PubMed/7792728"
}
]
},
{
"title": "A homozygous deletion/insertion mutation in the protein C (PROC) gene causing neonatal Purpura fulminans: prenatal diagnosis in an at-risk pregnancy.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1994",
"authors": "Millar DS, Allgrove J, Rodeck C, Kakkar VV, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7841323",
"url": "https://glygen.org/publication/PubMed/7841323"
}
]
},
{
"title": "A novel homozygous missense mutation (Val 325-->Ala) in the protein C gene causing neonatal purpura fulminans.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1994",
"authors": "Witt I, Beck S, Seydewitz HH, Tasangil C, Schenck W",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7841324",
"url": "https://glygen.org/publication/PubMed/7841324"
}
]
},
{
"title": "Six missense mutations associated with type I and type II protein C deficiency and implications obtained from molecular modelling.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1994",
"authors": "Zheng YZ, Sakata T, Matsusue T, Umeyama H, Kato H, Miyata T",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7865674",
"url": "https://glygen.org/publication/PubMed/7865674"
}
]
},
{
"title": "Homozygous type I protein C deficiency in two unrelated families exhibiting thrombophilia related to Ala136-->Pro or Arg286-->His mutations.",
"journal": "Thrombosis and haemostasis",
"date": "1994",
"authors": "Long GL, Tomczak JA, Rainville IR, Dreyfus M, Schramm W, Schwarz HP",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7878626",
"url": "https://glygen.org/publication/PubMed/7878626"
}
]
},
{
"title": "First de novo mutations in the protein C gene of two patients with type I deficiency: a missense mutation and a splice site deletion.",
"journal": "Blood",
"date": "1994",
"authors": "Gandrille S, Jude B, Alhenc-Gelas M, Emmerich J, Aiach M",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7919373",
"url": "https://glygen.org/publication/PubMed/7919373"
}
]
},
{
"title": "Influence of six mutations of the protein C gene on the Gla domain conformation and calcium affinity.",
"journal": "Thrombosis and haemostasis",
"date": "1994",
"authors": "Gaussem P, Gandrille S, Duchemin J, Emmerich J, Alhenc-Gelas M, Aillaud MF, Aiach M",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "7974343",
"url": "https://glygen.org/publication/PubMed/7974343"
}
]
},
{
"title": "Models of the serine protease domain of the human antithrombotic plasma factor activated protein C and its zymogen.",
"journal": "Protein Sci.",
"date": "1994",
"authors": "Fisher C L, Greengard J S, Griffin J H",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8003977",
"url": "https://glygen.org/publication/PubMed/8003977"
}
]
},
{
"title": "Novel Asn-linked oligosaccharides terminating in GalNAc beta (1-->4)[Fuc alpha (1-->3)]GlcNAc beta (1-->.) are present in recombinant human protein C expressed in human kidney 293 cells.",
"journal": "Glycobiology",
"date": "1993",
"authors": "Yan SB, Chao YB, van Halbeek H",
"evidence": [
{
"database": "UniCarbKB",
"id": "P04070",
"url": ""
},
{
"database": "GlyConnect",
"id": "620",
"url": "https://glyconnect.expasy.org/browser/proteins/620"
}
],
"reference": [
{
"type": "PubMed",
"id": "8130392",
"url": "https://glygen.org/publication/PubMed/8130392"
}
]
},
{
"title": "Factor IXa protects factor VIIIa from activated protein C. Factor IXa inhibits activated protein C-catalyzed cleavage of factor VIIIa at Arg562.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Regan LM, Lamphear BJ, Huggins CF, Walker FJ, Fay PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "8144529",
"url": "https://glygen.org/publication/PubMed/8144529"
}
]
},
{
"title": "Biology of factor IX.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1993",
"authors": "Kurachi K, Kurachi S, Furukawa M, Yao SN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8148489",
"url": "https://glygen.org/publication/PubMed/8148489"
}
]
},
{
"title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.",
"journal": "The Journal of cell biology",
"date": "1994",
"authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "8163559",
"url": "https://glygen.org/publication/PubMed/8163559"
}
]
},
{
"title": "The surrogate light chain in B-cell development.",
"journal": "Immunology today",
"date": "1993",
"authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "8166770",
"url": "https://glygen.org/publication/PubMed/8166770"
}
]
},
{
"title": "Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular `heads` of C1q.",
"journal": "The Journal of experimental medicine",
"date": "1994",
"authors": "Ghebrehiwet B, Lim BL, Peerschke EI, Willis AC, Reid KB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8195709",
"url": "https://glygen.org/publication/PubMed/8195709"
}
]
},
{
"title": "Genetic mutations in ten unrelated American patients with symptomatic type 1 protein C deficiency.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1993",
"authors": "Tsay W, Greengard JS, Montgomery RR, McPherson RA, Fucci JC, Koerper MA, Coughlin J, Griffin JH",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8292730",
"url": "https://glygen.org/publication/PubMed/8292730"
}
]
},
{
"title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.",
"journal": "The Journal of cell biology",
"date": "1993",
"authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "8314844",
"url": "https://glygen.org/publication/PubMed/8314844"
}
]
},
{
"title": "Five novel mutations located in exons III and IX of the protein C gene in patients presenting with defective protein C anticoagulant activity.",
"journal": "Blood",
"date": "1993",
"authors": "Gandrille S, Alhenc-Gelas M, Gaussem P, Aillaud MF, Dupuy E, Juhan-Vague I, Aiach M",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8324221",
"url": "https://glygen.org/publication/PubMed/8324221"
}
]
},
{
"title": "The protein encoded by a growth arrest-specific gene (gas6) is a new member of the vitamin K-dependent proteins related to protein S, a negative coregulator in the blood coagulation cascade.",
"journal": "Molecular and cellular biology",
"date": "1993",
"authors": "Manfioletti G, Brancolini C, Avanzi G, Schneider C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "8336730",
"url": "https://glygen.org/publication/PubMed/8336730"
}
]
},
{
"title": "Factor XII-independent activation of factor XI in plasma: effects of sulfatides on tissue factor-induced coagulation.",
"journal": "Blood",
"date": "1993",
"authors": "Gailani D, Broze GJ Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8338946",
"url": "https://glygen.org/publication/PubMed/8338946"
}
]
},
{
"title": "Sequencing and cloning of human prolylcarboxypeptidase (angiotensinase C). Similarity to both serine carboxypeptidase and prolylendopeptidase families.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Tan F, Morris PW, Skidgel RA, Erdos EG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8344943",
"url": "https://glygen.org/publication/PubMed/8344943"
}
]
},
{
"title": "Symptomatic type II protein C deficiency caused by a missense mutation (Gly 381-->Ser) in the substrate-binding pocket.",
"journal": "British journal of haematology",
"date": "1993",
"authors": "Marchetti G, Patracchini P, Gemmati D, Castaman G, Rodeghiero F, Wacey A, Cooper DN, Tuddenham EG, Bernardi F",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8398832",
"url": "https://glygen.org/publication/PubMed/8398832"
}
]
},
{
"title": "Protein C deficiency: a database of mutations.",
"journal": "Thromb. Haemost.",
"date": "1993",
"authors": "Reitsma P H, Poort S R, Bernardi F, Gandrille S, Long G L, Sala N, Cooper D N",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8446940",
"url": "https://glygen.org/publication/PubMed/8446940"
}
]
},
{
"title": "PACE/furin can process the vitamin K-dependent pro-factor IX precursor within the secretory pathway.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Wasley LC, Rehemtulla A, Bristol JA, Kaufman RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159782",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159782"
}
],
"reference": [
{
"type": "PubMed",
"id": "8473289",
"url": "https://glygen.org/publication/PubMed/8473289"
}
]
},
{
"title": "An abnormal protein C (protein C Yonago) with an amino acid substitution of Gly for Arg-15 caused by a single base mutation of C to G in codon 57 (CGG-->GGG). Deteriorated calcium-dependent conformation of the gamma-carboxyglutamic acid domain relevant to a thrombotic tendency.",
"journal": "International journal of hematology",
"date": "1993",
"authors": "Mimuro J, Muramatsu S, Kaneko M, Yoshitake S, Iijima K, Nakamura K, Sakata Y, Matsuda M",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8477066",
"url": "https://glygen.org/publication/PubMed/8477066"
}
]
},
{
"title": "Twelve novel and two recurrent mutations in 14 Austrian families with hereditary protein C deficiency.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1993",
"authors": "Poort SR, Pabinger-Fasching I, Mannhalter C, Reitsma PH, Bertina RM",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8499565",
"url": "https://glygen.org/publication/PubMed/8499565"
}
]
},
{
"title": "A Gla domain mutation (Arg 15-->Trp) in the protein C (PROC) gene causing type 2 protein C deficiency and recurrent venous thrombosis.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1993",
"authors": "Millar DS, Grundy CB, Bignell P, Moffat EH, Martin R, Kakkar VV, Cooper DN",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8499568",
"url": "https://glygen.org/publication/PubMed/8499568"
}
]
},
{
"title": "Processive post-translational modification. Vitamin K-dependent carboxylation of a peptide substrate.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Morris DP, Stevens RD, Wright DJ, Stafford DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-159740",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740"
}
],
"reference": [
{
"type": "PubMed",
"id": "8530480",
"url": "https://glygen.org/publication/PubMed/8530480"
}
]
},
{
"title": "Protein C Osaka 10 with aberrant propeptide processing: loss of anticoagulant activity due to an amino acid substitution in the protein C precursor.",
"journal": "Thrombosis and haemostasis",
"date": "1995",
"authors": "Miyata T, Zheng YZ, Sakata T, Kato H",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8560401",
"url": "https://glygen.org/publication/PubMed/8560401"
}
]
},
{
"title": "Activation of the factor VIIIa-factor IXa enzyme complex of blood coagulation by membranes containing phosphatidyl-L-serine.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Gilbert GE, Arena AA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626656",
"url": "https://glygen.org/publication/PubMed/8626656"
}
]
},
{
"title": "Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular `heads` of C1q (gC1q-R).",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1996",
"authors": "Joseph K, Ghebrehiwet B, Peerschke EI, Reid KB, Kaplan AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "8710908",
"url": "https://glygen.org/publication/PubMed/8710908"
}
]
},
{
"title": "Activation and function of human Hageman factor. The role of high molecular weight kininogen and prekallikrein.",
"journal": "The Journal of clinical investigation",
"date": "1977",
"authors": "Meier HL, Pierce JV, Colman RW, Kaplan AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "874082",
"url": "https://glygen.org/publication/PubMed/874082"
}
]
},
{
"title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.",
"journal": "Biochimica et biophysica acta",
"date": "1996",
"authors": "Bach LA, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8781553",
"url": "https://glygen.org/publication/PubMed/8781553"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.",
"journal": "Progress in growth factor research",
"date": "1995",
"authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8817670",
"url": "https://glygen.org/publication/PubMed/8817670"
}
]
},
{
"title": "Two novel (R(-11)C; T394D) and two repeat missense mutations in the protein C gene associated with venous thrombosis in six kindreds.",
"journal": "Human mutation",
"date": "1996",
"authors": "Ireland HA, Boisclair MD, Taylor J, Thompson E, Thein SL, Girolami A, De Caterina M, Scopacasa F, De Stefano V, Leone G, Finazzi G, Cohen H, Lane DA",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "8829639",
"url": "https://glygen.org/publication/PubMed/8829639"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.",
"journal": "Growth regulation",
"date": "1996",
"authors": "Angelloz-Nicoud P, Harel L, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8894645",
"url": "https://glygen.org/publication/PubMed/8894645"
}
]
},
{
"title": "Human blood coagulation factor XI. Purification, properties, and mechanism of activation by activated factor XII.",
"journal": "The Journal of biological chemistry",
"date": "1977",
"authors": "Bouma BN, Griffin JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "893417",
"url": "https://glygen.org/publication/PubMed/893417"
}
]
},
{
"title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.",
"journal": "Hormone research",
"date": "1996",
"authors": "Lalou C, Lassarre C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8964575",
"url": "https://glygen.org/publication/PubMed/8964575"
}
]
},
{
"title": "The 2.8 A crystal structure of Gla-domainless activated protein C.",
"journal": "EMBO J.",
"date": "1996",
"authors": "Mather T, Oganessyan V, Hof P, Huber R, Foundling S, Esmon C, Bode W",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "9003757",
"url": "https://glygen.org/publication/PubMed/9003757"
}
]
},
{
"title": "An endothelial receptor for oxidized low-density lipoprotein.",
"journal": "Nature",
"date": "1997",
"authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9052782",
"url": "https://glygen.org/publication/PubMed/9052782"
}
]
},
{
"title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.",
"journal": "Infection and immunity",
"date": "1997",
"authors": "Bos MP, Grunert F, Belland RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9169774",
"url": "https://glygen.org/publication/PubMed/9169774"
}
]
},
{
"title": "Identification of functional endothelial protein C receptor in human plasma.",
"journal": "The Journal of clinical investigation",
"date": "1997",
"authors": "Kurosawa S, Stearns-Kurosawa DJ, Hidari N, Esmon CT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140875",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875"
}
],
"reference": [
{
"type": "PubMed",
"id": "9218519",
"url": "https://glygen.org/publication/PubMed/9218519"
}
]
},
{
"title": "High molecular weight kininogen peptides inhibit the formation of kallikrein on endothelial cell surfaces and subsequent urokinase-dependent plasmin formation.",
"journal": "Blood",
"date": "1997",
"authors": "Lin Y, Harris RB, Yan W, McCrae KR, Zhang H, Colman RW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9226169",
"url": "https://glygen.org/publication/PubMed/9226169"
}
]
},
{
"title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.",
"journal": "Science (New York, N.Y.)",
"date": "1997",
"authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9242610",
"url": "https://glygen.org/publication/PubMed/9242610"
}
]
},
{
"title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Tsuji M, Ezumi Y, Arai M, Takayama H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9295288",
"url": "https://glygen.org/publication/PubMed/9295288"
}
]
},
{
"title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.",
"journal": "The Journal of cell biology",
"date": "1997",
"authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9382878",
"url": "https://glygen.org/publication/PubMed/9382878"
}
]
},
{
"title": "High molecular weight kininogen regulates prekallikrein assembly and activation on endothelial cells: a novel mechanism for contact activation.",
"journal": "Blood",
"date": "1998",
"authors": "Motta G, Rojkjaer R, Hasan AA, Cines DB, Schmaier AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9427705",
"url": "https://glygen.org/publication/PubMed/9427705"
}
]
},
{
"title": "Effects of melagatran, a new low-molecular-weight thrombin inhibitor, on thrombin and fibrinolytic enzymes.",
"journal": "Thrombosis and haemostasis",
"date": "1998",
"authors": "Gustafsson D, Antonsson T, Bylund R, Eriksson U, Gyzander E, Nilsson I, Elg M, Mattsson C, Deinum J, Pehrsson S, Karlsson O, Nilsson A, Sorensen H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9459334",
"url": "https://glygen.org/publication/PubMed/9459334"
}
]
},
{
"title": "Novastan (brand of argatroban): a small-molecule, direct thrombin inhibitor.",
"journal": "Seminars in thrombosis and hemostasis",
"date": "1997",
"authors": "Hursting MJ, Alford KL, Becker JC, Brooks RL, Joffrion JL, Knappenberger GD, Kogan PW, Kogan TP, McKinney AA, Schwarz RP Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9469622",
"url": "https://glygen.org/publication/PubMed/9469622"
}
]
},
{
"title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9497324",
"url": "https://glygen.org/publication/PubMed/9497324"
}
]
},
{
"title": "Biosynthesis, assembly and secretion of coagulation factor VIII.",
"journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis",
"date": "1997",
"authors": "Kaufman RJ, Pipe SW, Tagliavacca L, Swaroop M, Moussalli M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9607108",
"url": "https://glygen.org/publication/PubMed/9607108"
}
]
},
{
"title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.",
"journal": "The Biochemical journal",
"date": "1998",
"authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9693095",
"url": "https://glygen.org/publication/PubMed/9693095"
}
]
},
{
"title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1998",
"authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9709957",
"url": "https://glygen.org/publication/PubMed/9709957"
}
]
},
{
"title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9733769",
"url": "https://glygen.org/publication/PubMed/9733769"
}
]
},
{
"title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "1998",
"authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-202733",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733"
}
],
"reference": [
{
"type": "PubMed",
"id": "9763524",
"url": "https://glygen.org/publication/PubMed/9763524"
}
]
},
{
"title": "Activation of factor VIII by thrombin increases its affinity for binding to synthetic phospholipid membranes and activated platelets.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Saenko EL, Scandella D, Yakhyaev AV, Greco NJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9774404",
"url": "https://glygen.org/publication/PubMed/9774404"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9786878",
"url": "https://glygen.org/publication/PubMed/9786878"
}
]
},
{
"title": "Type I protein C deficiency in French Canadians: evidence of a founder effect and association of specific protein C gene mutations with plasma protein C levels.",
"journal": "Thrombosis and haemostasis",
"date": "1998",
"authors": "Couture P, Demers C, Morissette J, Delage R, Jomphe M, Couture L, Simard J",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"reference": [
{
"type": "PubMed",
"id": "9798967",
"url": "https://glygen.org/publication/PubMed/9798967"
}
]
},
{
"title": "The life cycle of coagulation factor VIII in view of its structure and function.",
"journal": "Blood",
"date": "1998",
"authors": "Lenting PJ, van Mourik JA, Mertens K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9834200",
"url": "https://glygen.org/publication/PubMed/9834200"
}
]
},
{
"title": "Thrombin activates factor XI on activated platelets in the absence of factor XII.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "1999",
"authors": "Oliver JA, Monroe DM, Roberts HR, Hoffman M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-140837",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837"
}
],
"reference": [
{
"type": "PubMed",
"id": "9888880",
"url": "https://glygen.org/publication/PubMed/9888880"
}
]
},
{
"title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.",
"journal": "American journal of respiratory cell and molecular biology",
"date": "1999",
"authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9922210",
"url": "https://glygen.org/publication/PubMed/9922210"
}
]
}
],
"pathway": [
{
"id": "hsa:5624",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5624",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-140837",
"name": "Intrinsic Pathway of Fibrin Clot Formation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837",
"resource": "Reactome",
"description": "Intrinsic Pathway of Fibrin Clot Formation"
},
{
"id": "R-HSA-140875",
"name": "Common Pathway of Fibrin Clot Formation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140875",
"resource": "Reactome",
"description": "Common Pathway of Fibrin Clot Formation"
},
{
"id": "R-HSA-159740",
"name": "Gamma-carboxylation of protein precursors",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159740",
"resource": "Reactome",
"description": "Gamma-carboxylation of protein precursors"
},
{
"id": "R-HSA-159763",
"name": "Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159763",
"resource": "Reactome",
"description": "Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus"
},
{
"id": "R-HSA-159782",
"name": "Removal of aminoterminal propeptides from gamma-carboxylated proteins",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159782",
"resource": "Reactome",
"description": "Removal of aminoterminal propeptides from gamma-carboxylated proteins"
},
{
"id": "R-HSA-202733",
"name": "Cell surface interactions at the vascular wall",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733",
"resource": "Reactome",
"description": "Cell surface interactions at the vascular wall"
},
{
"id": "R-HSA-381426",
"name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"resource": "Reactome",
"description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)"
},
{
"id": "R-HSA-8957275",
"name": "Post-translational protein phosphorylation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275",
"resource": "Reactome",
"description": "Post-translational protein phosphorylation"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P31394-1",
"protein_name": "Vitamin K-dependent protein C",
"gene_name": "Proc",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MWQFRIFLLFASTWGISGVSAHPDPVFSSSEGAHQVLRVRRANSFLEEVRAGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCSCDKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCRCAPGYELADDHMHCRPTVNFPCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFILTFIRIPLAARNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHLNNYGVYTKVGSYLKWIHSYIGERDVSLKSPKL",
"length": 461
},
"evidence": [
{
"id": "45920714",
"url": "http://www.informatics.jax.org/homology/45920714",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P33587-1",
"protein_name": "Vitamin K-dependent protein C",
"gene_name": "Proc",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWQFRVFLLLMSTWGISSIPAHPDPVFSSSEHAHQVLRVRRANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPPLDHQCDSPCCGHGTCIDGIGSFSCSCDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKILKRDTDLEDELEPDPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGTKKLTVRLGEYDLRRRDHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQELTQAGQETVVTGWGYQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWIHSYIGEKGVSLKSQKL",
"length": 460
},
"evidence": [
{
"id": "45920714",
"url": "http://www.informatics.jax.org/homology/45920714",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 2,
"go_terms": [
{
"name": "serine-type endopeptidase activity",
"id": "GO:0004252",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "calcium ion binding",
"id": "GO:0005509",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 6,
"go_terms": [
{
"name": "extracellular region",
"id": "GO:0005576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum lumen",
"id": "GO:0005788",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "Golgi lumen",
"id": "GO:0005796",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum",
"id": "GO:0005783",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "Golgi apparatus",
"id": "GO:0005794",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 7,
"go_terms": [
{
"name": "proteolysis",
"id": "GO:0006508",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "blood coagulation",
"id": "GO:0007596",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "negative regulation of apoptotic process",
"id": "GO:0043066",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "negative regulation of inflammatory response",
"id": "GO:0050728",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "positive regulation of establishment of endothelial barrier",
"id": "GO:1903142",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903142",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "negative regulation of blood coagulation",
"id": "GO:0030195",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030195",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
},
{
"name": "negative regulation of coagulation",
"id": "GO:0050819",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050819",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [
{
"name": "vitamin K-dependent protein C N-glycosylated 1 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053224",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053224"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 2 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G17409FQ. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G17409FQ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053225",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053225"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 3 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G32246SI. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G32246SI. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053226",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053226"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 4 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G34306IB. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G34306IB. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053227",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053227"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 5 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G37868ZX. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G37868ZX. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053228",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053228"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 6 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053229",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053229"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 7 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42440OJ. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G42440OJ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053230",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053230"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 8 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G45495MK. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G45495MK. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053231",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053231"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 9 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053232",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053232"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 10 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G61726TP. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G61726TP. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053233",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053233"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 11 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-139 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G79939YZ. Example: UniProtKB:P04070-1, Asn-139, MOD:00160~GNO:G79939YZ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053234",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053234"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 12 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]",
"evidence": [
{
"id": "PR:000053235",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053235"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 13 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053236",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053236"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 14 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G34306IB. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G34306IB. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053237",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053237"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 15 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G37868ZX. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G37868ZX. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053238",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053238"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 16 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053239",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053239"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 17 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42440OJ. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G42440OJ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053240",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053240"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 18 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G45495MK. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G45495MK. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053241",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053241"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 19 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053242",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053242"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 20 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-290 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G61726TP. Example: UniProtKB:P04070-1, Asn-290, MOD:00160~GNO:G61726TP. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053243",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053243"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 21 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053244",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053244"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 22 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G34306IB. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G34306IB. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053245",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053245"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 23 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G37868ZX. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G37868ZX. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053246",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053246"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 24 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053247",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053247"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 25 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42440OJ. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G42440OJ. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053248",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053248"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 26 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G45495MK. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G45495MK. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053249",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053249"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 27 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053250",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053250"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 28 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-355 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G61726TP. Example: UniProtKB:P04070-1, Asn-355, MOD:00160~GNO:G61726TP. [PRO:DNx, PMID:19343721]",
"evidence": [
{
"id": "PR:000053251",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053251"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 29 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053252",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053252"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 30 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G13661YX. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G13661YX. [PRO:DNx, PMID:8130392]",
"evidence": [
{
"id": "PR:000053253",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053253"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 31 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G16758MX. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G16758MX. [PRO:DNx, PMID:8130392]",
"evidence": [
{
"id": "PR:000053254",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053254"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 32 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G17409FQ. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G17409FQ. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053255",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053255"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 33 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G30939HN. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G30939HN. [PRO:DNx, PMID:8130392]",
"evidence": [
{
"id": "PR:000053256",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053256"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 34 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G34306IB. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G34306IB. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053257",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053257"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 35 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G37868ZX. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G37868ZX. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053258",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053258"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 36 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053259",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053259"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 37 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G42440OJ. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G42440OJ. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053260",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053260"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 38 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G45495MK. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G45495MK. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053261",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053261"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 39 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053262",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053262"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 40 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G61726TP. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G61726TP. [PRO:DNx, PMID:19343721, PMID:8130392]",
"evidence": [
{
"id": "PR:000053263",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053263"
}
]
},
{
"name": "vitamin K-dependent protein C N-glycosylated 41 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been N-glycosylated at the residue equivalent to Asn-371 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P04070-1, Asn-371, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:8130392]",
"evidence": [
{
"id": "PR:000053264",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053264"
}
]
},
{
"name": "vitamin K-dependent protein C O-glycosylated 1 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been O-glycosylated at the residue equivalent to Ser-382 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04070-1, Ser-382, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]",
"evidence": [
{
"id": "PR:000053265",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053265"
}
]
},
{
"name": "vitamin K-dependent protein C O-glycosylated 2 (human)",
"definition": "A vitamin K-dependent protein C (human) that has been O-glycosylated at the residue equivalent to Thr-19 of the amino acid sequence represented by UniProtKB:P04070-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04070-1, Thr-19, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:22171320]",
"evidence": [
{
"id": "PR:000053266",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053266"
}
]
}
],
"site_annotation": [
{
"start_pos": 139,
"end_pos": 141,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 290,
"end_pos": 292,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 355,
"end_pos": 357,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "N- and O-glycosylated. Partial (70%) N-glycosylation of Asn-371 with an atypical N-X-C site produces a higher molecular weight form referred to as alpha. The lower molecular weight form, not N-glycosylated at Asn-371, is beta. O-glycosylated with core 1 or possibly core 8 glycans.",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
},
{
"database": "PubMed",
"id": "16335952",
"url": "https://glygen.org/publication/PubMed/16335952"
},
{
"database": "PubMed",
"id": "2991887",
"url": "https://glygen.org/publication/PubMed/2991887"
},
{
"database": "PubMed",
"id": "1694179",
"url": "https://glygen.org/publication/PubMed/1694179"
},
{
"database": "PubMed",
"id": "22171320",
"url": "https://glygen.org/publication/PubMed/22171320"
}
]
},
{
"annotation": "The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.",
"evidence": [
{
"database": "UniProtKB",
"id": "P04070",
"url": "https://www.uniprot.org/uniprot/P04070"
},
{
"database": "PubMed",
"id": "2991887",
"url": "https://glygen.org/publication/PubMed/2991887"
},
{
"database": "PubMed",
"id": "1544894",
"url": "https://glygen.org/publication/PubMed/1544894"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "R-HSA-140599",
"name": "factor XIII -> factor XIII cleaved tetramer + 2 factor XIII A activation peptides",
"equation": "",
"summary": "Activated thrombin cleaves the A chains of factor XIII tetramers in a reaction stimulated by the presence of fibrin multimers (Lewis et al. 1985). The amino terminal portions of the A chains are released as activation peptides, which have no known function. The resulting factor XIII tetramer remains catalytically inactive.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1",
"P00734-1",
"P00488-1"
],
"evidence": [
{
"id": "R-HSA-140599",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140599"
}
]
},
{
"id": "R-HSA-140696",
"name": "factor V -> factor Va + factor V activation peptide",
"equation": "",
"summary": "Activated thrombin (factor IIa) catalyzes the conversion of factor V to factor Va (activated factor V). The activation peptide released in this reaction has no known function.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-140697"
],
"output_participant_list": [
"R-HSA-140692",
"R-HSA-140787"
],
"enzyme_list": [
"P04070-1",
"P00734-1"
],
"evidence": [
{
"id": "R-HSA-140696",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140696"
}
]
},
{
"id": "R-HSA-140840",
"name": "fibrinogen -> fibrin monomer + 2 fibrinopeptide A + 2 fibrinopeptide B",
"equation": "",
"summary": "The alpha and beta chains of fibrinogen hexamer are cleaved by thrombin to generate fibrin monomer (Ni et al. 1989). The amino terminal regions of the cleaved alpha and beta chains are released (fibrinopeptides A and B respectively).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-114618"
],
"output_participant_list": [
"R-HSA-140586",
"R-HSA-140867",
"R-HSA-140876"
],
"enzyme_list": [
"P04070-1",
"P00734-1"
],
"evidence": [
{
"id": "R-HSA-140840",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140840"
}
]
},
{
"id": "R-HSA-141026",
"name": "Activated protein C cleaves factor Va to factor Vi intermediate form",
"equation": "",
"summary": "Activated protein C cleaves peptide bonds in activated factor V (factor Va), converting it to an inactive form (factor Vi). APC proteolysis involves cleavage of the factor Va heavy chain at Arg-334 (306 if signal peptide is not included) and Arg-534 (506 with no signal peptide) (Nicolaes et al. 1985). Most factor Va molecules are initially cleaved at Arg-534, yielding a partially active intermediate, followed by complete inactivation through cleavage at Arg-334 (Kalafatis et al. 1994). Factor Xa inhibits Arg-534 cleavage but this effect is mitigated by Protein S (Norstrom et al. 2006). A mutation of the APC cleavage sites in Fv at Arg-534Gln a.k.a. FVLeiden is the most common identifiable hereditary risk factor for venous thrombosis among Caucasians (Camire 2011).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-5605103"
],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-141026",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141026"
}
]
},
{
"id": "R-HSA-141040",
"name": "Activated thrombin:thrombomodulin cleaves PROCR:Protein C to PROCR:Activated protein C",
"equation": "",
"summary": "Thrombin complexed with thrombomodulin at the endothelial cell surface cleaves the heavy chain of protein C, generating activated protein C and an activation peptide. The activation peptide has no known function.",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1",
"P00734-1"
],
"evidence": [
{
"id": "R-HSA-141040",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141040"
}
]
},
{
"id": "R-HSA-158137",
"name": "factor VIII:von Willibrand factor multimer -> factor VIIIa + factor VIIIa B A3 acidic polypeptide + von Willibrand factor multimer",
"equation": "",
"summary": "Factor VIII complexed to von Willibrand factor in the blood is cleaved into several smaller polypeptides that remain associated. The acidic polypeptide on the aminoterminal side of the A3 domain of the light chain is released, however, and as this polypeptide mediates the association of factor VIII with von Willibrand factor, the activated factor VIII is released. While several proteases are capable of catalyzing these cleavages in vitro, only thrombin is active on factor VIII:von Willibrand factor complexes under physiological conditions (Eaton et al. 1986; Hill-Eubanks et al. 1989; Lollar et al. 1988; Pieters et al. 1989).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1",
"P00734-1"
],
"evidence": [
{
"id": "R-HSA-158137",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158137"
}
]
},
{
"id": "R-HSA-158419",
"name": "factor XI:platelet glycoprotein (GP) Ib:IX:V complex -> factor XIa:platelet glycoprotein (GP) Ib:IX:V complex (thrombin catalyst)",
"equation": "",
"summary": "Factor XI, bound to the cell surface, is converted to activated factor XI (factor XIa). In the body, this reaction occurs on the surfaces of activated platelets (Baglia et al. 2002). Small quantities of factor XI can be activated in a reaction catalyzed by factor XIIa, to initiate formation of a fibrin clot. However, the efficient activation of larger quantities of factor XI, needed to propagate the blood clotting process, appears to be mediated by thrombin (Baglia and Walsh 2000; Gailani and Broze 1993; Naito and Fujikawa 1991; Oliver et al. 1999; Monroe et al. 2002).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1",
"P00734-1",
"P03951-1"
],
"evidence": [
{
"id": "R-HSA-158419",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158419"
}
]
},
{
"id": "R-HSA-159762",
"name": "Gamma-carboxy pro-protein C transport from the endoplasmic reticulum to the Golgi apparatus",
"equation": "",
"summary": "Gamma-carboxylated pro-protein C is transported from the endoplasmic reticulum to the Golgi apparatus (Kirchhausen 2000).",
"cellular_location": "COPII-coated ER to Golgi transport vesicle, Golgi lumen, endoplasmic reticulum lumen",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-159762",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159762"
}
]
},
{
"id": "R-HSA-159771",
"name": "Furin cleaves pro-protein C to protein C",
"equation": "",
"summary": "Furin, associated with the Golgi membrane, cleaves pro-protein C to form mature, gamma-carboxylated protein C (Wasley et al. 1993).",
"cellular_location": "Golgi lumen, Golgi membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P09958-1",
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-159771",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159771"
}
]
},
{
"id": "R-HSA-159795",
"name": "GGCX gamma-carboxylates 3D-PROC(33-197) (pro-protein C light chain)",
"equation": "",
"summary": "GGCX (gamma glutamyl carboxylase) in the endoplasmic reticulum gamma-carboxylates eight glutamate residues on 3D-PROC(33-197) (pro-protein C light chain). MK4 (vitamin K hydroquinone) is oxidized to MK4 epoxide in the process (Berkner 2000; Furie et al. 1999; Stenina et al. 2001; Morris et al. 1995).",
"cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1",
"P38435-1"
],
"evidence": [
{
"id": "R-HSA-159795",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159795"
}
]
},
{
"id": "R-HSA-5591040",
"name": "Activated protein C cleaves Factor Va intermediate form for Factor Va",
"equation": "",
"summary": "Protein C is best known for its anticoagulant activity, the proteolytic inactivation of FVa and FVIIIa on negatively charged phospholipid membranes. This is enhanced by cofactors protein S and FV (Rosing et al. 1995, Norstrom et al. 2006). Inactivation of FVa involves APC-mediated cleavages at Arg306 and Arg506. The rapid cleavage at Arg506 is kinetically favored over cleavage at Arg306, but results only in partial inactivation of FVa, whereas the slower cleavage at Arg306 results in a complete loss of FVa function (Kalafatis et al. 1994, Nicolaes et al. 1995). Protein S accelerates factor Va inactivation by selectively promoting the slow cleavage at Arg306 (Rosing et al. 1995). A mutation of the APC cleavage sites in FV Arg506Gln a.k.a. FVLeiden is the most common identifiable hereditary risk factor for venous thrombosis among Caucasians (Camire 2011). APC also has a role in the inactivation of FVIIIa (Regan et al. 1994). Similar to FVa inactivation, FVIIIa is cleaved by APC at Arg336 in the A1 subunit and at Arg562 in the A2 subunit, with either resulting in a complete loss of cofactor activity (O'Brien et al. 2000, Manithody et al. 2003). Both protein S and FV but not FVa enhance inactivation of FVIIIa by APC (O'Brien et al. 2000,57). By acting on FVa and FVIIIa Protein C down-regulates both primary and secondary thrombin formation, delaying clot formation and diminishing activation of TAFI, enhanced susceptibility of the clot to fibrinolysis, respectively. The latter effects of APC on secondary thrombin formation is sometimes referred to as APC\u2019s profibrinolytic effect (Bajzar et al. 1996).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5591040",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5591040"
}
]
},
{
"id": "R-HSA-5591052",
"name": "PROCR binds Protein C",
"equation": "",
"summary": "Physiological activation of protein C on the endothelial cell surface requires the binding of protein C to the endothelial protein C receptor PROCR (EPCR) as well as binding of thrombin to thrombomodulin (TM) (Stavenuiter et al. 2013). PROCR binding to protein C (Fukudome & Esmon 1994) augments by at least 5-fold the effect of thrombin-thrombomodulin on the rate of protein C activation (Stearns-Kurosawa et al. 1996, Taylor et al. 2001).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5591052",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5591052"
}
]
},
{
"id": "R-HSA-5591086",
"name": "SERPINA5 binds activated protein C",
"equation": "",
"summary": "SERPINA5, also called Plasma serine protease inhibitor or Protein C inhibitor, inactivates serine proteases by binding irreversibly to their serine activation site. It is involved in the regulation of intravascular and extravascular proteolytic activities, promoting coagulation by inhibiting the anticoagulant complex Activated protein C (APC), but also acts as an anticoagulant factor by inhibiting blood coagulation factors such as prothrombin, factor XI, factor Xa, plasma kallikrein and fibrinolytic enzymes such as tissue- and urinary-type plasminogen activators. Its inhibitory activity is greatly enhanced in the presence of glycosaminoglycans (GAGs), heparin, thrombomodulin and phospholipids vesicles (Suzuki et al. 1985).
SERPINA5 inhibits activated protein C In the blood plasma and inhibits thromibin as part of the thrombin:thrombomodulin complex (Rezaie et al. 1995). On the other hand, PCI can also inhibit coagulation factors (Radtke et al. 2007). The SERPINA5:APC complex is a marker of thrombotic events (Kolbel et al. 2006), which suggests that despite low circulating SERPINA5 concentrations and rates of APC inhibition, its predominant role is procoagulatory (Li & Huntington 2008). This is due to the enhancing effect of GAGs, which line the vascular endothelium. Both SERPINA5 and APC bind to GAGs. The presence of heparin in vitro accelerates the maximal rate of inhibition by over 2000-fold (when accounting for dissociation constants) (Yang et al. 2002).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5591086",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5591086"
}
]
},
{
"id": "R-HSA-5603467",
"name": "Activated protein C is released from PROCR",
"equation": "",
"summary": "Activated protein C (APC) can either dissociate from PROCR to exert its anticoagulant activity, or remain bound to PROCR where it influences multiple direct cellular activities. Dissociation of APC from PROCR allows APC to associate with other cell membrane surface molecules, various microparticles, or lipoproteins (e.g., high-density lipoprotein). As an anticoagulant, APC cleaves the activated cofactors Va (fVa) and VIIIa (fVIIIa), yielding inactivated cofactors, fVi and fVIIIi. This proteolytic inactivation is enhanced by protein cofactors (e.g., protein S, factor V) and lipids cofactors (e.g., phosphatidylserine, cardiolipin, glucosylceramide, or HDL).",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5603467",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5603467"
}
]
},
{
"id": "R-HSA-5604929",
"name": "Activated protein C binds Protein S",
"equation": "",
"summary": "Activated protein C binds to Protein S on appropriate cell surfaces where it inactivates factors Va and VIIIa.
Protein S is best known as a cofactor for the Activated protein C (APC)-catalyzed inactivation of factor Va (Walker 1980). Protein S must be membrane-bound to display this cofactor activity (Hackeng et al. 1993). Protein S binding brings the active site of APC closer to the phospholipid cell surface (Yegneswaran et al. 1999).
APC proteolysis involves cleavage of the factor Va heavy chain at Arg-306 and Arg-506 (Nicolaes et al. 1985). Most factor Va molecules are initially cleaved at Arg506, yielding a partially active intermediate, followed by complete inactivation through cleavage at Arg306 (Kalafatis et al. 1994). Protein S stimulates the cleavage at Arg306 ~20-fold (Rosing et al. 1995) and also counteracts the protective effect of factor Xa on Arg506 cleavage (Norstrom et al. 2006).
Protein S also enhances the APC-mediated inactivation of factor VIIIa (van de Poel et al. 2001). Protein S and factor V act as synergistic cofactors in the APC-mediated inactivation of factor VIIIa (Shen & Dahlback 1994, Somajo et al. 2014).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5604929",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5604929"
}
]
},
{
"id": "R-HSA-5606996",
"name": "Soluble PROCR binds activated protein C",
"equation": "",
"summary": "A soluble form of PROCR (sEPCR) fully retains the ability to bind Protein C and Activated protein C (Kurosawa et al. 1997). This form increases up to 5-fold in patients with sepsis or systemic lupus erythematosus (Kurosawa et al. 1998), either from vascular injury or through a regulated proteolytic release of soluble receptor (Gu et al. 2000). sEPCR inhibits protein C activation over large vessel endothelium in culture, reflecting competition between the soluble and cell surface forms of PROCR (Liaw et al. 2000).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5606996",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5606996"
}
]
},
{
"id": "R-HSA-5607002",
"name": "Activated protein C cleaves factor VIIIa",
"equation": "",
"summary": "Activated Protein C (APC) is best known for its anticoagulant activity, the proteolytic inactivation of FVa and FVIIIa on negatively charged phospholipid membranes. This is enhanced by cofactors protein S and factor V (Rosing et al. 1995, Norstrom et al. 2006).
APC inactivates FVIIIa (Regan et al. 1994) with a mechanism similar to its inactivation of FVa. FVIIIa is cleaved by APC at Arg355 (336 if numbering excludes signal peptide) in the A1 subunit and at Arg581 (562 if numbering excludes signal peptide) in the A2 subunit (O'Brien et al. 2000, Manithody et al. 2003). The Arg355 cleavage is 6-fold faster than the Arg581 cleavage but does not fully inactivate factor VIIIa if dissociation of the A2 subunit is blocked (Gale et al. 2008). Protein S and Factor V (but not FVa) enhance the inactivation of FVIIIa by APC (O'Brien et al. 2000). Protein S and factor V both enhance cleavage at both sites, more so at Arg581 (Gale et al. 2008).
The A2 subunit of FVIIIa spontaneously dissociates, inactivating FVIIIa with a half-life of about 2 min (Fay et al. 1991).
By acting on FVa and FVIIIa Protein C down-regulates both primary and secondary thrombin formation, delaying clot formation and diminishing activation of TAFI, enhanced susceptibility of the clot to fibrinolysis, respectively. The latter effects of APC on secondary thrombin formation is sometimes referred to as APC\u2019s profibrinolytic effect (Bajzar et al. 1996).",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-5606999",
"R-HSA-5607008"
],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5607002",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607002"
}
]
},
{
"id": "R-HSA-5607058",
"name": "Activated protein C:PROCR binds F2R",
"equation": "",
"summary": "F2R (PAR1) mediates multiple cytoprotective effects of Activated protein C (APC) (Riewald et al. 2002, Griffin et al. 2007). In most, but not all, reported studies of APC\u2019s beneficial effects on endothelial cells, the cellular receptors EPCR and F2R are required. These cytoprotective effects include anti-apoptotic activities, anti-inflammatory activities, protection of endothelial barrier functions, and favorable alteration of gene expression profiles. This paradigm in which EPCR-bound APC activates F2R to initiate signaling is consistent with many in vitro and in vivo data. Localization of APC signaling to caveolin-1-rich microdomains (caveolae) may help differentiate mechanisms for cytoprotective APC signaling versus proinflammatory thrombin signaling. Additional mechanisms for APC effects on cells may involve other receptors. These effects include APC anti-inflammatory effects on leukocytes or cytoprotective effects on dendritic cells and neurons. Other receptors may include F2RL2 (PAR3), various integrins e.g., Mac-1 (CD11b/CD18), Beta-1 integrins, Beta-3 integrins, S1P1, or the apolipoprotein E receptor 2 (LRP8) (Mosnier et al. 2007).",
"cellular_location": "plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P04070-1"
],
"evidence": [
{
"id": "R-HSA-5607058",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607058"
}
]
},
{
"id": "R-HSA-8952289",
"name": "FAM20C phosphorylates FAM20C substrates",
"equation": "",
"summary": "Extracellular serine/threonine protein kinase FAM20C is an extracellular kinase that can phosphorylate a broad range of secreted protein. FAM20C is bound and allosterically activated by the pseudokinase FAM20A (Tagliabracchi et al. 2012, 2015, Cui et al. 2015).
Loss of function mutations in Fam20C cause Raine Syndrome, an osteosclerotic bone dysplasia (Faundes et al. 2014).",
"cellular_location": "endoplasmic reticulum lumen",
"input_participant_list": [
"R-ALL-8931885"
],
"output_participant_list": [
"R-ALL-8931884"
],
"enzyme_list": [
"Q6P988-1",
"P07237-1",
"O14672-1",
"Q8NBP7-1",
"Q8IXL6-1",
"P00450-1",
"P04070-1",
"Q9BTY2-1",
"Q96AD5-1",
"Q14703-1",
"Q9UM21-1",
"Q15084-1",
"O95084-1",
"O00391-1"
],
"evidence": [
{
"id": "R-HSA-8952289",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952289"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-8931884",
"participant_name": "ADP [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "C00008",
"database": "COMPOUND",
"url": ""
},
{
"id": "456216",
"database": "ChEBI",
"url": ""
},
{
"id": "000012360703",
"database": "ZINC",
"url": ""
},
{
"id": "C00008",
"database": "COMPOUND",
"url": ""
},
{
"id": "000012360703",
"database": "ZINC",
"url": ""
},
{
"id": "456216",
"database": "ChEBI",
"url": ""
},
{
"id": "456216",
"database": "ChEBI",
"url": ""
},
{
"id": "C00008",
"database": "COMPOUND",
"url": ""
},
{
"id": "000012360703",
"database": "ZINC",
"url": ""
},
{
"id": "C00008",
"database": "COMPOUND",
"url": ""
},
{
"id": "456216",
"database": "ChEBI",
"url": ""
},
{
"id": "000012360703",
"database": "ZINC",
"url": ""
},
{
"id": "C00008",
"database": "COMPOUND",
"url": ""
},
{
"id": "456216",
"database": "ChEBI",
"url": ""
},
{
"id": "000012360703",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-8931885",
"participant_name": "ATP [endoplasmic reticulum lumen]",
"crossref": [
{
"id": "30616",
"database": "ChEBI",
"url": ""
},
{
"id": "C00002",
"database": "COMPOUND",
"url": ""
},
{
"id": "000004261765",
"database": "ZINC",
"url": ""
},
{
"id": "C00002",
"database": "COMPOUND",
"url": ""
},
{
"id": "30616",
"database": "ChEBI",
"url": ""
},
{
"id": "000004261765",
"database": "ZINC",
"url": ""
},
{
"id": "C00002",
"database": "COMPOUND",
"url": ""
},
{
"id": "30616",
"database": "ChEBI",
"url": ""
},
{
"id": "000004261765",
"database": "ZINC",
"url": ""
},
{
"id": "000004261765",
"database": "ZINC",
"url": ""
},
{
"id": "C00002",
"database": "COMPOUND",
"url": ""
},
{
"id": "30616",
"database": "ChEBI",
"url": ""
},
{
"id": "30616",
"database": "ChEBI",
"url": ""
},
{
"id": "000004261765",
"database": "ZINC",
"url": ""
},
{
"id": "C00002",
"database": "COMPOUND",
"url": ""
}
]
},
{
"participant_id": "R-HSA-114618",
"participant_name": "Fibrinogen [extracellular region]",
"crossref": [
{
"id": "CPX-1922",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140586",
"participant_name": "fibrin monomer [extracellular region]",
"crossref": [
{
"id": "CPX-6225",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140692",
"participant_name": "factor Va [extracellular region]",
"crossref": [
{
"id": "CPX-6216",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140697",
"participant_name": "factor V [extracellular region]",
"crossref": [
{
"id": "P12259",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000198734-F5",
"database": "HPA",
"url": ""
},
{
"id": "P12259",
"database": "PRO",
"url": ""
},
{
"id": "P12259",
"database": "ZINC target",
"url": ""
},
{
"id": "HMDBP02118",
"database": "HMDB Protein",
"url": ""
},
{
"id": "3P6Z",
"database": "PDB",
"url": ""
},
{
"id": "7TPP",
"database": "PDB",
"url": ""
},
{
"id": "NP_000121.2",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000367797",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000356771",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "Ensembl",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "2606",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "OpenTargets",
"url": ""
},
{
"id": "1CZV",
"database": "PDB",
"url": ""
},
{
"id": "7KXY",
"database": "PDB",
"url": ""
},
{
"id": "16014",
"database": "Orphanet",
"url": ""
},
{
"id": "P12259",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "8FDG",
"database": "PDB",
"url": ""
},
{
"id": "1CZT",
"database": "PDB",
"url": ""
},
{
"id": "7KVF",
"database": "PDB",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "7TPQ",
"database": "PDB",
"url": ""
},
{
"id": "7KVE",
"database": "PDB",
"url": ""
},
{
"id": "1CZS",
"database": "PDB",
"url": ""
},
{
"id": "3P70",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "GeneCards",
"url": ""
},
{
"id": "3S9C",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140787",
"participant_name": "factor V activation peptide [extracellular region]",
"crossref": [
{
"id": "2606",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "7KVF",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02118",
"database": "HMDB Protein",
"url": ""
},
{
"id": "16014",
"database": "Orphanet",
"url": ""
},
{
"id": "1CZS",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000367797",
"database": "Ensembl",
"url": ""
},
{
"id": "P12259",
"database": "GeneCards",
"url": ""
},
{
"id": "1CZV",
"database": "PDB",
"url": ""
},
{
"id": "7TPP",
"database": "PDB",
"url": ""
},
{
"id": "7TPQ",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "PRO",
"url": ""
},
{
"id": "8FDG",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "Ensembl",
"url": ""
},
{
"id": "P12259",
"database": "UniProt",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1CZT",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "ZINC target",
"url": ""
},
{
"id": "7KVE",
"database": "PDB",
"url": ""
},
{
"id": "NP_000121.2",
"database": "RefSeq",
"url": ""
},
{
"id": "7KXY",
"database": "PDB",
"url": ""
},
{
"id": "3S9C",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "OpenTargets",
"url": ""
},
{
"id": "3P6Z",
"database": "PDB",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSG00000198734-F5",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000356771",
"database": "Ensembl",
"url": ""
},
{
"id": "3P70",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "Pharos - Targets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140867",
"participant_name": "FGA(20-35) [extracellular region]",
"crossref": [
{
"id": "2XNY",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000651975",
"database": "Ensembl",
"url": ""
},
{
"id": "1RF0",
"database": "PDB",
"url": ""
},
{
"id": "2HPC",
"database": "PDB",
"url": ""
},
{
"id": "2HOD",
"database": "PDB",
"url": ""
},
{
"id": "1RF1",
"database": "PDB",
"url": ""
},
{
"id": "4F27",
"database": "PDB",
"url": ""
},
{
"id": "2OYI",
"database": "PDB",
"url": ""
},
{
"id": "3HUS",
"database": "PDB",
"url": ""
},
{
"id": "1FZC",
"database": "PDB",
"url": ""
},
{
"id": "1RE3",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000385981",
"database": "Ensembl",
"url": ""
},
{
"id": "1LTJ",
"database": "PDB",
"url": ""
},
{
"id": "3AT0",
"database": "PDB",
"url": ""
},
{
"id": "P02671",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000171560",
"database": "Ensembl",
"url": ""
},
{
"id": "3GHG",
"database": "PDB",
"url": ""
},
{
"id": "2HLO",
"database": "PDB",
"url": ""
},
{
"id": "1YCP",
"database": "PDB",
"url": ""
},
{
"id": "1LT9",
"database": "PDB",
"url": ""
},
{
"id": "2A45",
"database": "PDB",
"url": ""
},
{
"id": "NP_000499.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1FZE",
"database": "PDB",
"url": ""
},
{
"id": "1DM4",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000171560",
"database": "OpenTargets",
"url": ""
},
{
"id": "2Z4E",
"database": "PDB",
"url": ""
},
{
"id": "2FFD",
"database": "PDB",
"url": ""
},
{
"id": "2Q9I",
"database": "PDB",
"url": ""
},
{
"id": "3H32",
"database": "PDB",
"url": ""
},
{
"id": "1FZD",
"database": "PDB",
"url": ""
},
{
"id": "3E1I",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000498441",
"database": "Ensembl",
"url": ""
},
{
"id": "1N86",
"database": "PDB",
"url": ""
},
{
"id": "3BVH",
"database": "PDB",
"url": ""
},
{
"id": "P02671",
"database": "PRO",
"url": ""
},
{
"id": "2H43",
"database": "PDB",
"url": ""
},
{
"id": "16040",
"database": "Orphanet",
"url": ""
},
{
"id": "5CFA",
"database": "PDB",
"url": ""
},
{
"id": "1FZB",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000403106",
"database": "Ensembl",
"url": ""
},
{
"id": "P02671",
"database": "UniProt",
"url": ""
},
{
"id": "2XNX",
"database": "PDB",
"url": ""
},
{
"id": "1FZF",
"database": "PDB",
"url": ""
},
{
"id": "1N8E",
"database": "PDB",
"url": ""
},
{
"id": "P02671",
"database": "GeneCards",
"url": ""
},
{
"id": "1BBR",
"database": "PDB",
"url": ""
},
{
"id": "1FZG",
"database": "PDB",
"url": ""
},
{
"id": "1FZA",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP13512",
"database": "HMDB Protein",
"url": ""
},
{
"id": "NP_068657.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1FPH",
"database": "PDB",
"url": ""
},
{
"id": "1RE4",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000171560-FGA",
"database": "HPA",
"url": ""
},
{
"id": "2OYH",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-140876",
"participant_name": "FGB(31-44) [extracellular region]",
"crossref": [
{
"id": "1N86",
"database": "PDB",
"url": ""
},
{
"id": "NP_005132.2",
"database": "RefSeq",
"url": ""
},
{
"id": "1FZA",
"database": "PDB",
"url": ""
},
{
"id": "2H43",
"database": "PDB",
"url": ""
},
{
"id": "1RE4",
"database": "PDB",
"url": ""
},
{
"id": "1FZG",
"database": "PDB",
"url": ""
},
{
"id": "2A45",
"database": "PDB",
"url": ""
},
{
"id": "3GHG",
"database": "PDB",
"url": ""
},
{
"id": "6BIL",
"database": "PDB",
"url": ""
},
{
"id": "3E1I",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000171564",
"database": "Ensembl",
"url": ""
},
{
"id": "2Z4E",
"database": "PDB",
"url": ""
},
{
"id": "6V15",
"database": "PDB",
"url": ""
},
{
"id": "1FZF",
"database": "PDB",
"url": ""
},
{
"id": "1RE3",
"database": "PDB",
"url": ""
},
{
"id": "1LTJ",
"database": "PDB",
"url": ""
},
{
"id": "6ATZ",
"database": "PDB",
"url": ""
},
{
"id": "1RF1",
"database": "PDB",
"url": ""
},
{
"id": "P02675",
"database": "UniProt",
"url": ""
},
{
"id": "6V0Y",
"database": "PDB",
"url": ""
},
{
"id": "6V18",
"database": "PDB",
"url": ""
},
{
"id": "1FZB",
"database": "PDB",
"url": ""
},
{
"id": "2HLO",
"database": "PDB",
"url": ""
},
{
"id": "NP_001171670.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1N8E",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP13514",
"database": "HMDB Protein",
"url": ""
},
{
"id": "6V19",
"database": "PDB",
"url": ""
},
{
"id": "1LT9",
"database": "PDB",
"url": ""
},
{
"id": "1FZE",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000306099",
"database": "Ensembl",
"url": ""
},
{
"id": "3BVH",
"database": "PDB",
"url": ""
},
{
"id": "6V13",
"database": "PDB",
"url": ""
},
{
"id": "3H32",
"database": "PDB",
"url": ""
},
{
"id": "6V1A",
"database": "PDB",
"url": ""
},
{
"id": "6BIJ",
"database": "PDB",
"url": ""
},
{
"id": "3HUS",
"database": "PDB",
"url": ""
},
{
"id": "1RF0",
"database": "PDB",
"url": ""
},
{
"id": "16041",
"database": "Orphanet",
"url": ""
},
{
"id": "ENST00000302068",
"database": "Ensembl",
"url": ""
},
{
"id": "2XNX",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000171564",
"database": "OpenTargets",
"url": ""
},
{
"id": "P02675",
"database": "GeneCards",
"url": ""
},
{
"id": "2HPC",
"database": "PDB",
"url": ""
},
{
"id": "P02675",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "P02675",
"database": "PRO",
"url": ""
},
{
"id": "1FZC",
"database": "PDB",
"url": ""
},
{
"id": "2XNY",
"database": "PDB",
"url": ""
},
{
"id": "2OYH",
"database": "PDB",
"url": ""
},
{
"id": "2Q9I",
"database": "PDB",
"url": ""
},
{
"id": "2FFD",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000171564-FGB",
"database": "HPA",
"url": ""
},
{
"id": "2OYI",
"database": "PDB",
"url": ""
},
{
"id": "2HOD",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5605103",
"participant_name": "F5(535-737) [extracellular region]",
"crossref": [
{
"id": "7KXY",
"database": "PDB",
"url": ""
},
{
"id": "7KVE",
"database": "PDB",
"url": ""
},
{
"id": "NP_000121.2",
"database": "RefSeq",
"url": ""
},
{
"id": "P12259",
"database": "ZINC target",
"url": ""
},
{
"id": "1CZT",
"database": "PDB",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENSG00000198734-F5",
"database": "HPA",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "OpenTargets",
"url": ""
},
{
"id": "FA5_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3P6Z",
"database": "PDB",
"url": ""
},
{
"id": "3P70",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000356771",
"database": "Ensembl",
"url": ""
},
{
"id": "P12259",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "3S9C",
"database": "PDB",
"url": ""
},
{
"id": "1CZV",
"database": "PDB",
"url": ""
},
{
"id": "7TPP",
"database": "PDB",
"url": ""
},
{
"id": "7TPQ",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "PRO",
"url": ""
},
{
"id": "8FDG",
"database": "PDB",
"url": ""
},
{
"id": "P12259",
"database": "GeneCards",
"url": ""
},
{
"id": "ENSG00000198734",
"database": "Ensembl",
"url": ""
},
{
"id": "P12259",
"database": "UniProt",
"url": ""
},
{
"id": "16014",
"database": "Orphanet",
"url": ""
},
{
"id": "ENST00000367797",
"database": "Ensembl",
"url": ""
},
{
"id": "1CZS",
"database": "PDB",
"url": ""
},
{
"id": "2606",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "HMDBP02118",
"database": "HMDB Protein",
"url": ""
},
{
"id": "7KVF",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5606999",
"participant_name": "F8(356-372) [extracellular region]",
"crossref": [
{
"id": "ENSP00000353393",
"database": "Ensembl",
"url": ""
},
{
"id": "3HNY",
"database": "PDB",
"url": ""
},
{
"id": "3CDZ",
"database": "PDB",
"url": ""
},
{
"id": "6MF0",
"database": "PDB",
"url": ""
},
{
"id": "8G6I",
"database": "PDB",
"url": ""
},
{
"id": "3HNB",
"database": "PDB",
"url": ""
},
{
"id": "4BDV",
"database": "PDB",
"url": ""
},
{
"id": "4PT6",
"database": "PDB",
"url": ""
},
{
"id": "3HOB",
"database": "PDB",
"url": ""
},
{
"id": "1CFG",
"database": "PDB",
"url": ""
},
{
"id": "FA8_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "5K8D",
"database": "PDB",
"url": ""
},
{
"id": "2607",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "16016",
"database": "Orphanet",
"url": ""
},
{
"id": "3J2S",
"database": "PDB",
"url": ""
},
{
"id": "NP_000123.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P00451",
"database": "GeneCards",
"url": ""
},
{
"id": "ENST00000330287",
"database": "Ensembl",
"url": ""
},
{
"id": "P00451",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "4XZU",
"database": "PDB",
"url": ""
},
{
"id": "P00451",
"database": "UniProt",
"url": ""
},
{
"id": "HMDBP01727",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000185010",
"database": "Ensembl",
"url": ""
},
{
"id": "P00451",
"database": "ZINC target",
"url": ""
},
{
"id": "7K66",
"database": "PDB",
"url": ""
},
{
"id": "1D7P",
"database": "PDB",
"url": ""
},
{
"id": "2R7E",
"database": "PDB",
"url": ""
},
{
"id": "1FAC",
"database": "PDB",
"url": ""
},
{
"id": "7KBT",
"database": "PDB",
"url": ""
},
{
"id": "4KI5",
"database": "PDB",
"url": ""
},
{
"id": "FA8_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P00451",
"database": "PRO",
"url": ""
},
{
"id": "1IQD",
"database": "PDB",
"url": ""
},
{
"id": "7KWO",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000185010-F8",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000327895",
"database": "Ensembl",
"url": ""
},
{
"id": "6MF2",
"database": "PDB",
"url": ""
},
{
"id": "NP_063916.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000360256",
"database": "Ensembl",
"url": ""
},
{
"id": "3J2Q",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000185010",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5607008",
"participant_name": "F8(582-640) [extracellular region]",
"crossref": [
{
"id": "7KBT",
"database": "PDB",
"url": ""
},
{
"id": "1FAC",
"database": "PDB",
"url": ""
},
{
"id": "2R7E",
"database": "PDB",
"url": ""
},
{
"id": "FA8_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "4KI5",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP01727",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000185010",
"database": "Ensembl",
"url": ""
},
{
"id": "P00451",
"database": "ZINC target",
"url": ""
},
{
"id": "1D7P",
"database": "PDB",
"url": ""
},
{
"id": "7K66",
"database": "PDB",
"url": ""
},
{
"id": "NP_063916.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000360256",
"database": "Ensembl",
"url": ""
},
{
"id": "3J2Q",
"database": "PDB",
"url": ""
},
{
"id": "6MF2",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000185010",
"database": "OpenTargets",
"url": ""
},
{
"id": "P00451",
"database": "PRO",
"url": ""
},
{
"id": "1IQD",
"database": "PDB",
"url": ""
},
{
"id": "7KWO",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000185010-F8",
"database": "HPA",
"url": ""
},
{
"id": "ENSP00000327895",
"database": "Ensembl",
"url": ""
},
{
"id": "P00451",
"database": "UniProt",
"url": ""
},
{
"id": "4BDV",
"database": "PDB",
"url": ""
},
{
"id": "4PT6",
"database": "PDB",
"url": ""
},
{
"id": "3HOB",
"database": "PDB",
"url": ""
},
{
"id": "3HNB",
"database": "PDB",
"url": ""
},
{
"id": "1CFG",
"database": "PDB",
"url": ""
},
{
"id": "6MF0",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000353393",
"database": "Ensembl",
"url": ""
},
{
"id": "3HNY",
"database": "PDB",
"url": ""
},
{
"id": "3CDZ",
"database": "PDB",
"url": ""
},
{
"id": "8G6I",
"database": "PDB",
"url": ""
},
{
"id": "FA8_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "5K8D",
"database": "PDB",
"url": ""
},
{
"id": "2607",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "16016",
"database": "Orphanet",
"url": ""
},
{
"id": "3J2S",
"database": "PDB",
"url": ""
},
{
"id": "NP_000123.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P00451",
"database": "GeneCards",
"url": ""
},
{
"id": "ENST00000330287",
"database": "Ensembl",
"url": ""
},
{
"id": "P00451",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "4XZU",
"database": "PDB",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O00391",
"gene_name": "QSOX1",
"activity": [
{
"ec_number": "1.8.3.2",
"activity": "O2 + 2 R'C(R)SH = H2O2 + R'C(R)S-S(R)CR'.",
"evidence": [
{
"id": "O00391",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00391"
}
]
},
{
"ec_number": "1.8.3.2",
"activity": "",
"evidence": [
{
"id": "O00391",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O00391"
}
]
}
]
},
{
"uniprot_ac": "O14672",
"gene_name": "ADAM10",
"activity": [
{
"ec_number": "3.4.24.81",
"activity": "Endopeptidase of broad specificity.",
"evidence": [
{
"id": "O14672",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14672"
}
]
},
{
"ec_number": "3.4.24.81",
"activity": "",
"evidence": [
{
"id": "O14672",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14672"
}
]
}
]
},
{
"uniprot_ac": "O95084",
"gene_name": "PRSS23",
"activity": [
{
"ec_number": "3.4.21.-",
"activity": "",
"evidence": [
{
"id": "O95084",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95084"
}
]
}
]
},
{
"uniprot_ac": "P00450",
"gene_name": "CP",
"activity": [
{
"ec_number": "1.16.3.1",
"activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.",
"evidence": [
{
"id": "P00450",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00450"
}
]
},
{
"ec_number": "1.16.3.1",
"activity": "",
"evidence": [
{
"id": "P00450",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00450"
}
]
}
]
},
{
"uniprot_ac": "P00488",
"gene_name": "F13A1",
"activity": [
{
"ec_number": "2.3.2.13",
"activity": "L-glutaminyl-[protein] + L-lysyl-[protein] = [protein]-L-lysyl-N(6)-5-L-glutamyl-[protein] + NH4(+).",
"evidence": [
{
"id": "P00488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00488"
}
]
},
{
"ec_number": "2.3.2.13",
"activity": "",
"evidence": [
{
"id": "P00488",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00488"
}
]
}
]
},
{
"uniprot_ac": "P00734",
"gene_name": "F2",
"activity": [
{
"ec_number": "3.4.21.5",
"activity": "Selective cleavage of Arg-|-Gly bonds in fibrinogen to form fibrin and release fibrinopeptides A and B.",
"evidence": [
{
"id": "P00734",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00734"
}
]
},
{
"ec_number": "3.4.21.5",
"activity": "",
"evidence": [
{
"id": "P00734",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00734"
}
]
}
]
},
{
"uniprot_ac": "P03951",
"gene_name": "F11",
"activity": [
{
"ec_number": "3.4.21.27",
"activity": "Selective cleavage of Arg-|-Ala and Arg-|-Val bonds in factor IX to form factor IXa.",
"evidence": [
{
"id": "P03951",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03951"
}
]
},
{
"ec_number": "3.4.21.27",
"activity": "",
"evidence": [
{
"id": "P03951",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03951"
}
]
}
]
},
{
"uniprot_ac": "P04070",
"gene_name": "PROC",
"activity": [
{
"ec_number": "3.4.21.69",
"activity": "Degradation of blood coagulation factors Va and VIIIa.",
"evidence": [
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070"
}
]
},
{
"ec_number": "3.4.21.69",
"activity": "",
"evidence": [
{
"id": "P04070",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04070"
}
]
}
]
},
{
"uniprot_ac": "P07237",
"gene_name": "P4HB",
"activity": [
{
"ec_number": "5.3.4.1",
"activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.",
"evidence": [
{
"id": "P07237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07237"
}
]
},
{
"ec_number": "5.3.4.1",
"activity": "",
"evidence": [
{
"id": "P07237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07237"
}
]
}
]
},
{
"uniprot_ac": "P09958",
"gene_name": "FURIN",
"activity": [
{
"ec_number": "3.4.21.75",
"activity": "Release of mature proteins from their proproteins by cleavage of -Arg-Xaa-Yaa-Arg-|-Zaa- bonds, where Xaa can be any amino acid and Yaa is Arg or Lys. Releases albumin, complement component C3 and von Willebrand factor from their respective precursors.",
"evidence": [
{
"id": "P09958",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09958"
}
]
},
{
"ec_number": "3.4.21.75",
"activity": "",
"evidence": [
{
"id": "P09958",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09958"
}
]
}
]
},
{
"uniprot_ac": "P38435",
"gene_name": "GGCX",
"activity": [
{
"ec_number": "4.1.1.90",
"activity": "2,3-epoxyphylloquinone + 4-carboxy-L-glutamyl-[protein] + H(+) + H2O = CO2 + L-glutamyl-[protein] + O2 + phylloquinol.",
"evidence": [
{
"id": "P38435",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P38435"
}
]
},
{
"ec_number": "4.1.1.90",
"activity": "",
"evidence": [
{
"id": "P38435",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P38435"
}
]
}
]
},
{
"uniprot_ac": "Q14703",
"gene_name": "MBTPS1",
"activity": [
{
"ec_number": "3.4.21.112",
"activity": "Processes precursors containing basic and hydrophobic/aliphatic residues at P4 and P2, respectively, with a relatively relaxed acceptance of amino acids at P1 and P3.",
"evidence": [
{
"id": "Q14703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14703"
}
]
},
{
"ec_number": "3.4.21.112",
"activity": "",
"evidence": [
{
"id": "Q14703",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q14703"
}
]
}
]
},
{
"uniprot_ac": "Q15084",
"gene_name": "PDIA6",
"activity": [
{
"ec_number": "5.3.4.1",
"activity": "Catalyzes the rearrangement of -S-S- bonds in proteins.",
"evidence": [
{
"id": "Q15084",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15084"
}
]
},
{
"ec_number": "5.3.4.1",
"activity": "",
"evidence": [
{
"id": "Q15084",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15084"
}
]
}
]
},
{
"uniprot_ac": "Q6P988",
"gene_name": "NOTUM",
"activity": [
{
"ec_number": "3.1.1.98",
"activity": "[Wnt protein]-O-(9Z)-hexadecenoyl-L-serine + H2O = (9Z)-hexadecenoate + [Wnt protein]-L-serine + H(+).",
"evidence": [
{
"id": "Q6P988",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P988"
}
]
},
{
"ec_number": "3.1.1.98",
"activity": "",
"evidence": [
{
"id": "Q6P988",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P988"
}
]
}
]
},
{
"uniprot_ac": "Q8IXL6",
"gene_name": "FAM20C",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q8IXL6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IXL6"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q8IXL6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IXL6"
}
]
}
]
},
{
"uniprot_ac": "Q8NBP7",
"gene_name": "PCSK9",
"activity": [
{
"ec_number": "3.4.21.-",
"activity": "",
"evidence": [
{
"id": "Q8NBP7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NBP7"
}
]
}
]
},
{
"uniprot_ac": "Q96AD5",
"gene_name": "PNPLA2",
"activity": [
{
"ec_number": "3.1.1.4",
"activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).",
"evidence": [
{
"id": "Q96AD5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AD5"
}
]
},
{
"ec_number": "3.1.1.3",
"activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).",
"evidence": [
{
"id": "Q96AD5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AD5"
}
]
},
{
"ec_number": "3.1.1.3",
"activity": "",
"evidence": [
{
"id": "Q96AD5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96AD5"
}
]
}
]
},
{
"uniprot_ac": "Q9BTY2",
"gene_name": "FUCA2",
"activity": [
{
"ec_number": "3.2.1.51",
"activity": "an alpha-L-fucoside + H2O = an alcohol + L-fucose.",
"evidence": [
{
"id": "Q9BTY2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BTY2"
}
]
},
{
"ec_number": "3.2.1.51",
"activity": "",
"evidence": [
{
"id": "Q9BTY2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BTY2"
}
]
}
]
},
{
"uniprot_ac": "Q9UM21",
"gene_name": "MGAT4A",
"activity": [
{
"ec_number": "2.4.1.145",
"activity": "N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP.",
"evidence": [
{
"id": "Q9UM21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UM21"
}
]
},
{
"ec_number": "2.4.1.145",
"activity": "",
"evidence": [
{
"id": "Q9UM21",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UM21"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [
139,
290,
355,
371
],
"o_linked_sites": [
19,
382
],
"snv_sites": [
108,
115,
139,
141,
290,
292,
294,
301,
344,
433,
448
],
"glycation_sites": [],
"phosphorylation_sites": [
347
],
"sequon_annotation_sites": [
{
"start_pos": 139,
"end_pos": 141
},
{
"start_pos": 290,
"end_pos": 292
},
{
"start_pos": 355,
"end_pos": 357
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 78
},
{
"field": "total_sites",
"count": 7
},
{
"field": "n_linked_glycans",
"count": 43
},
{
"field": "n_linked_glycan_sites",
"count": 9
},
{
"field": "o_linked_glycans",
"count": 3
},
{
"field": "o_linked_glycan_sites",
"count": 3
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 5
},
{
"field": "total_sites",
"count": 5
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 4
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 73
},
{
"field": "total_sites",
"count": 7
},
{
"field": "n_linked_glycans",
"count": 43
},
{
"field": "n_linked_glycan_sites",
"count": 5
},
{
"field": "o_linked_glycans",
"count": 3
},
{
"field": "o_linked_glycan_sites",
"count": 2
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 15
},
{
"field": "total_sites",
"count": 11
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 13
},
{
"field": "total_sites",
"count": 9
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 280
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}