{ "uniprot_canonical_ac": "P04004-1", "uniprot_ac": "P04004", "uniprot_id": "VTNC_HUMAN", "mass": { "chemical_mass": 54306.0, "monoisotopic_mass": 54306.0 }, "refseq": { "ac": "NP_000629", "name": "vitronectin precursor", "summary": "The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein. [provided by RefSeq, Aug 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, "gene_names": [ { "name": "VTN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P04004", "id": "P04004" }, { "name": "V75; VN; VNT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629", "id": "NP_000629" }, { "name": "VTN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629", "id": "NP_000629" } ], "protein_names": [ { "name": "Vitronectin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P04004" }, { "name": "S-protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04004" }, { "name": "Serum-spreading factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04004" }, { "name": "V75", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04004" }, { "name": "VN", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P04004" }, { "name": "serum spreading factor; somatomedin B; complement S-protein; epibolin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629", "id": "NP_000629" }, { "name": "vitronectin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629", "id": "NP_000629" } ], "function": [ { "annotation": "Complement Inhibitors Vitronectin and Clusterin Are Recruited from Human Serum to the Surface of Coronavirus OC43-Infected Lung Cells through Antibody-Dependent Mechanisms. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, { "database": "PubMed", "id": "35062233", "url": "https://glygen.org/publication/PubMed/35062233" } ] }, { "annotation": "Correlations between vitronectin, miR-520, and miR-34 in patients with stenosis of coronary arteries.", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, { "database": "PubMed", "id": "34652615", "url": "https://glygen.org/publication/PubMed/34652615" } ] }, { "annotation": "Knockdown of FBLN2 suppresses TGF-beta1-induced MRC-5 cell migration and fibrosis by downregulating VTN.", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, { "database": "PubMed", "id": "36608640", "url": "https://glygen.org/publication/PubMed/36608640" } ] }, { "annotation": "Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#function" } ] }, { "annotation": "The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein. [provided by RefSeq, Aug 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ] }, { "annotation": "Vitronectin and Its Interaction with PAI-1 Suggests a Functional Link to Vascular Changes in AMD Pathobiology. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, { "database": "PubMed", "id": "35681461", "url": "https://glygen.org/publication/PubMed/35681461" } ] }, { "annotation": "Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#function" } ] }, { "annotation": "Vitronectin, a Novel Urinary Proteomic Biomarker, Promotes Cell Pyroptosis in Juvenile Systemic Lupus Erythematosus. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" }, { "database": "PubMed", "id": "35462789", "url": "https://glygen.org/publication/PubMed/35462789" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs781994851", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781994851" }, { "id": "rs781994851", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781994851" }, { "id": "rs781994851", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781994851" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 88, "end_pos": 88, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->NAP); o-glyco-site-loss (T->P).", "chr_id": "17", "chr_pos": "28369774", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T88", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199522124", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199522124" }, { "id": "rs199522124", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199522124" }, { "id": "rs199522124", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199522124" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "28369614", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555583488", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555583488" }, { "id": "rs1555583488", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555583488" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 242, "end_pos": 242, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "17", "chr_pos": "28368973", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N242", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs868950617", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868950617" }, { "id": "rs868950617", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs868950617" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 264, "end_pos": 264, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SYS->NYS).", "chr_id": "17", "chr_pos": "28368907", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S264", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1597810465", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1597810465" }, { "id": "rs1597810465", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1597810465" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 392, "end_pos": 392, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQN->NQT).", "chr_id": "17", "chr_pos": "28367864", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N392", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782448217", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782448217" }, { "id": "rs782448217", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782448217" }, { "id": "rs782448217", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782448217" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 429, "end_pos": 429, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "28367753", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T429", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782678679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782678679" }, { "id": "rs782678679", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782678679" }, { "id": "rs782678679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782678679" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 429, "end_pos": 429, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "17", "chr_pos": "28367754", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T429", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1339986885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1339986885" }, { "id": "rs1339986885", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1339986885#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 433, "end_pos": 433, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IQS->NQS).", "chr_id": "17", "chr_pos": "28367741", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I433", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782332650", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782332650" }, { "id": "rs782332650", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782332650" }, { "id": "rs782332650", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782332650#frequency_tab" }, { "id": "rs782332650", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782332650" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 63, "end_pos": 63, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "28369848", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T63", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs541153221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs541153221" }, { "id": "rs541153221", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs541153221" }, { "id": "rs541153221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs541153221" }, { "id": "rs541153221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs541153221" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "28369830", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T69", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1567802296", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567802296" }, { "id": "rs1567802296", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567802296" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 87, "end_pos": 87, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNA->NNT).", "chr_id": "17", "chr_pos": "28369777", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A87", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs367756510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367756510" }, { "id": "rs367756510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367756510" }, { "id": "rs367756510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs367756510#frequency_tab" }, { "id": "rs367756510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs367756510" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 97, "end_pos": 97, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "28369747", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S97", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes phosphorylation by CK2 and inhibits adhesion and spreading; when associated with A-76.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "E", "comment": "Abolishes phosphorylation by CK2 and enhances adhesion and spreading; when associated with E-76.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] }, { "start_pos": 76, "end_pos": 76, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes phosphorylation by CK2 and inhibits adhesion and spreading; when associated with A-69.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] }, { "start_pos": 76, "end_pos": 76, "sequence_org": "T", "sequence_mut": "E", "comment": "Abolishes phosphorylation by CK2 and enhances adhesion and spreading; when associated with E-69.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "70.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "62.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "60.26", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "72.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "62.31", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "67.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "64.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P04004", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P04004" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "common_name": "Human" } ], "gene": [ { "name": "VTN", "url": "https://www.uniprot.org/uniprot/P04004", "locus": { "chromosome": "17", "start_pos": 28367284, "end_pos": 28373091, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000109072", "url": "https://www.ensembl.org/id/ENSG00000109072" } ] } } ], "crossref": [ { "id": "ENSG00000109072", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109072", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00094", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00094", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1075314", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1075314", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "VTN", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=VTN", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7448", "url": "https://www.ncbi.nlm.nih.gov/gene/7448", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "12724", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12724", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P04004", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04004*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000585", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000585", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001212", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001212", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018486", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018486", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018487", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018487", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036375", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036375", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7448", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7448", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "193190", "url": "http://www.omim.org/entry/193190", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P04004", "url": "https://www.nextprot.org/entry/NX_P04004", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P04004", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04004", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LGTYNYD", "url": "https://omabrowser.org/oma/group/LGTYNYD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5310951at2759", "url": "http://www.orthodb.org/?query=5310951at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22917", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22917", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22917:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22917:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1OC0", "url": "https://www.rcsb.org/structure/1OC0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1S4G", "url": "https://www.rcsb.org/structure/1S4G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SSU", "url": "https://www.rcsb.org/structure/1SSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JQ8", "url": "https://www.rcsb.org/structure/2JQ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BT1", "url": "https://www.rcsb.org/structure/3BT1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BT2", "url": "https://www.rcsb.org/structure/3BT2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K24", "url": "https://www.rcsb.org/structure/4K24", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O5E", "url": "https://www.rcsb.org/structure/6O5E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RJ9", "url": "https://www.rcsb.org/structure/7RJ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00045", "url": "http://pfam.xfam.org/family/PF00045", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01033", "url": "http://pfam.xfam.org/family/PF01033", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P04004", "url": "https://pharos.nih.gov/targets/P04004", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053176", "url": "https://proconsortium.org/app/entry/PR:000053176", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053177", "url": "https://proconsortium.org/app/entry/PR:000053177", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053178", "url": "https://proconsortium.org/app/entry/PR:000053178", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053179", "url": "https://proconsortium.org/app/entry/PR:000053179", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053180", "url": "https://proconsortium.org/app/entry/PR:000053180", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053181", "url": "https://proconsortium.org/app/entry/PR:000053181", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053182", "url": "https://proconsortium.org/app/entry/PR:000053182", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053183", "url": "https://proconsortium.org/app/entry/PR:000053183", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053184", "url": "https://proconsortium.org/app/entry/PR:000053184", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053185", "url": "https://proconsortium.org/app/entry/PR:000053185", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053186", "url": "https://proconsortium.org/app/entry/PR:000053186", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053187", "url": "https://proconsortium.org/app/entry/PR:000053187", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053188", "url": "https://proconsortium.org/app/entry/PR:000053188", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053189", "url": "https://proconsortium.org/app/entry/PR:000053189", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053190", "url": "https://proconsortium.org/app/entry/PR:000053190", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053191", "url": "https://proconsortium.org/app/entry/PR:000053191", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053192", "url": "https://proconsortium.org/app/entry/PR:000053192", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053193", "url": "https://proconsortium.org/app/entry/PR:000053193", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053194", "url": "https://proconsortium.org/app/entry/PR:000053194", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053195", "url": "https://proconsortium.org/app/entry/PR:000053195", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053196", "url": "https://proconsortium.org/app/entry/PR:000053196", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053197", "url": "https://proconsortium.org/app/entry/PR:000053197", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053198", "url": "https://proconsortium.org/app/entry/PR:000053198", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053199", "url": "https://proconsortium.org/app/entry/PR:000053199", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053200", "url": "https://proconsortium.org/app/entry/PR:000053200", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053201", "url": "https://proconsortium.org/app/entry/PR:000053201", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053202", "url": "https://proconsortium.org/app/entry/PR:000053202", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053203", "url": "https://proconsortium.org/app/entry/PR:000053203", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053204", "url": "https://proconsortium.org/app/entry/PR:000053204", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053205", "url": "https://proconsortium.org/app/entry/PR:000053205", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053206", "url": "https://proconsortium.org/app/entry/PR:000053206", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053207", "url": "https://proconsortium.org/app/entry/PR:000053207", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053208", "url": "https://proconsortium.org/app/entry/PR:000053208", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053209", "url": "https://proconsortium.org/app/entry/PR:000053209", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053210", "url": "https://proconsortium.org/app/entry/PR:000053210", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053211", "url": "https://proconsortium.org/app/entry/PR:000053211", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053212", "url": "https://proconsortium.org/app/entry/PR:000053212", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053213", "url": "https://proconsortium.org/app/entry/PR:000053213", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053214", "url": "https://proconsortium.org/app/entry/PR:000053214", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053215", "url": "https://proconsortium.org/app/entry/PR:000053215", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053216", "url": "https://proconsortium.org/app/entry/PR:000053216", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053217", "url": "https://proconsortium.org/app/entry/PR:000053217", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053218", "url": "https://proconsortium.org/app/entry/PR:000053218", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053219", "url": "https://proconsortium.org/app/entry/PR:000053219", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053220", "url": "https://proconsortium.org/app/entry/PR:000053220", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053221", "url": "https://proconsortium.org/app/entry/PR:000053221", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053222", "url": "https://proconsortium.org/app/entry/PR:000053222", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053223", "url": "https://proconsortium.org/app/entry/PR:000053223", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P04004", "url": "http://purl.obolibrary.org/obo/PR_P04004", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P04004", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "F5GX75", "url": "https://www.uniprot.org/uniprot/F5GX75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GX75-1", "url": "https://www.uniprot.org/uniprot/F5GX75-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P04004-1", "url": "https://www.uniprot.org/uniprot/P04004-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL", "length": 478, "header": "sp|P04004-1|VTNC_HUMAN Isoform 1 of Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1 CANONICAL=P04004-1" }, "isoforms": [ { "isoform_ac": "F5GX75-1", "url": "", "sequence": { "sequence": "MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKP", "length": 118, "header": "tr|F5GX75-1|F5GX75_HUMAN Computationally mapped isoform of Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=2 CANONICAL=P04004-1" }, "locus": { "chromosome": "17", "start_pos": 28370203, "end_pos": 28369682, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000542029.1", "url": "https://www.ensembl.org/id/ENST00000542029.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000440439.1", "url": "https://www.ensembl.org/id/ENSP00000440439.1" } ] } }, { "isoform_ac": "P04004-1", "url": "", "sequence": { "sequence": "MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL", "length": 478, "header": "sp|P04004-1|VTNC_HUMAN Isoform 1 of Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1 CANONICAL=P04004-1" }, "locus": { "chromosome": "17", "start_pos": 28370203, "end_pos": 28367372, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000226218.9", "url": "https://www.ensembl.org/id/ENST00000226218.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000226218.4", "url": "https://www.ensembl.org/id/ENSP00000226218.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 100, "start_aa": "Ser", "end_pos": 100, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser100", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 113, "start_aa": "Thr", "end_pos": 113, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr113", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 130, "start_aa": "Ser", "end_pos": 130, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser130", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 141, "start_aa": "Thr", "end_pos": 141, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr141", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 141, "start_aa": "Thr", "end_pos": 141, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr141", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 141, "start_aa": "Thr", "end_pos": 141, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr141", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N169" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N169" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14889WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15683CN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27122CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N169" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G42493LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G44513XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N169" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G58232MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G58802FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004@N169", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N169" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69107AL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83624CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G98425JK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P04004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 171, "start_aa": "Ser", "end_pos": 171, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser171", "evidence": [ { "id": "P04004", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04004" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G08527WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G13661YX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G14572XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G16758MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23010ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G24303GI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G41522EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G58232MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "G90386IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N242", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N242" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P04004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 429, "start_aa": "Thr", "end_pos": 429, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr429", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 63, "start_aa": "Thr", "end_pos": 63, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr63", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "relation": "attached", "comment": "", "start_pos": 85, "start_aa": "Asn", "end_pos": 107, "end_aa": "Lys", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N86" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08527WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N86" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N86" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P04004@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P04004@N86" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25374123", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25374123" }, { "id": "P04004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "id": "17558413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17558413" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "29427759", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" }, { "id": "29427759", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 88, "start_aa": "Thr", "end_pos": 88, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr88", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 88, "start_aa": "Thr", "end_pos": 88, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr88", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 88, "start_aa": "Thr", "end_pos": 88, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr88", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 97, "start_aa": "Ser", "end_pos": 97, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser97", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 97, "start_aa": "Ser", "end_pos": 97, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser97", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 97, "start_aa": "Ser", "end_pos": 97, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser97", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 99, "start_aa": "Thr", "end_pos": 99, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr99", "evidence": [ { "id": "P04004", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G04273XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G06209KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G66665YI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G75850OP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "7541354", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7541354" } ] } ], "phosphorylation": [ { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "site_lbl": "Ser130" }, { "start_pos": 137, "end_pos": 137, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "site_lbl": "Ser137" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "phospho.ELM", "id": "P04004", "url": "http://phospho.elm.eu.org/byAccession/P04004.html" } ], "site_lbl": "Ser171" }, { "start_pos": 312, "end_pos": 312, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "17558413", "url": "https://glygen.org/publication/PubMed/17558413" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "16807684", "url": "https://glygen.org/publication/PubMed/16807684" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" }, { "database": "phospho.ELM", "id": "P04004", "url": "http://phospho.elm.eu.org/byAccession/P04004.html" } ], "site_lbl": "Ser312" }, { "start_pos": 381, "end_pos": 381, "kinase_uniprot_canonical_ac": "P05129-1", "kinase_gene_name": "PRKCG", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9030777", "url": "https://glygen.org/publication/PubMed/9030777" } ], "site_lbl": "Ser381" }, { "start_pos": 381, "end_pos": 381, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9030777", "url": "https://glygen.org/publication/PubMed/9030777" } ], "site_lbl": "Ser381" }, { "start_pos": 381, "end_pos": 381, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9030777", "url": "https://glygen.org/publication/PubMed/9030777" } ], "site_lbl": "Ser381" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "1706595", "url": "https://glygen.org/publication/PubMed/1706595" } ], "site_lbl": "Ser397" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "phospho.ELM", "id": "P04004", "url": "http://phospho.elm.eu.org/byAccession/P04004.html" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "1696913", "url": "https://glygen.org/publication/PubMed/1696913" }, { "database": "PubMed", "id": "2448300", "url": "https://glygen.org/publication/PubMed/2448300" } ], "site_lbl": "Ser397" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ], "site_lbl": "Thr69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CK2; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "phospho.ELM", "id": "P04004", "url": "http://phospho.elm.eu.org/byAccession/P04004.html" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ], "site_lbl": "Thr69" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ], "site_lbl": "Thr76" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CK2; in vitro", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "phospho.ELM", "id": "P04004", "url": "http://phospho.elm.eu.org/byAccession/P04004.html" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ], "site_lbl": "Thr76" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "The integrin alpha v beta 6 binds and activates latent TGF beta 1: a mechanism for regulating pulmonary inflammation and fibrosis.", "journal": "Cell", "date": "1999", "authors": "Munger JS, Huang X, Kawakatsu H, Griffiths MJ, Dalton SL, Wu J, Pittet JF, Kaminski N, Garat C, Matthay MA, Rifkin DB, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10025398", "url": "https://glygen.org/publication/PubMed/10025398" } ] }, { "title": "The integrin alpha9beta1 mediates adhesion to activated endothelial cells and transendothelial neutrophil migration through interaction with vascular cell adhesion molecule-1.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Taooka Y, Chen J, Yednock T, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10209034", "url": "https://glygen.org/publication/PubMed/10209034" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Alpha 2 beta 1 integrin mediates dermal fibroblast attachment to type VII collagen via a 158-amino-acid segment of the NC1 domain.", "journal": "Experimental cell research", "date": "1999", "authors": "Chen M, O'Toole EA, Li YY, Woodley DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10366422", "url": "https://glygen.org/publication/PubMed/10366422" } ] }, { "title": "Ultrastructural distribution of 36-kD microfibril-associated glycoprotein (MAGP-36) in human and bovine tissues.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1999", "authors": "Toyoshima T, Yamashita K, Furuichi H, Shishibori T, Itano T, Kobayashi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10424889", "url": "https://glygen.org/publication/PubMed/10424889" } ] }, { "title": "The leukocyte integrin alpha D beta 2 binds VCAM-1: evidence for a binding interface between I domain and VCAM-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Van der Vieren M, Crowe DT, Hoekstra D, Vazeux R, Hoffman PA, Grayson MH, Bochner BS, Gallatin WM, Staunton DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10438935", "url": "https://glygen.org/publication/PubMed/10438935" } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "Characteristics of fibrinogen binding to the domain of CD11c, an alpha subunit of p150,95.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10543983", "url": "https://glygen.org/publication/PubMed/10543983" } ] }, { "title": "Tropoelastin binding to fibulins, nidogen-2 and other extracellular matrix proteins.", "journal": "FEBS letters", "date": "1999", "authors": "Sasaki T, Gohring W, Miosge N, Abrams WR, Rosenbloom J, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10544250", "url": "https://glygen.org/publication/PubMed/10544250" } ] }, { "title": "The integrin alpha(9)beta(1) binds to a novel recognition sequence (SVVYGLR) in the thrombin-cleaved amino-terminal fragment of osteopontin.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yokosaki Y, Matsuura N, Sasaki T, Murakami I, Schneider H, Higashiyama S, Saitoh Y, Yamakido M, Taooka Y, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10593924", "url": "https://glygen.org/publication/PubMed/10593924" } ] }, { "title": "Signaling through platelet integrin alpha IIb beta 3: inside-out, outside-in, and sideways.", "journal": "Thrombosis and haemostasis", "date": "1999", "authors": "Shattil SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10605720", "url": "https://glygen.org/publication/PubMed/10605720" } ] }, { "title": "Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.", "journal": "Experimental cell research", "date": "2000", "authors": "Byzova TV, Kim W, Midura RJ, Plow EF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10640428", "url": "https://glygen.org/publication/PubMed/10640428" } ] }, { "title": "Role of the latent transforming growth factor beta binding protein 1 in fibrillin-containing microfibrils in bone cells in vitro and in vivo.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2000", "authors": "Dallas SL, Keene DR, Bruder SP, Saharinen J, Sakai LY, Mundy GR, Bonewald LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10646116", "url": "https://glygen.org/publication/PubMed/10646116" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "A regulated interaction between alpha5beta1 integrin and osteopontin.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Barry ST, Ludbrook SB, Murrison E, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10673366", "url": "https://glygen.org/publication/PubMed/10673366" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "Distinct recognition of collagen subtypes by alpha(1)beta(1) and alpha(2)beta(1) integrins. Alpha(1)beta(1) mediates cell adhesion to type XIII collagen.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nykvist P, Tu H, Ivaska J, Kapyla J, Pihlajaniemi T, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10713152", "url": "https://glygen.org/publication/PubMed/10713152" } ] }, { "title": "Specific sequence motif of 8-Cys repeats of TGF-beta binding proteins, LTBPs, creates a hydrophobic interaction surface for binding of small latent TGF-beta.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Saharinen J, Keski-Oja J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "10930463", "url": "https://glygen.org/publication/PubMed/10930463" } ] }, { "title": "Cell contact-dependent activation of alpha3beta1 integrin modulates endothelial cell responses to thrombospondin-1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Chandrasekaran L, He CZ, Al-Barazi H, Krutzsch HC, Iruela-Arispe ML, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "10982388", "url": "https://glygen.org/publication/PubMed/10982388" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Interaction of endostatin with integrins implicated in angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Rehn M, Veikkola T, Kukk-Valdre E, Nakamura H, Ilmonen M, Lombardo C, Pihlajaniemi T, Alitalo K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11158588", "url": "https://glygen.org/publication/PubMed/11158588" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.", "journal": "Developmental biology", "date": "2001", "authors": "Tiger CF, Fougerousse F, Grundstrom G, Velling T, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11518510", "url": "https://glygen.org/publication/PubMed/11518510" } ] }, { "title": "Selective binding of collagen subtypes by integrin alpha 1I, alpha 2I, and alpha 10I domains.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tulla M, Pentikainen OT, Viitasalo T, Kapyla J, Impola U, Nykvist P, Nissinen L, Johnson MS, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11572855", "url": "https://glygen.org/publication/PubMed/11572855" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "Distinct glycoprotein Ib/V/IX and integrin alpha IIbbeta 3-dependent calcium signals cooperatively regulate platelet adhesion under flow.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nesbitt WS, Kulkarni S, Giuliano S, Goncalves I, Dopheide SM, Yap CL, Harper IS, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11713259", "url": "https://glygen.org/publication/PubMed/11713259" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mu D, Cambier S, Fjellbirkeland L, Baron JL, Munger JS, Kawakatsu H, Sheppard D, Broaddus VC, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "11970960", "url": "https://glygen.org/publication/PubMed/11970960" } ] }, { "title": "Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Li Z, Calzada MJ, Sipes JM, Cashel JA, Krutzsch HC, Annis DS, Mosher DF, Roberts DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "11980922", "url": "https://glygen.org/publication/PubMed/11980922" } ] }, { "title": "Identification of the disulfide bonds in the recombinant somatomedin B domain of human vitronectin.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Kamikubo Yu-ichi, Okumura Yuushi, Loskutoff David J", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "12019263", "url": "https://glygen.org/publication/PubMed/12019263" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.", "journal": "The Biochemical journal", "date": "2003", "authors": "Ludbrook SB, Barry ST, Delves CJ, Horgan CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12358597", "url": "https://glygen.org/publication/PubMed/12358597" } ] }, { "title": "Integrin alpha8beta1 mediates adhesion to LAP-TGFbeta1.", "journal": "Journal of cell science", "date": "2002", "authors": "Lu M, Munger JS, Steadele M, Busald C, Tellier M, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12415008", "url": "https://glygen.org/publication/PubMed/12415008" } ] }, { "title": "Latent transforming growth factor beta-binding protein 1 interacts with fibrillin and is a microfibril-associated protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Isogai Z, Ono RN, Ushiro S, Keene DR, Chen Y, Mazzieri R, Charbonneau NL, Reinhardt DP, Rifkin DB, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "12429738", "url": "https://glygen.org/publication/PubMed/12429738" } ] }, { "title": "alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang WM, Kapyla J, Puranen JS, Knight CG, Tiger CF, Pentikainen OT, Johnson MS, Farndale RW, Heino J, Gullberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12496264", "url": "https://glygen.org/publication/PubMed/12496264" } ] }, { "title": "Bidirectional integrin alphaIIbbeta3 signalling regulating platelet adhesion under flow: contribution of protein kinase C.", "journal": "The Biochemical journal", "date": "2003", "authors": "Giuliano S, Nesbitt WS, Rooney M, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12585966", "url": "https://glygen.org/publication/PubMed/12585966" } ] }, { "title": "Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Sudhakar A, Sugimoto H, Yang C, Lively J, Zeisberg M, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12682293", "url": "https://glygen.org/publication/PubMed/12682293" } ] }, { "title": "Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bax DV, Bernard SE, Lomas A, Morgan A, Humphries J, Shuttleworth CA, Humphries MJ, Kielty CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "12807887", "url": "https://glygen.org/publication/PubMed/12807887" } ] }, { "title": "How vitronectin binds PAI-1 to modulate fibrinolysis and cell migration.", "journal": "Nat. Struct. Biol.", "date": "2003", "authors": "Zhou Aiwu, Huntington James A, Pannu Navraj S, Carrell Robin W, Read Randy J", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "12808446", "url": "https://glygen.org/publication/PubMed/12808446" } ] }, { "title": "Syndecan-4 as a molecule involved in defense mechanisms.", "journal": "Glycoconjugate journal", "date": "2002", "authors": "Ishiguro K, Kojima T, Muramatsu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "12975610", "url": "https://glygen.org/publication/PubMed/12975610" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "Fibulin binds to itself and to the carboxyl-terminal heparin-binding region of fibronectin.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Balbona K, Tran H, Godyna S, Ingham KC, Strickland DK, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1400330", "url": "https://glygen.org/publication/PubMed/1400330" } ] }, { "title": "Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover.", "journal": "Cell communication & adhesion", "date": "2003", "authors": "Wilkins-Port CE, Sanderson RD, Tominna-Sebald E, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14681059", "url": "https://glygen.org/publication/PubMed/14681059" } ] }, { "title": "EMILIN-1 deficiency induces elastogenesis and vascular cell defects.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Zanetti M, Braghetta P, Sabatelli P, Mura I, Doliana R, Colombatti A, Volpin D, Bonaldo P, Bressan GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "14701737", "url": "https://glygen.org/publication/PubMed/14701737" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Syndecan-2 regulates transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen L, Klass C, Woods A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "14976204", "url": "https://glygen.org/publication/PubMed/14976204" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "Endorepellin causes endothelial cell disassembly of actin cytoskeleton and focal adhesions through alpha2beta1 integrin.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bix G, Fu J, Gonzalez EM, Macro L, Barker A, Campbell S, Zutter MM, Santoro SA, Kim JK, Hook M, Reed CC, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15240572", "url": "https://glygen.org/publication/PubMed/15240572" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "Functional assessment of alphaEbeta7/E-cadherin interactions in the steady state postnatal thymus.", "journal": "Clinical & developmental immunology", "date": "2004", "authors": "Prockop SE, Petrie HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15330449", "url": "https://glygen.org/publication/PubMed/15330449" } ] }, { "title": "Galectin-3 is induced in rheumatoid arthritis synovial fibroblasts after adhesion to cartilage oligomeric matrix protein.", "journal": "Annals of the rheumatic diseases", "date": "2005", "authors": "Neidhart M, Zaucke F, von Knoch R, Jungel A, Michel BA, Gay RE, Gay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15345499", "url": "https://glygen.org/publication/PubMed/15345499" } ] }, { "title": "The fibril-associated collagen IX provides a novel mechanism for cell adhesion to cartilaginous matrix.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kapyla J, Jaalinoja J, Tulla M, Ylostalo J, Nissinen L, Viitasalo T, Vehvilainen P, Marjomaki V, Nykvist P, Saamanen AM, Farndale RW, Birk DE, Ala-Kokko L, Heino J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15383545", "url": "https://glygen.org/publication/PubMed/15383545" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "The syndecan-1 ectodomain regulates alphavbeta3 integrin activity in human mammary carcinoma cells.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Beauvais DM, Burbach BJ, Rapraeger AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "15479743", "url": "https://glygen.org/publication/PubMed/15479743" } ] }, { "title": "Loss of alpha10beta1 integrin expression leads to moderate dysfunction of growth plate chondrocytes.", "journal": "Journal of cell science", "date": "2005", "authors": "Bengtsson T, Aszodi A, Nicolae C, Hunziker EB, Lundgren-Akerlund E, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15713743", "url": "https://glygen.org/publication/PubMed/15713743" } ] }, { "title": "VLA-4-fibronectin interaction is required for the terminal differentiation of human bone marrow cells capable of spontaneous and high rate immunoglobulin secretion.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Roldan E, Garcia-Pardo A, Brieva JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "1588291", "url": "https://glygen.org/publication/PubMed/1588291" } ] }, { "title": "Canstatin acts on endothelial and tumor cells via mitochondrial damage initiated through interaction with alphavbeta3 and alphavbeta5 integrins.", "journal": "Cancer research", "date": "2005", "authors": "Magnon C, Galaup A, Mullan B, Rouffiac V, Bouquet C, Bidart JM, Griscelli F, Opolon P, Perricaudet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "15899827", "url": "https://glygen.org/publication/PubMed/15899827" } ] }, { "title": "Critical role of the fifth domain of E-cadherin for heterophilic adhesion with alpha E beta 7, but not for homophilic adhesion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Shiraishi K, Tsuzaka K, Yoshimoto K, Kumazawa C, Nozaki K, Abe T, Tsubota K, Takeuchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16002701", "url": "https://glygen.org/publication/PubMed/16002701" } ] }, { "title": "Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen FH, Thomas AO, Hecht JT, Goldring MB, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16051604", "url": "https://glygen.org/publication/PubMed/16051604" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Human alpha1 type IV collagen NC1 domain exhibits distinct antiangiogenic activity mediated by alpha1beta1 integrin.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Sudhakar A, Nyberg P, Keshamouni VG, Mannam AP, Li J, Sugimoto H, Cosgrove D, Kalluri R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16151532", "url": "https://glygen.org/publication/PubMed/16151532" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Integrin alphaDbeta2, an adhesion receptor up-regulated on macrophage foam cells, exhibits multiligand-binding properties.", "journal": "Blood", "date": "2006", "authors": "Yakubenko VP, Yadav SP, Ugarova TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16239428", "url": "https://glygen.org/publication/PubMed/16239428" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Borza CM, Pozzi A, Borza DB, Pedchenko V, Hellmark T, Hudson BG, Zent R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16731529", "url": "https://glygen.org/publication/PubMed/16731529" } ] }, { "title": "Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eble JA, Kassner A, Niland S, Morgelin M, Grifka J, Grassel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16754661", "url": "https://glygen.org/publication/PubMed/16754661" } ] }, { "title": "Phosphoproteomic analysis of the human pituitary.", "journal": "Pituitary", "date": "2006", "authors": "Beranova-Giorgianni S, Zhao Y, Desiderio DM, Giorgianni F", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "16807684", "url": "https://glygen.org/publication/PubMed/16807684" } ] }, { "title": "The synergy site of fibronectin is required for strong interaction with the platelet integrin alphaIIbbeta3.", "journal": "Annals of biomedical engineering", "date": "2006", "authors": "Chada D, Mather T, Nollert MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "16933105", "url": "https://glygen.org/publication/PubMed/16933105" } ] }, { "title": "Laminin alpha1 chain LG4 module promotes cell attachment through syndecans and cell spreading through integrin alpha2beta1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hozumi K, Suzuki N, Nielsen PK, Nomizu M, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "16945929", "url": "https://glygen.org/publication/PubMed/16945929" } ] }, { "title": "The phosphorylation of the two-chain form of vitronectin by protein kinase A is heparin dependent.", "journal": "FEBS letters", "date": "1990", "authors": "Chain D, Korc-Grodzicki B, Kreizman T, Shaltiel S", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "1696913", "url": "https://glygen.org/publication/PubMed/1696913" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "Evidence that type 1 plasminogen activator inhibitor binds to the somatomedin B domain of vitronectin.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Seiffert D, Loskutoff D J", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "1704366", "url": "https://glygen.org/publication/PubMed/1704366" } ] }, { "title": "Endogenous cleavage of the Arg-379-Ala-380 bond in vitronectin results in a distinct conformational change which 'buries' Ser-378, its site of phosphorylation by protein kinase A.", "journal": "The Biochemical journal", "date": "1991", "authors": "Chain D, Korc-Grodzicki B, Kreizman T, Shaltiel S", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "1706595", "url": "https://glygen.org/publication/PubMed/1706595" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Tissue vitronectin in normal adult human dermis is non-covalently bound to elastic tissue.", "journal": "The Journal of investigative dermatology", "date": "1991", "authors": "Hintner H, Dahlback K, Dahlback B, Pepys MB, Breathnach SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "1708799", "url": "https://glygen.org/publication/PubMed/1708799" } ] }, { "title": "Insulin binds to type V collagen with retention of mitogenic activity.", "journal": "Exp. Cell Res.", "date": "1991", "authors": "Yaoi Y, Hashimoto K, Takahara K, Kato I", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "1709100", "url": "https://glygen.org/publication/PubMed/1709100" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "The short arm of laminin gamma2 chain of laminin-5 (laminin-332) binds syndecan-1 and regulates cellular adhesion and migration by suppressing phosphorylation of integrin beta4 chain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Ogawa T, Tsubota Y, Hashimoto J, Kariya Y, Miyazaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "17314405", "url": "https://glygen.org/publication/PubMed/17314405" } ] }, { "title": "A comparative analysis of the fibulin protein family. Biochemical characterization, binding interactions, and tissue localization.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kobayashi N, Kostka G, Garbe JH, Keene DR, Bachinger HP, Hanisch FG, Markova D, Tsuda T, Timpl R, Chu ML, Sasaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "17324935", "url": "https://glygen.org/publication/PubMed/17324935" } ] }, { "title": "Critical residues of alphaX I-domain recognizing fibrinogen central domain.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Lee JH, Choi J, Nham SU", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17339034", "url": "https://glygen.org/publication/PubMed/17339034" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "Determination of the sites of tyrosine O-sulfation in peptides and proteins.", "journal": "Nature methods", "date": "2007", "authors": "Yu Y, Hoffhines AJ, Moore KL, Leary JA", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "17558413", "url": "https://glygen.org/publication/PubMed/17558413" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Involvement of alpha(v)beta3 integrins in osteoclast function.", "journal": "Journal of bone and mineral metabolism", "date": "2007", "authors": "Nakamura I, Duong LT, Rodan SB, Rodan GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "17968485", "url": "https://glygen.org/publication/PubMed/17968485" } ] }, { "title": "Phosphoproteome of resting human platelets.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ] }, { "title": "Targeting of bone morphogenetic protein growth factor complexes to fibrillin.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sengle G, Charbonneau NL, Ono RN, Sasaki T, Alvarez J, Keene DR, Bachinger HP, Sakai LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "18339631", "url": "https://glygen.org/publication/PubMed/18339631" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004#ptm_processing" }, { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Molecular interplay between endostatin, integrins, and heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Faye C, Moreau C, Chautard E, Jetne R, Fukai N, Ruggiero F, Humphries MJ, Olsen BR, Ricard-Blum S", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "19502598", "url": "https://glygen.org/publication/PubMed/19502598" } ] }, { "title": "An initial characterization of the serum phosphoproteome.", "journal": "Journal of proteome research", "date": "2009", "authors": "Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ] }, { "title": "Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.", "journal": "Molecular and cellular biochemistry", "date": "2010", "authors": "Rock MJ, Holden P, Horton WA, Cohn DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20033473", "url": "https://glygen.org/publication/PubMed/20033473" } ] }, { "title": "Thrombospondin-induced adhesion of human platelets.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Tuszynski GP, Kowalska MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "2010551", "url": "https://glygen.org/publication/PubMed/2010551" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Lumican inhibits cell migration through alpha2beta1 integrin.", "journal": "Experimental cell research", "date": "2010", "authors": "Zeltz C, Brezillon S, Kapyla J, Eble JA, Bobichon H, Terryn C, Perreau C, Franz CM, Heino J, Maquart FX, Wegrowski Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "20705068", "url": "https://glygen.org/publication/PubMed/20705068" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin alphavbeta8-mediated activation of TGF-beta.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Kitamura H, Cambier S, Somanath S, Barker T, Minagawa S, Markovics J, Goodsell A, Publicover J, Reichardt L, Jablons D, Wolters P, Hill A, Marks JD, Lou J, Pittet JF, Gauldie J, Baron JL, Nishimura SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "21646718", "url": "https://glygen.org/publication/PubMed/21646718" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04004", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04004" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "Tetrastatin, the NC1 domain of the alpha4(IV) collagen chain: a novel potent anti-tumor matrikine.", "journal": "PloS one", "date": "2012", "authors": "Brassart-Pasco S, Senechal K, Thevenard J, Ramont L, Devy J, Di Stefano L, Dupont-Deshorgue A, Brezillon S, Feru J, Jazeron JF, Diebold MD, Ricard-Blum S, Maquart FX, Monboisse JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22539938", "url": "https://glygen.org/publication/PubMed/22539938" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "Target-derived matricryptins organize cerebellar synapse formation through alpha3beta1 integrins.", "journal": "Cell reports", "date": "2012", "authors": "Su J, Stenbjorn RS, Gorse K, Su K, Hauser KF, Ricard-Blum S, Pihlajaniemi T, Fox MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "22884367", "url": "https://glygen.org/publication/PubMed/22884367" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.", "journal": "The FEBS journal", "date": "2013", "authors": "Willis CD, Poluzzi C, Mongiat M, Iozzo RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "23374253", "url": "https://glygen.org/publication/PubMed/23374253" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "Complete amino acid sequence of human vitronectin deduced from cDNA. Similarity of cell attachment sites in vitronectin and fibronectin.", "journal": "EMBO J.", "date": "1985", "authors": "Suzuki S, Oldberg A, Hayman E G, Pierschbacher M D, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "2414098", "url": "https://glygen.org/publication/PubMed/2414098" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "Nucleotide sequence and organization of the human S-protein gene: repeating peptide motifs in the 'pexin' family and a model for their evolution.", "journal": "Biochemistry", "date": "1987", "authors": "Jenne D, Stanley K K", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "2447940", "url": "https://glygen.org/publication/PubMed/2447940" } ] }, { "title": "Phosphorylation of vitronectin by a protein kinase in human plasma. Identification of a unique phosphorylation site in the heparin-binding domain.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "McGuire EA, Peacock ME, Inhorn RC, Siegel NR, Tollefsen DM", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "2448300", "url": "https://glygen.org/publication/PubMed/2448300" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "Sulfation of two tyrosine-residues in human complement S-protein (vitronectin).", "journal": "European journal of biochemistry", "date": "1989", "authors": "Jenne D, Hille A, Stanley KK, Huttner WB", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "2479556", "url": "https://glygen.org/publication/PubMed/2479556" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "Complement factor H, vitronectin, and opticin are tyrosine-sulfated proteins of the retinal pigment epithelium.", "journal": "PloS one", "date": "2014", "authors": "Kanan Y, Siefert JC, Kinter M, Al-Ubaidi MR", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "25136834", "url": "https://glygen.org/publication/PubMed/25136834" } ] }, { "title": "In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation.", "journal": "Analytical and bioanalytical chemistry", "date": "2014", "authors": "Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "25374123", "url": "https://glygen.org/publication/PubMed/25374123" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Quantitative analysis of core fucosylation of serum proteins in liver diseases by LC-MS-MRM.", "journal": "Journal of proteomics", "date": "2018", "authors": "Ma J, Sanda M, Wei R, Zhang L, Goldman R", "evidence": [ { "database": "Automatic Literature Mining", "id": "29427759", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" } ], "reference": [ { "type": "PubMed", "id": "29427759", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "Molecular Camouflage of Plasmodium falciparum Merozoites by Binding of Host Vitronectin to P47 Fragment of SERA5.", "journal": "Sci. Rep.", "date": "2018", "authors": "Tougan T, Edula JR, Takashima E, Morita M, Shinohara M, Shinohara A, Tsuboi T, Horii T", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "29567995", "url": "https://glygen.org/publication/PubMed/29567995" } ] }, { "title": "Cell surface proteoglycan binds mouse mammary epithelial cells to fibronectin and behaves as a receptor for interstitial matrix.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Saunders S, Bernfield M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "2963012", "url": "https://glygen.org/publication/PubMed/2963012" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" }, { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Molecular cloning of S-protein, a link between complement, coagulation and cell-substrate adhesion.", "journal": "EMBO J.", "date": "1985", "authors": "Jenne D, Stanley K K", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "3004934", "url": "https://glygen.org/publication/PubMed/3004934" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P04004", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Correlations between vitronectin, miR-520, and miR-34 in patients with stenosis of coronary arteries.", "journal": "Molecular biology reports", "date": "2021", "authors": "Ghasempour G, Shaikhnia F, Soleimani AA, Rahimi B, Najafi M", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ], "reference": [ { "type": "PubMed", "id": "34652615", "url": "https://glygen.org/publication/PubMed/34652615" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Complement Inhibitors Vitronectin and Clusterin Are Recruited from Human Serum to the Surface of Coronavirus OC43-Infected Lung Cells through Antibody-Dependent Mechanisms.", "journal": "Viruses", "date": "2021", "authors": "Fox CR, Parks GD", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ], "reference": [ { "type": "PubMed", "id": "35062233", "url": "https://glygen.org/publication/PubMed/35062233" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04004", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04004" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Vitronectin, a Novel Urinary Proteomic Biomarker, Promotes Cell Pyroptosis in Juvenile Systemic Lupus Erythematosus.", "journal": "Mediators of inflammation", "date": "2022", "authors": "Zhang S, Pan W, Wang H, Zhi C, Lin Y, Wu P, Ren Q, Wei P, Chen R, Li F, Xie Y, Wong CK, Tang H, Cai Z, Xu W, Zeng H", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ], "reference": [ { "type": "PubMed", "id": "35462789", "url": "https://glygen.org/publication/PubMed/35462789" } ] }, { "title": "Vitronectin and Its Interaction with PAI-1 Suggests a Functional Link to Vascular Changes in AMD Pathobiology.", "journal": "Cells", "date": "2022", "authors": "Biasella F, Strunz T, Kiel C, On Behalf Of The International Amd Genomics Consortium Iamdgc, Weber BHF, Friedrich U", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ], "reference": [ { "type": "PubMed", "id": "35681461", "url": "https://glygen.org/publication/PubMed/35681461" } ] }, { "title": "Knockdown of FBLN2 suppresses TGF-beta1-induced MRC-5 cell migration and fibrosis by downregulating VTN.", "journal": "Tissue & cell", "date": "2023", "authors": "Zhang Y, Zhang W, Zhang R, Xia Y", "evidence": [ { "database": "RefSeq", "id": "NP_000629", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000629" } ], "reference": [ { "type": "PubMed", "id": "36608640", "url": "https://glygen.org/publication/PubMed/36608640" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P04004", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P04004" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Primary structure of somatomedin B: a growth hormone-dependent serum factor with protease inhibiting activity.", "journal": "FEBS Lett.", "date": "1978", "authors": "Fryklund L, Sievertsson H", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "631332", "url": "https://glygen.org/publication/PubMed/631332" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Binding of mouse and human fibulin-2 to extracellular matrix ligands.", "journal": "Journal of molecular biology", "date": "1995", "authors": "Sasaki T, Gohring W, Pan TC, Chu ML, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7500359", "url": "https://glygen.org/publication/PubMed/7500359" } ] }, { "title": "Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.", "journal": "Blood", "date": "1993", "authors": "Denis C, Williams JA, Lu X, Meyer D, Baruch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7505120", "url": "https://glygen.org/publication/PubMed/7505120" } ] }, { "title": "Identification of a PAI-1 binding site in vitronectin.", "journal": "Biochim. Biophys. Acta", "date": "1994", "authors": "Sigurdardottir O, Wiman B", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "7522053", "url": "https://glygen.org/publication/PubMed/7522053" } ] }, { "title": "Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Nishimura SL, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7525578", "url": "https://glygen.org/publication/PubMed/7525578" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "The association of human fibulin-1 with elastic fibers: an immunohistological, ultrastructural, and RNA study.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1995", "authors": "Roark EF, Keene DR, Haudenschild CC, Godyna S, Little CD, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "7534784", "url": "https://glygen.org/publication/PubMed/7534784" } ] }, { "title": "Structures of the N-linked oligosaccharides on human plasma vitronectin.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I", "evidence": [ { "database": "GlyConnect", "id": "625", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "reference": [ { "type": "PubMed", "id": "7541354", "url": "https://glygen.org/publication/PubMed/7541354" } ] }, { "title": "The integrin receptor alpha 8 beta 1 mediates interactions of embryonic chick motor and sensory neurons with tenascin-C.", "journal": "Neuron", "date": "1995", "authors": "Varnum-Finney B, Venstrom K, Muller U, Kypta R, Backus C, Chiquet M, Reichardt LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7541634", "url": "https://glygen.org/publication/PubMed/7541634" } ] }, { "title": "CD31/PECAM-1 is a ligand for alpha v beta 3 integrin involved in adhesion of leukocytes to endothelium.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Piali L, Hammel P, Uherek C, Bachmann F, Gisler RH, Dunon D, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "7542249", "url": "https://glygen.org/publication/PubMed/7542249" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Platelet adhesion to collagen types I through VIII under conditions of stasis and flow is mediated by GPIa/IIa (alpha 2 beta 1-integrin).", "journal": "Blood", "date": "1994", "authors": "Saelman EU, Nieuwenhuis HK, Hese KM, de Groot PG, Heijnen HF, Sage EH, Williams S, McKeown L, Gralnick HR, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8118028", "url": "https://glygen.org/publication/PubMed/8118028" } ] }, { "title": "Interaction of type IV collagen with the isolated integrins alpha 1 beta 1 and alpha 2 beta 1.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Kern A, Eble J, Golbik R, Kuhn K", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8344274", "url": "https://glygen.org/publication/PubMed/8344274" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "Receptor-ligand interaction between CD44 and osteopontin (Eta-1).", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber GF, Ashkar S, Glimcher MJ, Cantor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8560266", "url": "https://glygen.org/publication/PubMed/8560266" } ] }, { "title": "Stimulation of fibroblast growth factor receptor-1 occupancy and signaling by cell surface-associated syndecans and glypican.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Steinfeld R, Van Den Berghe H, David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "8609172", "url": "https://glygen.org/publication/PubMed/8609172" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Identification of alpha v beta 3 as a heterotypic ligand for CD31/PECAM-1.", "journal": "Journal of cell science", "date": "1996", "authors": "Buckley CD, Doyonnas R, Newton JP, Blystone SD, Brown EJ, Watt SM, Simmons DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8838667", "url": "https://glygen.org/publication/PubMed/8838667" } ] }, { "title": "The binding protein for globular heads of complement C1q, gC1qR. Functional expression and characterization as a novel vitronectin binding factor.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Lim B L, Reid K B, Ghebrehiwet B, Peerschke E I, Leigh L A, Preissner K T", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "reference": [ { "type": "PubMed", "id": "8900153", "url": "https://glygen.org/publication/PubMed/8900153" } ] }, { "title": "Osteopontin N-terminal domain contains a cryptic adhesive sequence recognized by alpha9beta1 integrin.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Smith LL, Cheung HK, Ling LE, Chen J, Sheppard D, Pytela R, Giachelli CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "8910476", "url": "https://glygen.org/publication/PubMed/8910476" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Phosphorylation of vitronectin on Ser362 by protein kinase C attenuates its cleavage by plasmin.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Gechtman Z, Shaltiel S", "evidence": [ { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "9030777", "url": "https://glygen.org/publication/PubMed/9030777" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Multimerization of the cytoplasmic domain of syndecan-4 is required for its ability to activate protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Oh ES, Woods A, Couchman JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170" } ], "reference": [ { "type": "PubMed", "id": "9115237", "url": "https://glygen.org/publication/PubMed/9115237" } ] }, { "title": "The alpha v beta 3 integrin `vitronectin receptor`.", "journal": "The international journal of biochemistry & cell biology", "date": "1997", "authors": "Horton MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9251239", "url": "https://glygen.org/publication/PubMed/9251239" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.", "journal": "Journal of cell science", "date": "1998", "authors": "Memmo LM, McKeown-Longo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9443892", "url": "https://glygen.org/publication/PubMed/9443892" } ] }, { "title": "Identification of the ligand binding site for the integrin alpha9 beta1 in the third fibronectin type III repeat of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Yokosaki Y, Matsuura N, Higashiyama S, Murakami I, Obara M, Yamakido M, Shigeto N, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9565552", "url": "https://glygen.org/publication/PubMed/9565552" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Interactions between growth factors and integrins: latent forms of transforming growth factor-beta are ligands for the integrin alphavbeta1.", "journal": "Molecular biology of the cell", "date": "1998", "authors": "Munger JS, Harpel JG, Giancotti FG, Rifkin DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2129379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379" } ], "reference": [ { "type": "PubMed", "id": "9725916", "url": "https://glygen.org/publication/PubMed/9725916" } ] }, { "title": "Phosphorylation of vitronectin by casein kinase II. Identification of the sites and their promotion of cell adhesion and spreading.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Seger D, Gechtman Z, Shaltiel S", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "iPTMnet", "id": "P04004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04004" } ], "reference": [ { "type": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] }, { "title": "Effect of the interaction between fibronectin and VLA-4 on the proliferation of human B cells, especially a novel human B-cell line, OPM-3.", "journal": "British journal of haematology", "date": "1998", "authors": "Yoshida H, Nishiura T, Karasuno T, Matsumura I, Ishikawa J, Yoshimura M, Yokota T, Okajima Y, Ogawa M, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-216083", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083" } ], "reference": [ { "type": "PubMed", "id": "9858236", "url": "https://glygen.org/publication/PubMed/9858236" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:7448", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7448", "resource": "KEGG Pathway" }, { "id": "R-HSA-2129379", "name": "Molecules associated with elastic fibres", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2129379", "resource": "Reactome", "description": "Molecules associated with elastic fibres" }, { "id": "R-HSA-216083", "name": "Integrin cell surface interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-216083", "resource": "Reactome", "description": "Integrin cell surface interactions" }, { "id": "R-HSA-3000170", "name": "Syndecan interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000170", "resource": "Reactome", "description": "Syndecan interactions" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "P29788-1", "protein_name": "Vitronectin", "gene_name": "Vtn", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPLRPFFILALVAWVSLADQESCKGRCTQGFMASKKCQCDELCTYYQSCCADYMEQCKPQVTRGDVFTMPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPGYPRNISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQRDSWENIFELLFWGRSSDGAREPQFISRNWHGVPGKVDAAMAGRIYVTGSLSHSAQAKKQKSKRRSRKRYRSRRGRGHRRSQSSNSRRSSRSIWFSLFSSEESGLGTYNNYDYDMDWLVPATCEPIQSVYFFSGDKYYRVNLRTRRVDSVNPPYPRSIAQYWLGCPTSEK", "length": 478 }, "evidence": [ { "id": "45919310", "url": "http://www.informatics.jax.org/homology/45919310", "database": "MGI" }, { "id": "P04004", "url": "https://omabrowser.org/oma/group/P04004/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7TQ11-1", "protein_name": "Vitronectin", "gene_name": "Vtn", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASLRPFFILALLALVSLADQESCKGRCTQGFMASKKCQCDELCTYYQSCCVDYMEQCKPQVTRGDVFTMPEDEYWSYDYPEETKNSTSTGVQSENTSLHFNLKPRAEETIKPTTPDPQEQSNTQEPEVGQQGVAPRPDTTDEGTSEFPEEELCSGKPFDAFTDLKNGSLFAFRGDSVDRFDGGEYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISEGFSGIPDNVDAALALPAHSYSGRERVYFFKGTQGKQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQRDSWENIFELLFWGRSSDGAKGPQFISRDWHGVPGKVDAAMAGRIYITGSTFRSVQAKKQKSGRRSRKRYRSRRGRGHSRSRSRSMSSRRPSRSVWFSLLSSEESGLGTYNYDYDMNWRIPATCEPIQSVYFFSGDKYYRVNLRTRRVDSVNPPYPRSIAQYWLGCPTSEK", "length": 490 }, "evidence": [ { "id": "P04004", "url": "https://omabrowser.org/oma/group/P04004/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "polysaccharide binding", "id": "GO:0030247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030247", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "scavenger receptor activity", "id": "GO:0005044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005044", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "collagen binding", "id": "GO:0005518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005518", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "extracellular matrix binding", "id": "GO:0050840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050840", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent", "id": "GO:0005201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005201", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 22, "go_terms": [ { "name": "smooth muscle cell-matrix adhesion", "id": "GO:0061302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061302", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "regulation of cell adhesion", "id": "GO:0030155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030155", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of protein binding", "id": "GO:0032092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032092", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "cell adhesion mediated by integrin", "id": "GO:0033627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033627", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "negative regulation of fibrinolysis", "id": "GO:0051918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051918", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of wound healing", "id": "GO:0090303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090303", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of cell-substrate adhesion", "id": "GO:0010811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010811", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "negative regulation of blood coagulation", "id": "GO:0030195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030195", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "negative regulation of endopeptidase activity", "id": "GO:0010951", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010951", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "liver regeneration", "id": "GO:0097421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097421", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of vascular endothelial growth factor receptor signaling pathway", "id": "GO:0030949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030949", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "protein polymerization", "id": "GO:0051258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051258", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell migration", "id": "GO:0014911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014911", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "oligodendrocyte differentiation", "id": "GO:0048709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048709", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "endodermal cell differentiation", "id": "GO:0035987", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035987", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "rough endoplasmic reticulum lumen", "id": "GO:0048237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048237", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "alphav-beta3 integrin-vitronectin complex", "id": "GO:0071062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071062", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "peptidase inhibitor complex", "id": "GO:1904090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904090", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" }, { "name": "protein complex involved in cell-matrix adhesion", "id": "GO:0098637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098637", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "vitronectin N-glycosylated 1 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053176", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053176" } ] }, { "name": "vitronectin N-glycosylated 2 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053177", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053177" } ] }, { "name": "vitronectin N-glycosylated 3 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053178", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053178" } ] }, { "name": "vitronectin N-glycosylated 4 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053179", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053179" } ] }, { "name": "vitronectin N-glycosylated 5 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053180", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053180" } ] }, { "name": "vitronectin N-glycosylated 6 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G19379ID. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G19379ID. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053181", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053181" } ] }, { "name": "vitronectin N-glycosylated 7 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053182", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053182" } ] }, { "name": "vitronectin N-glycosylated 8 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053183", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053183" } ] }, { "name": "vitronectin N-glycosylated 9 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413, PMID:25374123]", "evidence": [ { "id": "PR:000053184", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053184" } ] }, { "name": "vitronectin N-glycosylated 10 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G56610MH. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G56610MH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053185", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053185" } ] }, { "name": "vitronectin N-glycosylated 11 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G58802FE. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G58802FE. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053186", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053186" } ] }, { "name": "vitronectin N-glycosylated 12 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G69107AL. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G69107AL. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000053187", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053187" } ] }, { "name": "vitronectin N-glycosylated 13 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-169 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P04004-1, Asn-169, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053188", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053188" } ] }, { "name": "vitronectin N-glycosylated 14 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053189", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053189" } ] }, { "name": "vitronectin N-glycosylated 15 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053190", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053190" } ] }, { "name": "vitronectin N-glycosylated 16 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:24279413, PMID:25374123]", "evidence": [ { "id": "PR:000053191", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053191" } ] }, { "name": "vitronectin N-glycosylated 17 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:25374123]", "evidence": [ { "id": "PR:000053192", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053192" } ] }, { "name": "vitronectin N-glycosylated 18 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053193", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053193" } ] }, { "name": "vitronectin N-glycosylated 19 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:25374123]", "evidence": [ { "id": "PR:000053194", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053194" } ] }, { "name": "vitronectin N-glycosylated 20 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413, PMID:25374123]", "evidence": [ { "id": "PR:000053195", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053195" } ] }, { "name": "vitronectin N-glycosylated 21 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G51941GC. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G51941GC. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000053196", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053196" } ] }, { "name": "vitronectin N-glycosylated 22 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G57818FI. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G57818FI. [PRO:DNx, PMID:25374123]", "evidence": [ { "id": "PR:000053197", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053197" } ] }, { "name": "vitronectin N-glycosylated 23 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053198", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053198" } ] }, { "name": "vitronectin N-glycosylated 24 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053199", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053199" } ] }, { "name": "vitronectin N-glycosylated 25 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053200", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053200" } ] }, { "name": "vitronectin N-glycosylated 26 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G93860XO. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G93860XO. [PRO:DNx, PMID:24279413, PMID:25374123]", "evidence": [ { "id": "PR:000053201", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053201" } ] }, { "name": "vitronectin N-glycosylated 27 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-242 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P04004-1, Asn-242, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053202", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053202" } ] }, { "name": "vitronectin N-glycosylated 28 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053203", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053203" } ] }, { "name": "vitronectin N-glycosylated 29 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053204", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053204" } ] }, { "name": "vitronectin N-glycosylated 30 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053205", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053205" } ] }, { "name": "vitronectin N-glycosylated 31 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053206", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053206" } ] }, { "name": "vitronectin N-glycosylated 32 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053207", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053207" } ] }, { "name": "vitronectin N-glycosylated 33 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:25374123]", "evidence": [ { "id": "PR:000053208", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053208" } ] }, { "name": "vitronectin N-glycosylated 34 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053209", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053209" } ] }, { "name": "vitronectin N-glycosylated 35 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053210", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053210" } ] }, { "name": "vitronectin N-glycosylated 36 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053211", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053211" } ] }, { "name": "vitronectin N-glycosylated 37 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053212", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053212" } ] }, { "name": "vitronectin N-glycosylated 38 (human)", "definition": "A vitronectin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P04004-1, Asn-86, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053213", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053213" } ] }, { "name": "vitronectin O-glycosylated 1 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Ser-130 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Ser-130, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053214", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053214" } ] }, { "name": "vitronectin O-glycosylated 2 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Ser-97 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P04004-1, Ser-97, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053215", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053215" } ] }, { "name": "vitronectin O-glycosylated 3 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Ser-97 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Ser-97, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053216", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053216" } ] }, { "name": "vitronectin O-glycosylated 4 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-141 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P04004-1, Thr-141, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053217", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053217" } ] }, { "name": "vitronectin O-glycosylated 5 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-141 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Thr-141, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053218", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053218" } ] }, { "name": "vitronectin O-glycosylated 6 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-429 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Thr-429, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053219", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053219" } ] }, { "name": "vitronectin O-glycosylated 7 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-88 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P04004-1, Thr-88, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053220", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053220" } ] }, { "name": "vitronectin O-glycosylated 8 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-88 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Thr-88, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053221", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053221" } ] }, { "name": "vitronectin O-glycosylated 9 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-88 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P04004-1, Thr-88, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053222", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053222" } ] }, { "name": "vitronectin O-glycosylated 10 (human)", "definition": "A vitronectin (human) that has been O-glycosylated at the residue equivalent to Thr-99 of the amino acid sequence represented by UniProtKB:P04004-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P04004-1, Thr-99, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053223", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053223" } ] } ], "site_annotation": [ { "start_pos": 169, "end_pos": 171, "annotation": "n_glycosylation_sequon" }, { "start_pos": 242, "end_pos": 244, "annotation": "n_glycosylation_sequon" }, { "start_pos": 86, "end_pos": 88, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "9733784", "url": "https://glygen.org/publication/PubMed/9733784" } ] }, { "annotation": "Sulfated on tyrosine residues.", "evidence": [ { "database": "UniProtKB", "id": "P04004", "url": "https://www.uniprot.org/uniprot/P04004" }, { "database": "PubMed", "id": "17558413", "url": "https://glygen.org/publication/PubMed/17558413" }, { "database": "PubMed", "id": "2479556", "url": "https://glygen.org/publication/PubMed/2479556" }, { "database": "PubMed", "id": "25136834", "url": "https://glygen.org/publication/PubMed/25136834" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 86, 169, 242 ], "o_linked_sites": [ 29, 63, 69, 85, 88, 97, 99, 100, 113, 130, 141, 171, 429 ], "snv_sites": [ 63, 69, 87, 88, 97, 141, 242, 264, 392, 429, 433 ], "glycation_sites": [], "phosphorylation_sites": [ 69, 76, 130, 137, 171, 312, 381, 397 ], "sequon_annotation_sites": [ { "start_pos": 169, "end_pos": 171 }, { "start_pos": 242, "end_pos": 244 }, { "start_pos": 86, "end_pos": 88 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 176 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 101 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 173 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 101 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 221 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }