{
"uniprot_canonical_ac": "P03956-1",
"uniprot_ac": "P03956",
"uniprot_id": "MMP1_HUMAN",
"mass": {
"chemical_mass": 54007.0,
"monoisotopic_mass": 54007.0
},
"refseq": {
"ac": "NP_002412",
"name": "interstitial collagenase isoform 1 preproprotein",
"summary": "This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
},
"gene_names": [
{
"name": "MMP1",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P03956",
"id": "P03956"
},
{
"name": "CLG; CLGN",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412",
"id": "NP_002412"
},
{
"name": "CLG",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P03956",
"id": "P03956"
},
{
"name": "MMP1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412",
"id": "NP_002412"
}
],
"protein_names": [
{
"name": "Interstitial collagenase",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P03956"
},
{
"name": "3.4.24.7",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P03956"
},
{
"name": "Fibroblast collagenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P03956"
},
{
"name": "MMP-1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P03956"
},
{
"name": "Matrix metalloproteinase-1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P03956"
},
{
"name": "fibroblast collagenase; matrix metalloprotease 1; matrix metallopeptidase 1 (interstitial collagenase)",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412",
"id": "NP_002412"
},
{
"name": "interstitial collagenase isoform 1 preproprotein",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412",
"id": "NP_002412"
}
],
"function": [
{
"annotation": "Association of Matrix Metalloproteinase-1 Promoter Polymorphisms With Asthma Risk.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
},
{
"database": "PubMed",
"id": "38148093",
"url": "https://glygen.org/publication/PubMed/38148093"
}
]
},
{
"annotation": "Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:2557822, PubMed:2153297, PubMed:1645757). In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity (PubMed:16807369).",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956#function"
},
{
"database": "PubMed",
"id": "16807369",
"url": "https://glygen.org/publication/PubMed/16807369"
},
{
"database": "PubMed",
"id": "2153297",
"url": "https://glygen.org/publication/PubMed/2153297"
},
{
"database": "PubMed",
"id": "2557822",
"url": "https://glygen.org/publication/PubMed/2557822"
},
{
"database": "PubMed",
"id": "1645757",
"url": "https://glygen.org/publication/PubMed/1645757"
}
]
},
{
"annotation": "Increased Matrix Metalloproteinase-1 Activation Enhances Disruption and Regression of k-RasV12-Expressing Arteriovenous Malformation-Like Vessels.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
},
{
"database": "PubMed",
"id": "37328101",
"url": "https://glygen.org/publication/PubMed/37328101"
}
]
},
{
"annotation": "Involvement of matrix metalloproteinase 1 and urokinase-type plasminogen activator in the PKCalpha-p38 MAPK pathway-mediated progression of human liver cancer cells.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
},
{
"database": "PubMed",
"id": "37005497",
"url": "https://glygen.org/publication/PubMed/37005497"
}
]
},
{
"annotation": "N-acetyltransferase 10 promotes the progression of oral squamous cell carcinoma through N4-acetylcytidine RNA acetylation of MMP1 mRNA.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
},
{
"database": "PubMed",
"id": "37705232",
"url": "https://glygen.org/publication/PubMed/37705232"
}
]
},
{
"annotation": "This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "rs114064748",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114064748"
},
{
"id": "rs114064748",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114064748"
},
{
"id": "rs114064748",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114064748"
},
{
"id": "rs114064748",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs114064748#frequency_tab"
},
{
"id": "rs114064748",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs114064748"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 122,
"end_pos": 122,
"sequence_org": "T",
"sequence_mut": "K",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->NYK).",
"chr_id": "11",
"chr_pos": "102797148",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "0.001198",
"site_lbl": "T122",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs114064748",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114064748"
},
{
"id": "rs114064748",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114064748"
},
{
"id": "rs114064748",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114064748"
},
{
"id": "rs114064748",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs114064748#frequency_tab"
},
{
"id": "rs114064748",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs114064748"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 122,
"end_pos": 122,
"sequence_org": "T",
"sequence_mut": "M",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->NYM).",
"chr_id": "11",
"chr_pos": "102797148",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "0.001198",
"site_lbl": "T122",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1335445679",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1335445679"
},
{
"id": "rs1335445679",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1335445679#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 145,
"end_pos": 145,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVI).",
"chr_id": "11",
"chr_pos": "102797079",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T145",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1423621991",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423621991"
},
{
"id": "rs1423621991",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1423621991#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 182,
"end_pos": 182,
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).",
"chr_id": "11",
"chr_pos": "102796745",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A182",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs761955087",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761955087"
},
{
"id": "rs761955087",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761955087"
},
{
"id": "rs761955087",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs761955087"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 228,
"end_pos": 228,
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HST->NST).",
"chr_id": "11",
"chr_pos": "102795551",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "H228",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs759136402",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759136402"
},
{
"id": "rs759136402",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759136402"
},
{
"id": "rs759136402",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs759136402#frequency_tab"
},
{
"id": "rs759136402",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs759136402"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 317,
"end_pos": 317,
"sequence_org": "I",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFI->NFT).",
"chr_id": "11",
"chr_pos": "102792688",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "I317",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "P03956",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P03956"
}
],
"glycoeffect": [],
"start_pos": 434,
"end_pos": 434,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "G",
"sequence_mut": "E",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "11",
"chr_pos": "102790521",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "G434",
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
},
{
"disease_id": "DOID:4159",
"recommended_name": {
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "skin cancer",
"description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
},
"synonyms": [
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "CA - skin cancer",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "malignant neoplasm of skin",
"description": ""
},
{
"id": "DOID:4159",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:4159",
"name": "melanoma and Non-melanoma skin cancer",
"description": ""
}
]
},
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [
{
"start_pos": 360,
"end_pos": 360,
"sequence_org": "Y",
"sequence_mut": "F",
"comment": "Partial reduction of tyrosine phosphorylation in the presence of PKDCC/VLK.",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "55.39",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "42.24",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "80.1",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "49.96",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "17.43",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "79.99",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "47.76",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "53.41",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "41.47",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "47.6",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "39.42",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "40.06",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "51.67",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03956"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "MMP1",
"url": "https://www.uniprot.org/uniprot/P03956",
"locus": {
"chromosome": "11",
"start_pos": 102789401,
"end_pos": 102798160,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000196611",
"url": "https://www.ensembl.org/id/ENSG00000196611"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000196611",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000196611",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "P03956",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P03956",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "3.4.24.7",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.24.7&UniProtAcc=P03956",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00094",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00094",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd04278",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04278",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL332",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL332",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "MMP1",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MMP1",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "4312",
"url": "https://www.ncbi.nlm.nih.gov/gene/4312",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "301",
"url": "https://glyconnect.expasy.org/browser/proteins/301",
"database": "GlyConnect",
"categories": [
"Glycoproteomics",
"Glycan"
]
},
{
"id": "7155",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7155",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P03956",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P03956*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000585",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000585",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001818",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001818",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR002477",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002477",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR006026",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR006026",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018486",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018486",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR018487",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR018487",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR021158",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR021158",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR021190",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR021190",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR024079",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR024079",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR033739",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR033739",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036365",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036365",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036375",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036375",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:4312",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4312",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "120353",
"url": "http://www.omim.org/entry/120353",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P03956",
"url": "https://www.nextprot.org/entry/NX_P03956",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "LHGYPKD",
"url": "https://omabrowser.org/oma/group/LHGYPKD/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "391167at2759",
"url": "http://www.orthodb.org/?query=391167at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10201",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR10201:SF151",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10201:SF151",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1AYK",
"url": "https://www.rcsb.org/structure/1AYK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CGE",
"url": "https://www.rcsb.org/structure/1CGE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CGF",
"url": "https://www.rcsb.org/structure/1CGF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1CGL",
"url": "https://www.rcsb.org/structure/1CGL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1HFC",
"url": "https://www.rcsb.org/structure/1HFC",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1SU3",
"url": "https://www.rcsb.org/structure/1SU3",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2AYK",
"url": "https://www.rcsb.org/structure/2AYK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2CLT",
"url": "https://www.rcsb.org/structure/2CLT",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2J0T",
"url": "https://www.rcsb.org/structure/2J0T",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2TCL",
"url": "https://www.rcsb.org/structure/2TCL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3AYK",
"url": "https://www.rcsb.org/structure/3AYK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3SHI",
"url": "https://www.rcsb.org/structure/3SHI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4AUO",
"url": "https://www.rcsb.org/structure/4AUO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4AYK",
"url": "https://www.rcsb.org/structure/4AYK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "966C",
"url": "https://www.rcsb.org/structure/966C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00045",
"url": "http://pfam.xfam.org/family/PF00045",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00413",
"url": "http://pfam.xfam.org/family/PF00413",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF01471",
"url": "http://pfam.xfam.org/family/PF01471",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P03956",
"url": "https://pharos.nih.gov/targets/P03956",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR:000053138",
"url": "https://proconsortium.org/app/entry/PR:000053138",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053139",
"url": "https://proconsortium.org/app/entry/PR:000053139",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053140",
"url": "https://proconsortium.org/app/entry/PR:000053140",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053141",
"url": "https://proconsortium.org/app/entry/PR:000053141",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053142",
"url": "https://proconsortium.org/app/entry/PR:000053142",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053143",
"url": "https://proconsortium.org/app/entry/PR:000053143",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053144",
"url": "https://proconsortium.org/app/entry/PR:000053144",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053145",
"url": "https://proconsortium.org/app/entry/PR:000053145",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053146",
"url": "https://proconsortium.org/app/entry/PR:000053146",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053147",
"url": "https://proconsortium.org/app/entry/PR:000053147",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053148",
"url": "https://proconsortium.org/app/entry/PR:000053148",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053149",
"url": "https://proconsortium.org/app/entry/PR:000053149",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053150",
"url": "https://proconsortium.org/app/entry/PR:000053150",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053151",
"url": "https://proconsortium.org/app/entry/PR:000053151",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053152",
"url": "https://proconsortium.org/app/entry/PR:000053152",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053153",
"url": "https://proconsortium.org/app/entry/PR:000053153",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053154",
"url": "https://proconsortium.org/app/entry/PR:000053154",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053155",
"url": "https://proconsortium.org/app/entry/PR:000053155",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053156",
"url": "https://proconsortium.org/app/entry/PR:000053156",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053157",
"url": "https://proconsortium.org/app/entry/PR:000053157",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053158",
"url": "https://proconsortium.org/app/entry/PR:000053158",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR:000053159",
"url": "https://proconsortium.org/app/entry/PR:000053159",
"database": "PRO",
"categories": [
"Glycoproteomics"
]
},
{
"id": "PR_P03956",
"url": "http://purl.obolibrary.org/obo/PR_P03956",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "P03956",
"url": "DISABLED",
"database": "UniCarbKB",
"categories": [
"Glycoproteomics"
]
},
{
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P03956-1",
"url": "https://www.uniprot.org/uniprot/P03956-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN",
"length": 469,
"header": "sp|P03956-1|MMP1_HUMAN Isoform 1 of Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3 CANONICAL=P03956-1"
},
"isoforms": [
{
"isoform_ac": "P03956-1",
"url": "",
"sequence": {
"sequence": "MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN",
"length": 469,
"header": "sp|P03956-1|MMP1_HUMAN Isoform 1 of Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3 CANONICAL=P03956-1"
},
"locus": {
"chromosome": "11",
"start_pos": 102798092,
"end_pos": 102790415,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000315274.7",
"url": "https://www.ensembl.org/id/ENST00000315274.7"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000322788.6",
"url": "https://www.ensembl.org/id/ENSP00000322788.6"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G02628JF",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G03382KH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G08110WX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G15198VK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G23863VK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G25451PN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G36221RT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G38349VC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G44215PV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G48381WH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G50757KG",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G52880ZN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G56284ZY",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G58268WC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G63381RX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G64706DG",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G70418MS",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G72667IM",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G76012OT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G76136FD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G78059CC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G82592ZH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G85196QC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G85542KD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G93856AJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-120 ; ASN-120",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
]
},
{
"glytoucan_ac": "G95977AE",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "N-linked (GlcNAc...) asparagine",
"start_pos": 120,
"start_aa": "Asn",
"end_pos": 120,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn120",
"evidence": [
{
"id": "P03956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03956#ptm_processing"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
},
{
"id": "10092871",
"database": "Automatic Literature Mining",
"url": "https://research.bioinformatics.udel.edu/glyco/pmid/10092871"
}
]
},
{
"glytoucan_ac": "G07799LX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G08293MJ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G16175ZV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G22310AV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G25418HZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G27126ED",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G30123TP",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G31615DN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G49345XT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G51413EV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G70696MD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G72978AW",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G80223IX",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G84452RH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G88374WZ",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "P03956",
"database": "UniCarbKB",
"url": ""
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G94826KT",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 143,
"start_aa": "Asn",
"end_pos": 143,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn143",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "23345538",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"glytoucan_ac": "G15198VK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G17689DH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G22310AV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G23863VK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G36191CD",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G44215PV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G44444MB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G47871MN",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G50045TK",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G75983OB",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G78059CC",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"glytoucan_ac": "G84452RH",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "",
"evidence": [
{
"id": "301",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
},
{
"id": "10092871",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
}
],
"phosphorylation": [
{
"start_pos": 274,
"end_pos": 274,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
},
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
}
],
"site_lbl": "Thr274"
},
{
"start_pos": 280,
"end_pos": 280,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Ser280"
},
{
"start_pos": 288,
"end_pos": 288,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Thr288"
},
{
"start_pos": 289,
"end_pos": 289,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Thr289"
},
{
"start_pos": 360,
"end_pos": 360,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine; by PKDCC",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
},
{
"database": "PubMed",
"id": "20058876",
"url": "https://glygen.org/publication/PubMed/20058876"
},
{
"database": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
}
],
"site_lbl": "Tyr360"
},
{
"start_pos": 57,
"end_pos": 57,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
},
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
}
],
"site_lbl": "Ser57"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan",
"glycoprotein_reported"
],
"publication": [
{
"title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.",
"journal": "Immunity",
"date": "1999",
"authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10023775",
"url": "https://glygen.org/publication/PubMed/10023775"
}
]
},
{
"title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10026136",
"url": "https://glygen.org/publication/PubMed/10026136"
}
]
},
{
"title": "Antiangiogenic activity of restin, NC10 domain of human collagen XV: comparison to endostatin.",
"journal": "Biochemical and biophysical research communications",
"date": "1999",
"authors": "Ramchandran R, Dhanabal M, Volk R, Waterman MJ, Segal M, Lu H, Knebelmann B, Sukhatme VP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "10049780",
"url": "https://glygen.org/publication/PubMed/10049780"
}
]
},
{
"title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1999",
"authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10077652",
"url": "https://glygen.org/publication/PubMed/10077652"
}
]
},
{
"title": "N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells.",
"journal": "European journal of biochemistry",
"date": "1999",
"authors": "Saarinen J, Welgus HG, Flizar CA, Kalkkinen N, Helin J",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956#ptm_processing"
},
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "UniCarbKB",
"id": "P03956",
"url": ""
},
{
"database": "Automatic Literature Mining",
"id": "10092871",
"url": "https://research.bioinformatics.udel.edu/glyco/pmid/10092871"
},
{
"database": "GlyConnect",
"id": "301",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
],
"reference": [
{
"type": "PubMed",
"id": "10092871",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
},
{
"title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Okabe E, Kajihara J, Usami Y, Hirano K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10218588",
"url": "https://glygen.org/publication/PubMed/10218588"
}
]
},
{
"title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.",
"journal": "Cell",
"date": "1999",
"authors": "Hage T, Sebald W, Reinemer P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10219247",
"url": "https://glygen.org/publication/PubMed/10219247"
}
]
},
{
"title": "Fibrillin degradation by matrix metalloproteinases: implications for connective tissue remodelling.",
"journal": "The Biochemical journal",
"date": "1999",
"authors": "Ashworth JL, Murphy G, Rock MJ, Sherratt MJ, Shapiro SD, Shuttleworth CA, Kielty CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10229672",
"url": "https://glygen.org/publication/PubMed/10229672"
}
]
},
{
"title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.",
"journal": "Molecular immunology",
"date": "1999",
"authors": "Warren WD, Roberts KL, Linehan LA, Berton MT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10369418",
"url": "https://glygen.org/publication/PubMed/10369418"
}
]
},
{
"title": "Fibrillin degradation by matrix metalloproteinases: identification of amino- and carboxy-terminal cleavage sites.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Hindson VJ, Ashworth JL, Rock MJ, Cunliffe S, Shuttleworth CA, Kielty CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10386589",
"url": "https://glygen.org/publication/PubMed/10386589"
}
]
},
{
"title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Stutz AM, Woisetschlager M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10510379",
"url": "https://glygen.org/publication/PubMed/10510379"
}
]
},
{
"title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1999",
"authors": "Gibson TL, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10512690",
"url": "https://glygen.org/publication/PubMed/10512690"
}
]
},
{
"title": "Catalytic activities and substrate specificity of the human membrane type 4 matrix metalloproteinase catalytic domain.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Wang Y, Johnson AR, Ye QZ, Dyer RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "10551873",
"url": "https://glygen.org/publication/PubMed/10551873"
}
]
},
{
"title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10586089",
"url": "https://glygen.org/publication/PubMed/10586089"
}
]
},
{
"title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.",
"journal": "Endocrinology",
"date": "2000",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10614670",
"url": "https://glygen.org/publication/PubMed/10614670"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.",
"journal": "Hormone research",
"date": "1999",
"authors": "Belgorosky A, Rivarola MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10681634",
"url": "https://glygen.org/publication/PubMed/10681634"
}
]
},
{
"title": "EMMPRIN (CD147), an inducer of matrix metalloproteinase synthesis, also binds interstitial collagenase to the tumor cell surface.",
"journal": "Cancer research",
"date": "2000",
"authors": "Guo H, Li R, Zucker S, Toole BP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10706100",
"url": "https://glygen.org/publication/PubMed/10706100"
}
]
},
{
"title": "Biochemical characterization of the catalytic domain of human matrix metalloproteinase 19. Evidence for a role as a potent basement membrane degrading enzyme.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Stracke JO, Hutton M, Stewart M, Pendas AM, Smith B, Lopez-Otin C, Murphy G, Knauper V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "10809722",
"url": "https://glygen.org/publication/PubMed/10809722"
}
]
},
{
"title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.",
"journal": "The Journal of endocrinology",
"date": "2000",
"authors": "Bond JJ, Meka S, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10810289",
"url": "https://glygen.org/publication/PubMed/10810289"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Hutt JA, O'Rourke JP, DeWille J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "10867011",
"url": "https://glygen.org/publication/PubMed/10867011"
}
]
},
{
"title": "Homo-oligomer formation by basigin, an immunoglobulin superfamily member, via its N-terminal immunoglobulin domain.",
"journal": "European journal of biochemistry",
"date": "2000",
"authors": "Yoshida S, Shibata M, Yamamoto S, Hagihara M, Asai N, Takahashi M, Mizutani S, Muramatsu T, Kadomatsu K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "10880960",
"url": "https://glygen.org/publication/PubMed/10880960"
}
]
},
{
"title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10898936",
"url": "https://glygen.org/publication/PubMed/10898936"
}
]
},
{
"title": "Effects of IGFBP-2 overexpression in vitro and in vivo.",
"journal": "Pediatric nephrology (Berlin, Germany)",
"date": "2000",
"authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10912521",
"url": "https://glygen.org/publication/PubMed/10912521"
}
]
},
{
"title": "CD147 is tightly associated with lactate transporters MCT1 and MCT4 and facilitates their cell surface expression.",
"journal": "The EMBO journal",
"date": "2000",
"authors": "Kirk P, Wilson MC, Heddle C, Brown MH, Barclay AN, Halestrap AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "10921872",
"url": "https://glygen.org/publication/PubMed/10921872"
}
]
},
{
"title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.",
"journal": "European journal of biochemistry",
"date": "2000",
"authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10951195",
"url": "https://glygen.org/publication/PubMed/10951195"
}
]
},
{
"title": "Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Nakamura H, Fujii Y, Inoki I, Sugimoto K, Tanzawa K, Matsuki H, Miura R, Yamaguchi Y, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "10986281",
"url": "https://glygen.org/publication/PubMed/10986281"
}
]
},
{
"title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.",
"journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society",
"date": "1998",
"authors": "Angelloz-Nicoud P, Lalou C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "10990447",
"url": "https://glygen.org/publication/PubMed/10990447"
}
]
},
{
"title": "A short sequence in the N-terminal region is required for the trimerization of type XIII collagen and is conserved in other collagenous transmembrane proteins.",
"journal": "The EMBO journal",
"date": "2000",
"authors": "Snellman A, Tu H, Vaisanen T, Kvist AP, Huhtala P, Pihlajaniemi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "11013208",
"url": "https://glygen.org/publication/PubMed/11013208"
}
]
},
{
"title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.",
"journal": "International immunology",
"date": "2000",
"authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11058569",
"url": "https://glygen.org/publication/PubMed/11058569"
}
]
},
{
"title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11084045",
"url": "https://glygen.org/publication/PubMed/11084045"
}
]
},
{
"title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.",
"journal": "The Journal of clinical investigation",
"date": "2000",
"authors": "Bousquet C, Zatelli MC, Melmed S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11104795",
"url": "https://glygen.org/publication/PubMed/11104795"
}
]
},
{
"title": "Generation and degradation of human endostatin proteins by various proteinases.",
"journal": "FEBS letters",
"date": "2000",
"authors": "Ferreras M, Felbor U, Lenhard T, Olsen BR, Delaisse J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "11119712",
"url": "https://glygen.org/publication/PubMed/11119712"
}
]
},
{
"title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.",
"journal": "The Journal of experimental medicine",
"date": "2000",
"authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11120780",
"url": "https://glygen.org/publication/PubMed/11120780"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2001",
"authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11158056",
"url": "https://glygen.org/publication/PubMed/11158056"
}
]
},
{
"title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.",
"journal": "The Journal of endocrinology",
"date": "2001",
"authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11250653",
"url": "https://glygen.org/publication/PubMed/11250653"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11264294",
"url": "https://glygen.org/publication/PubMed/11264294"
}
]
},
{
"title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Madamanchi NR, Li S, Patterson C, Runge MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278437",
"url": "https://glygen.org/publication/PubMed/11278437"
}
]
},
{
"title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Hung W, Elliott B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11278729",
"url": "https://glygen.org/publication/PubMed/11278729"
}
]
},
{
"title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.",
"journal": "Endocrinology",
"date": "2001",
"authors": "Firth SM, Clemmons DR, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11316783",
"url": "https://glygen.org/publication/PubMed/11316783"
}
]
},
{
"title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).",
"journal": "Cytokine",
"date": "2001",
"authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11356008",
"url": "https://glygen.org/publication/PubMed/11356008"
}
]
},
{
"title": "Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Agnihotri R, Crawford HC, Haro H, Matrisian LM, Havrda MC, Liaw L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "11375993",
"url": "https://glygen.org/publication/PubMed/11375993"
}
]
},
{
"title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11404481",
"url": "https://glygen.org/publication/PubMed/11404481"
}
]
},
{
"title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.",
"journal": "Molecular cell",
"date": "2001",
"authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11463377",
"url": "https://glygen.org/publication/PubMed/11463377"
}
]
},
{
"title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.",
"journal": "FEBS letters",
"date": "2001",
"authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11522292",
"url": "https://glygen.org/publication/PubMed/11522292"
}
]
},
{
"title": "Calprotectin inhibits matrix metalloproteinases by sequestration of zinc.",
"journal": "Molecular pathology : MP",
"date": "2001",
"authors": "Isaksen B, Fagerhol MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "11577169",
"url": "https://glygen.org/publication/PubMed/11577169"
}
]
},
{
"title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11606061",
"url": "https://glygen.org/publication/PubMed/11606061"
}
]
},
{
"title": "Fluorescence resonance energy transfer studies on the interaction between the lactate transporter MCT1 and CD147 provide information on the topology and stoichiometry of the complex in situ.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Wilson MC, Meredith D, Halestrap AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "11719518",
"url": "https://glygen.org/publication/PubMed/11719518"
}
]
},
{
"title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.",
"journal": "American journal of physiology. Endocrinology and metabolism",
"date": "2002",
"authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11739083",
"url": "https://glygen.org/publication/PubMed/11739083"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?",
"journal": "Cancer research",
"date": "2001",
"authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11751371",
"url": "https://glygen.org/publication/PubMed/11751371"
}
]
},
{
"title": "Molecular distribution of IGF binding protein-5 in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2002",
"authors": "Baxter RC, Meka S, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "11788658",
"url": "https://glygen.org/publication/PubMed/11788658"
}
]
},
{
"title": "Activation of membrane-type matrix metalloproteinase 3 zymogen by the proprotein convertase furin in the trans-Golgi network.",
"journal": "Cancer research",
"date": "2002",
"authors": "Kang T, Nagase H, Pei D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "11830519",
"url": "https://glygen.org/publication/PubMed/11830519"
}
]
},
{
"title": "Overexpression of alpha(v)beta6 integrin in serous epithelial ovarian cancer regulates extracellular matrix degradation via the plasminogen activation cascade.",
"journal": "Carcinogenesis",
"date": "2002",
"authors": "Ahmed N, Pansino F, Clyde R, Murthi P, Quinn MA, Rice GE, Agrez MV, Mok S, Baker MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "11872628",
"url": "https://glygen.org/publication/PubMed/11872628"
}
]
},
{
"title": "CLAC: a novel Alzheimer amyloid plaque component derived from a transmembrane precursor, CLAC-P/collagen type XXV.",
"journal": "The EMBO journal",
"date": "2002",
"authors": "Hashimoto T, Wakabayashi T, Watanabe A, Kowa H, Hosoda R, Nakamura A, Kanazawa I, Arai T, Takio K, Mann DM, Iwatsubo T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "11927537",
"url": "https://glygen.org/publication/PubMed/11927537"
}
]
},
{
"title": "Active site residues of cyclophilin A are crucial for its signaling activity via CD147.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Yurchenko V, Zybarth G, O'Connor M, Dai WW, Franchin G, Hao T, Guo H, Hung HC, Toole B, Gallay P, Sherry B, Bukrinsky M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "11943775",
"url": "https://glygen.org/publication/PubMed/11943775"
}
]
},
{
"title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.",
"journal": "Oncogene",
"date": "2002",
"authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "11960372",
"url": "https://glygen.org/publication/PubMed/11960372"
}
]
},
{
"title": "Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Velasco G, Cal S, Quesada V, Sanchez LM, Lopez-Otin C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12149247",
"url": "https://glygen.org/publication/PubMed/12149247"
}
]
},
{
"title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.",
"journal": "Journal of leukocyte biology",
"date": "2002",
"authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12223527",
"url": "https://glygen.org/publication/PubMed/12223527"
}
]
},
{
"title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12241545",
"url": "https://glygen.org/publication/PubMed/12241545"
}
]
},
{
"title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12242343",
"url": "https://glygen.org/publication/PubMed/12242343"
}
]
},
{
"title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.",
"journal": "The Journal of endocrinology",
"date": "2002",
"authors": "Mohan S, Baylink DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12379487",
"url": "https://glygen.org/publication/PubMed/12379487"
}
]
},
{
"title": "Cellular actions of the insulin-like growth factor binding proteins.",
"journal": "Endocrine reviews",
"date": "2002",
"authors": "Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12466191",
"url": "https://glygen.org/publication/PubMed/12466191"
}
]
},
{
"title": "The immunoglobulin-superfamily molecule basigin is a binding protein for oligomannosidic carbohydrates: an anti-idiotypic approach.",
"journal": "Journal of neurochemistry",
"date": "2003",
"authors": "Heller M, von der Ohe M, Kleene R, Mohajeri MH, Schachner M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "12558975",
"url": "https://glygen.org/publication/PubMed/12558975"
}
]
},
{
"title": "Loss of types XV and XIX collagen precedes basement membrane invasion in ductal carcinoma of the female breast.",
"journal": "The Journal of pathology",
"date": "2003",
"authors": "Amenta PS, Hadad S, Lee MT, Barnard N, Li D, Myers JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "12579531",
"url": "https://glygen.org/publication/PubMed/12579531"
}
]
},
{
"title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Yang E, Lerner L, Besser D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12600988",
"url": "https://glygen.org/publication/PubMed/12600988"
}
]
},
{
"title": "Membrane type-1-matrix metalloproteinase expressed by prostate carcinoma cells cleaves human laminin-5 beta3 chain and induces cell migration.",
"journal": "Cancer research",
"date": "2003",
"authors": "Udayakumar TS, Chen ML, Bair EL, Von Bredow DC, Cress AE, Nagle RB, Bowden GT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12727852",
"url": "https://glygen.org/publication/PubMed/12727852"
}
]
},
{
"title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.",
"journal": "Endocrinology",
"date": "2003",
"authors": "Payet LD, Wang XH, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12810533",
"url": "https://glygen.org/publication/PubMed/12810533"
}
]
},
{
"title": "STATs dimerize in the absence of phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Braunstein J, Brutsaert S, Olson R, Schindler C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "12832402",
"url": "https://glygen.org/publication/PubMed/12832402"
}
]
},
{
"title": "The calpain system.",
"journal": "Physiological reviews",
"date": "2003",
"authors": "Goll DE, Thompson VF, Li H, Wei W, Cong J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "12843408",
"url": "https://glygen.org/publication/PubMed/12843408"
}
]
},
{
"title": "IGF-binding protein-4: biochemical characteristics and functional consequences.",
"journal": "The Journal of endocrinology",
"date": "2003",
"authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "12904166",
"url": "https://glygen.org/publication/PubMed/12904166"
}
]
},
{
"title": "Interaction of 92-kDa type IV collagenase with the tissue inhibitor of metalloproteinases prevents dimerization, complex formation with interstitial collagenase, and activation of the proenzyme with stromelysin.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Goldberg GI, Strongin A, Collier IE, Genrich LT, Marmer BL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1311314",
"url": "https://glygen.org/publication/PubMed/1311314"
}
]
},
{
"title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Baxter RC, Bayne ML, Cascieri MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1370451",
"url": "https://glygen.org/publication/PubMed/1370451"
}
]
},
{
"title": "Matrix metalloproteinase 3 (stromelysin) activates the precursor for the human matrix metalloproteinase 9.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Ogata Y, Enghild JJ, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1371271",
"url": "https://glygen.org/publication/PubMed/1371271"
}
]
},
{
"title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1992",
"authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "1383255",
"url": "https://glygen.org/publication/PubMed/1383255"
}
]
},
{
"title": "Biochemical characterization of matrilysin. Activation conforms to the stepwise mechanisms proposed for other matrix metalloproteinases.",
"journal": "Biochemistry",
"date": "1992",
"authors": "Crabbe T, Willenbrock F, Eaton D, Hynds P, Carne AF, Murphy G, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1390635",
"url": "https://glygen.org/publication/PubMed/1390635"
}
]
},
{
"title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2003",
"authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14634100",
"url": "https://glygen.org/publication/PubMed/14634100"
}
]
},
{
"title": "Caveolin-1 regulates matrix metalloproteinases-1 induction and CD147/EMMPRIN cell surface clustering.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Tang W, Hemler ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "14707126",
"url": "https://glygen.org/publication/PubMed/14707126"
}
]
},
{
"title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.",
"journal": "Oncogene",
"date": "2004",
"authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "14712222",
"url": "https://glygen.org/publication/PubMed/14712222"
}
]
},
{
"title": "Activation mechanisms of the precursors of matrix metalloproteinases 1, 2 and 3.",
"journal": "Matrix (Stuttgart, Germany). Supplement",
"date": "1992",
"authors": "Nagase H, Suzuki K, Morodomi T, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1480033",
"url": "https://glygen.org/publication/PubMed/1480033"
}
]
},
{
"title": "HtrA1 serine protease inhibits signaling mediated by Tgfbeta family proteins.",
"journal": "Development (Cambridge, England)",
"date": "2004",
"authors": "Oka C, Tsujimoto R, Kajikawa M, Koshiba-Takeuchi K, Ina J, Yano M, Tsuchiya A, Ueta Y, Soma A, Kanda H, Matsumoto M, Kawaichi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "14973287",
"url": "https://glygen.org/publication/PubMed/14973287"
}
]
},
{
"title": "The shed ectodomain of type XIII collagen affects cell behaviour in a matrix-dependent manner.",
"journal": "The Biochemical journal",
"date": "2004",
"authors": "Vaisanen MR, Vaisanen T, Pihlajaniemi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "15005656",
"url": "https://glygen.org/publication/PubMed/15005656"
}
]
},
{
"title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.",
"journal": "Oncogene",
"date": "2004",
"authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15116091",
"url": "https://glygen.org/publication/PubMed/15116091"
}
]
},
{
"title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "2004",
"authors": "Payet LD, Firth SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15126567",
"url": "https://glygen.org/publication/PubMed/15126567"
}
]
},
{
"title": "A novel secreted, cell-surface glycoprotein containing multiple epidermal growth factor-like repeats and one CUB domain is highly expressed in primary osteoblasts and bones.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Wu BT, Su YH, Tsai MT, Wasserman SM, Topper JN, Yang RB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15234972",
"url": "https://glygen.org/publication/PubMed/15234972"
}
]
},
{
"title": "Collagenase unwinds triple-helical collagen prior to peptide bond hydrolysis.",
"journal": "The EMBO journal",
"date": "2004",
"authors": "Chung L, Dinakarpandian D, Yoshida N, Lauer-Fields JL, Fields GB, Visse R, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "15257288",
"url": "https://glygen.org/publication/PubMed/15257288"
}
]
},
{
"title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.",
"journal": "Molecular immunology",
"date": "2004",
"authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15261459",
"url": "https://glygen.org/publication/PubMed/15261459"
}
]
},
{
"title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2004",
"authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15308688",
"url": "https://glygen.org/publication/PubMed/15308688"
}
]
},
{
"title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.",
"journal": "Journal of biochemistry and molecular biology",
"date": "2004",
"authors": "Choi KY, Kyung YJ, Lee CY, Lee DH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15469690",
"url": "https://glygen.org/publication/PubMed/15469690"
}
]
},
{
"title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485880",
"url": "https://glygen.org/publication/PubMed/15485880"
}
]
},
{
"title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.",
"journal": "Journal of molecular endocrinology",
"date": "2004",
"authors": "Headey SJ, Leeding KS, Norton RS, Bach LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15525596",
"url": "https://glygen.org/publication/PubMed/15525596"
}
]
},
{
"title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.",
"journal": "Journal of neurochemistry",
"date": "2004",
"authors": "Borner C, Woltje M, Hollt V, Kraus J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15584925",
"url": "https://glygen.org/publication/PubMed/15584925"
}
]
},
{
"title": "BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Gonzalez EM, Reed CC, Bix G, Fu J, Zhang Y, Gopalakrishnan B, Greenspan DS, Iozzo RV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15591058",
"url": "https://glygen.org/publication/PubMed/15591058"
}
]
},
{
"title": "X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Jozic D, Bourenkov G, Lim NH, Visse R, Nagase H, Bode W, Maskos K",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "15611040",
"url": "https://glygen.org/publication/PubMed/15611040"
}
]
},
{
"title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.",
"journal": "Structure (London, England : 1993)",
"date": "2005",
"authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "15642270",
"url": "https://glygen.org/publication/PubMed/15642270"
}
]
},
{
"title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.",
"journal": "Cancer research",
"date": "2005",
"authors": "Rahaman SO, Vogelbaum MA, Haque SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15805299",
"url": "https://glygen.org/publication/PubMed/15805299"
}
]
},
{
"title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.",
"journal": "Cytokine",
"date": "2005",
"authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15869882",
"url": "https://glygen.org/publication/PubMed/15869882"
}
]
},
{
"title": "Metabolic activation-related CD147-CD98 complex.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2005",
"authors": "Xu D, Hemler ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "15901826",
"url": "https://glygen.org/publication/PubMed/15901826"
}
]
},
{
"title": "Cell surface expression of CD147/EMMPRIN is regulated by cyclophilin 60.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Pushkarsky T, Yurchenko V, Vanpouille C, Brichacek B, Vaisman I, Hatakeyama S, Nakayama KI, Sherry B, Bukrinsky MI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "15946952",
"url": "https://glygen.org/publication/PubMed/15946952"
}
]
},
{
"title": "Generation of biologically active endostatin fragments from human collagen XVIII by distinct matrix metalloproteases.",
"journal": "Experimental cell research",
"date": "2005",
"authors": "Heljasvaara R, Nyberg P, Luostarinen J, Parikka M, Heikkila P, Rehn M, Sorsa T, Salo T, Pihlajaniemi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "15950618",
"url": "https://glygen.org/publication/PubMed/15950618"
}
]
},
{
"title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.",
"journal": "Cancer cell",
"date": "2005",
"authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "15950906",
"url": "https://glygen.org/publication/PubMed/15950906"
}
]
},
{
"title": "ADAM10 mediates E-cadherin shedding and regulates epithelial cell-cell adhesion, migration, and beta-catenin translocation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Maretzky T, Reiss K, Ludwig A, Buchholz J, Scholz F, Proksch E, de Strooper B, Hartmann D, Saftig P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "15958533",
"url": "https://glygen.org/publication/PubMed/15958533"
}
]
},
{
"title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.",
"journal": "Oncogene",
"date": "2005",
"authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16007214",
"url": "https://glygen.org/publication/PubMed/16007214"
}
]
},
{
"title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.",
"journal": "The Biochemical journal",
"date": "2005",
"authors": "Bhattacharya S, Ray RM, Johnson LR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16048438",
"url": "https://glygen.org/publication/PubMed/16048438"
}
]
},
{
"title": "Role of Stat3 in regulating p53 expression and function.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16107692",
"url": "https://glygen.org/publication/PubMed/16107692"
}
]
},
{
"title": "Human glioblastomas overexpress ADAMTS-5 that degrades brevican.",
"journal": "Acta neuropathologica",
"date": "2005",
"authors": "Nakada M, Miyamori H, Kita D, Takahashi T, Yamashita J, Sato H, Miura R, Yamaguchi Y, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16133547",
"url": "https://glygen.org/publication/PubMed/16133547"
}
]
},
{
"title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.",
"journal": "Oncogene",
"date": "2006",
"authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16205632",
"url": "https://glygen.org/publication/PubMed/16205632"
}
]
},
{
"title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.",
"journal": "Genes to cells : devoted to molecular & cellular mechanisms",
"date": "2005",
"authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16236134",
"url": "https://glygen.org/publication/PubMed/16236134"
}
]
},
{
"title": "Mechanisms regulating tissue-specific polarity of monocarboxylate transporters and their chaperone CD147 in kidney and retinal epithelia.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005",
"authors": "Deora AA, Philp N, Hu J, Bok D, Rodriguez-Boulan E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "16260747",
"url": "https://glygen.org/publication/PubMed/16260747"
}
]
},
{
"title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2006",
"authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16397018",
"url": "https://glygen.org/publication/PubMed/16397018"
}
]
},
{
"title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.",
"journal": "Tissue antigens",
"date": "2006",
"authors": "Davey GM, Heath WR, Starr R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16451196",
"url": "https://glygen.org/publication/PubMed/16451196"
}
]
},
{
"title": "Interstitial collagenase (matrix metalloproteinase-1) expresses serpinase activity.",
"journal": "The Journal of clinical investigation",
"date": "1991",
"authors": "Desrochers PE, Jeffrey JJ, Weiss SJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "1645757",
"url": "https://glygen.org/publication/PubMed/1645757"
}
]
},
{
"title": "Matrix metalloproteinase degradation of elastin, type IV collagen and proteoglycan. A quantitative comparison of the activities of 95 kDa and 72 kDa gelatinases, stromelysins-1 and -2 and punctuated metalloproteinase (PUMP).",
"journal": "The Biochemical journal",
"date": "1991",
"authors": "Murphy G, Cockett MI, Ward RV, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1649600",
"url": "https://glygen.org/publication/PubMed/1649600"
}
]
},
{
"title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.",
"journal": "Cancer research",
"date": "2006",
"authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16510571",
"url": "https://glygen.org/publication/PubMed/16510571"
}
]
},
{
"title": "Signaling mechanisms, interaction partners, and target genes of STAT6.",
"journal": "Cytokine & growth factor reviews",
"date": "2006",
"authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16540365",
"url": "https://glygen.org/publication/PubMed/16540365"
}
]
},
{
"title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.",
"journal": "The Journal of experimental medicine",
"date": "2006",
"authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "16606674",
"url": "https://glygen.org/publication/PubMed/16606674"
}
]
},
{
"title": "Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.",
"journal": "Experimental cell research",
"date": "2006",
"authors": "Samanna V, Wei H, Ego-Osuala D, Chellaiah MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16631740",
"url": "https://glygen.org/publication/PubMed/16631740"
}
]
},
{
"title": "Interaction of HIV Tat and matrix metalloproteinase in HIV neuropathogenesis: a new host defense mechanism.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2006-08",
"authors": "Rumbaugh J, Turchan-Cholewo J, Galey D, St Hillaire C, Anderson C, Conant K, Nath A",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "16807369",
"url": "https://glygen.org/publication/PubMed/16807369"
}
]
},
{
"title": "TIMP independence of matrix metalloproteinase (MMP)-2 activation by membrane type 2 (MT2)-MMP is determined by contributions of both the MT2-MMP catalytic and hemopexin C domains.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Morrison CJ, Overall CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "16825197",
"url": "https://glygen.org/publication/PubMed/16825197"
}
]
},
{
"title": "Cathepsin s promotes human preadipocyte differentiation: possible involvement of fibronectin degradation.",
"journal": "Endocrinology",
"date": "2006",
"authors": "Taleb S, Cancello R, Clement K, Lacasa D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "16825321",
"url": "https://glygen.org/publication/PubMed/16825321"
}
]
},
{
"title": "Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1698775",
"url": "https://glygen.org/publication/PubMed/1698775"
}
]
},
{
"title": "Increased gene expression of matrix metalloproteinase-3 (stromelysin) in skin fibroblasts from patients with severe recessive dystrophic epidermolysis bullosa.",
"journal": "Biochemical and biophysical research communications",
"date": "1991",
"authors": "Sawamura D, Sugawara T, Hashimoto I, Bruckner-Tuderman L, Fujimoto D, Okada Y, Utsumi N, Shikata H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "1704217",
"url": "https://glygen.org/publication/PubMed/1704217"
}
]
},
{
"title": "The role of insulin-like growth factor binding proteins.",
"journal": "Neuroendocrinology",
"date": "2006",
"authors": "Holly J, Perks C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17047378",
"url": "https://glygen.org/publication/PubMed/17047378"
}
]
},
{
"title": "Hyaluronan and its binding proteins, the hyaladherins.",
"journal": "Current opinion in cell biology",
"date": "1990",
"authors": "Toole BP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "1707285",
"url": "https://glygen.org/publication/PubMed/1707285"
}
]
},
{
"title": "Enzymatic processing of collagen IV by MMP-2 (gelatinase A) affects neutrophil migration and it is modulated by extracatalytic domains.",
"journal": "Protein science : a publication of the Protein Society",
"date": "2006",
"authors": "Monaco S, Sparano V, Gioia M, Sbardella D, Di Pierro D, Marini S, Coletta M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "17088321",
"url": "https://glygen.org/publication/PubMed/17088321"
}
]
},
{
"title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Gyrup C, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17249697",
"url": "https://glygen.org/publication/PubMed/17249697"
}
]
},
{
"title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2007",
"authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17312271",
"url": "https://glygen.org/publication/PubMed/17312271"
}
]
},
{
"title": "Engagement of collagen-binding integrins promotes matrix metalloproteinase-9-dependent E-cadherin ectodomain shedding in ovarian carcinoma cells.",
"journal": "Cancer research",
"date": "2007",
"authors": "Symowicz J, Adley BP, Gleason KJ, Johnson JJ, Ghosh S, Fishman DA, Hudson LG, Stack MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17332331",
"url": "https://glygen.org/publication/PubMed/17332331"
}
]
},
{
"title": "Kallikrein 7 enhances pancreatic cancer cell invasion by shedding E-cadherin.",
"journal": "Cancer",
"date": "2007",
"authors": "Johnson SK, Ramani VC, Hennings L, Haun RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17354228",
"url": "https://glygen.org/publication/PubMed/17354228"
}
]
},
{
"title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.",
"journal": "Journal of cellular biochemistry",
"date": "2007",
"authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17427945",
"url": "https://glygen.org/publication/PubMed/17427945"
}
]
},
{
"title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.",
"journal": "European journal of immunology",
"date": "2007",
"authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17458857",
"url": "https://glygen.org/publication/PubMed/17458857"
}
]
},
{
"title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.",
"journal": "Molecular immunology",
"date": "2008",
"authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "17572495",
"url": "https://glygen.org/publication/PubMed/17572495"
}
]
},
{
"title": "The calpains: modular designs and functional diversity.",
"journal": "Genome biology",
"date": "2007",
"authors": "Croall DE, Ersfeld K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "17608959",
"url": "https://glygen.org/publication/PubMed/17608959"
}
]
},
{
"title": "Substrate specificities and activation mechanisms of matrix metalloproteinases.",
"journal": "Biochemical Society transactions",
"date": "1991",
"authors": "Nagase H, Ogata Y, Suzuki K, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "1783204",
"url": "https://glygen.org/publication/PubMed/1783204"
}
]
},
{
"title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.",
"journal": "Biochemistry",
"date": "2007",
"authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "17985932",
"url": "https://glygen.org/publication/PubMed/17985932"
}
]
},
{
"title": "LFA-1-mediated leukocyte adhesion regulated by interaction of CD43 with LFA-1 and CD147.",
"journal": "Molecular immunology",
"date": "2008",
"authors": "Khunkaewla P, Schiller HB, Paster W, Leksa V, Cermak L, Andera L, Horejsi V, Stockinger H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "17996943",
"url": "https://glygen.org/publication/PubMed/17996943"
}
]
},
{
"title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.",
"journal": "Cell",
"date": "2008",
"authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18243101",
"url": "https://glygen.org/publication/PubMed/18243101"
}
]
},
{
"title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18353781",
"url": "https://glygen.org/publication/PubMed/18353781"
}
]
},
{
"title": "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Najy AJ, Day KC, Day ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "18434311",
"url": "https://glygen.org/publication/PubMed/18434311"
}
]
},
{
"title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.",
"journal": "Stem cells and development",
"date": "2008",
"authors": "Foshay KM, Gallicano GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18447642",
"url": "https://glygen.org/publication/PubMed/18447642"
}
]
},
{
"title": "Matrix metalloproteinase-11/stromelysin-3 exhibits collagenolytic function against collagen VI under normal and malignant conditions.",
"journal": "Oncogene",
"date": "2008",
"authors": "Motrescu ER, Blaise S, Etique N, Messaddeq N, Chenard MP, Stoll I, Tomasetto C, Rio MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "18622425",
"url": "https://glygen.org/publication/PubMed/18622425"
}
]
},
{
"title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.",
"journal": "Molecular cancer research : MCR",
"date": "2008",
"authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "18644974",
"url": "https://glygen.org/publication/PubMed/18644974"
}
]
},
{
"title": "Caspase-3 activation triggers extracellular cathepsin L release and endorepellin proteolysis.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Cailhier JF, Sirois I, Laplante P, Lepage S, Raymond MA, Brassard N, Prat A, Iozzo RV, Pshezhetsky AV, Hebert MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "18658137",
"url": "https://glygen.org/publication/PubMed/18658137"
}
]
},
{
"title": "Membrane-type 1 matrix metalloproteinase regulates macrophage-dependent elastolytic activity and aneurysm formation in vivo.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Xiong W, Knispel R, MacTaggart J, Greiner TC, Weiss SJ, Baxter BT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19010778",
"url": "https://glygen.org/publication/PubMed/19010778"
}
]
},
{
"title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.",
"journal": "Molecular immunology",
"date": "2009",
"authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19124156",
"url": "https://glygen.org/publication/PubMed/19124156"
}
]
},
{
"title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.",
"journal": "Cancer cell",
"date": "2009",
"authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19185846",
"url": "https://glygen.org/publication/PubMed/19185846"
}
]
},
{
"title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.",
"journal": "The Biochemical journal",
"date": "2009",
"authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "19397496",
"url": "https://glygen.org/publication/PubMed/19397496"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "MT1-MMP-mediated cleavage of decorin in corneal angiogenesis.",
"journal": "Journal of vascular research",
"date": "2009",
"authors": "Mimura T, Han KY, Onguchi T, Chang JH, Kim TI, Kojima T, Zhou Z, Azar DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19571574",
"url": "https://glygen.org/publication/PubMed/19571574"
}
]
},
{
"title": "Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Chamberland A, Wang E, Jones AR, Collins-Racie LA, LaVallie ER, Huang Y, Liu L, Morris EA, Flannery CR, Yang Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19657146",
"url": "https://glygen.org/publication/PubMed/19657146"
}
]
},
{
"title": "ADAM-8 isolated from human osteoarthritic chondrocytes cleaves fibronectin at Ala(271).",
"journal": "Arthritis and rheumatism",
"date": "2009",
"authors": "Zack MD, Malfait AM, Skepner AP, Yates MP, Griggs DW, Hall T, Hills RL, Alston JT, Nemirovskiy OV, Radabaugh MR, Leone JW, Arner EC, Tortorella MD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "19714641",
"url": "https://glygen.org/publication/PubMed/19714641"
}
]
},
{
"title": "Sites of stromelysin cleavage in collagen types II, IX, X, and XI of cartilage.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Wu JJ, Lark MW, Chun LE, Eyre DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2005102",
"url": "https://glygen.org/publication/PubMed/2005102"
}
]
},
{
"title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.",
"journal": "Analytical chemistry",
"date": "2010",
"authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ",
"evidence": [
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "20058876",
"url": "https://glygen.org/publication/PubMed/20058876"
}
]
},
{
"title": "Matrix metalloproteinase-19 is highly expressed in astroglial tumors and promotes invasion of glioma cells.",
"journal": "Journal of neuropathology and experimental neurology",
"date": "2010",
"authors": "Lettau I, Hattermann K, Held-Feindt J, Brauer R, Sedlacek R, Mentlein R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "20142769",
"url": "https://glygen.org/publication/PubMed/20142769"
}
]
},
{
"title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.",
"journal": "Immunity",
"date": "2010",
"authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "20493732",
"url": "https://glygen.org/publication/PubMed/20493732"
}
]
},
{
"title": "Expanding members and roles of the calpain superfamily and their genetically modified animals.",
"journal": "Experimental animals",
"date": "2010",
"authors": "Sorimachi H, Hata S, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21030783",
"url": "https://glygen.org/publication/PubMed/21030783"
}
]
},
{
"title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.",
"journal": "Nature medicine",
"date": "2010",
"authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21102457",
"url": "https://glygen.org/publication/PubMed/21102457"
}
]
},
{
"title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.",
"journal": "Circulation research",
"date": "2011",
"authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21252155",
"url": "https://glygen.org/publication/PubMed/21252155"
}
]
},
{
"title": "Substrate-induced remodeling of the active site regulates human HTRA1 activity.",
"journal": "Nature structural & molecular biology",
"date": "2011",
"authors": "Truebestein L, Tennstaedt A, Monig T, Krojer T, Canellas F, Kaiser M, Clausen T, Ehrmann M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21297635",
"url": "https://glygen.org/publication/PubMed/21297635"
}
]
},
{
"title": "SCUBE3 is an endogenous TGF-beta receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.",
"journal": "Oncogene",
"date": "2011",
"authors": "Wu YY, Peck K, Chang YL, Pan SH, Cheng YF, Lin JC, Yang RB, Hong TM, Yang PC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21441952",
"url": "https://glygen.org/publication/PubMed/21441952"
}
]
},
{
"title": "Multiple modes of activation of latent human fibroblast collagenase: evidence for the role of a Cys73 active-site zinc complex in latency and a `cysteine switch` mechanism for activation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1990-01",
"authors": "Springman E B, Angleton E L, Birkedal-Hansen H, Van Wart H E",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "2153297",
"url": "https://glygen.org/publication/PubMed/2153297"
}
]
},
{
"title": "Extracellular matrix composition and remodeling in human abdominal aortic aneurysms: a proteomics approach.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2011",
"authors": "Didangelos A, Yin X, Mandal K, Saje A, Smith A, Xu Q, Jahangiri M, Mayr M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "21593211",
"url": "https://glygen.org/publication/PubMed/21593211"
}
]
},
{
"title": "Characterization and activation of procollagenase from human polymorphonuclear leucocytes. N-terminal sequence determination of the proenzyme and various proteolytically activated forms.",
"journal": "European journal of biochemistry",
"date": "1990",
"authors": "Knauper V, Kramer S, Reinke H, Tschesche H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2159879",
"url": "https://glygen.org/publication/PubMed/2159879"
}
]
},
{
"title": "Calpain chronicle--an enzyme family under multidisciplinary characterization.",
"journal": "Proceedings of the Japan Academy. Series B, Physical and biological sciences",
"date": "2011",
"authors": "Sorimachi H, Hata S, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21670566",
"url": "https://glygen.org/publication/PubMed/21670566"
}
]
},
{
"title": "Cloning and characterization of human tumor cell interstitial collagenase.",
"journal": "Cancer Res.",
"date": "1990",
"authors": "Templeton NS, Brown PD, Levy AT, Margulies IM, Liotta LA, Stetler-Stevenson WG",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "2167156",
"url": "https://glygen.org/publication/PubMed/2167156"
}
]
},
{
"title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.",
"journal": "Biochimica et biophysica acta",
"date": "2011",
"authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21689689",
"url": "https://glygen.org/publication/PubMed/21689689"
}
]
},
{
"title": "The role of matrix metalloproteinase 3 in the stepwise activation of human rheumatoid synovial procollagenase.",
"journal": "Biological chemistry Hoppe-Seyler",
"date": "1990",
"authors": "Suzuki K, Nagase H, Ito A, Enghild JJ, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2169257",
"url": "https://glygen.org/publication/PubMed/2169257"
}
]
},
{
"title": "Tumor promoter-stimulated Mr 92,000 gelatinase secreted by normal and malignant human cells: isolation and characterization of the enzyme from HT1080 tumor cells.",
"journal": "Cancer research",
"date": "1990",
"authors": "Moll UM, Youngleib GL, Rosinski KB, Quigley JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2169335",
"url": "https://glygen.org/publication/PubMed/2169335"
}
]
},
{
"title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21730069",
"url": "https://glygen.org/publication/PubMed/21730069"
}
]
},
{
"title": "Mechanisms of activation of tissue procollagenase by matrix metalloproteinase 3 (stromelysin).",
"journal": "Biochemistry",
"date": "1990",
"authors": "Suzuki K, Enghild JJ, Morodomi T, Salvesen G, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2176865",
"url": "https://glygen.org/publication/PubMed/2176865"
}
]
},
{
"title": "Classical and neonatal Marfan syndrome mutations in fibrillin-1 cause differential protease susceptibilities and protein function.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Kirschner R, Hubmacher D, Iyengar G, Kaur J, Fagotto-Kaufmann C, Bromme D, Bartels R, Reinhardt DP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21784848",
"url": "https://glygen.org/publication/PubMed/21784848"
}
]
},
{
"title": "Calpains: an elaborate proteolytic system.",
"journal": "Biochimica et biophysica acta",
"date": "2012",
"authors": "Ono Y, Sorimachi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "21864727",
"url": "https://glygen.org/publication/PubMed/21864727"
}
]
},
{
"title": "MMP mediated degradation of type VI collagen is highly associated with liver fibrosis--identification and validation of a novel biochemical marker assay.",
"journal": "PloS one",
"date": "2011",
"authors": "Veidal SS, Karsdal MA, Vassiliadis E, Nawrocki A, Larsen MR, Nguyen QH, Hagglund P, Luo Y, Zheng Q, Vainer B, Leeming DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "21935455",
"url": "https://glygen.org/publication/PubMed/21935455"
}
]
},
{
"title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Snyder M, Huang XY, Zhang JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21937440",
"url": "https://glygen.org/publication/PubMed/21937440"
}
]
},
{
"title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.",
"journal": "Molecular cancer research : MCR",
"date": "2011",
"authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "21994466",
"url": "https://glygen.org/publication/PubMed/21994466"
}
]
},
{
"title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.",
"journal": "PloS one",
"date": "2011",
"authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22046235",
"url": "https://glygen.org/publication/PubMed/22046235"
}
]
},
{
"title": "MT1-MMP regulates the turnover and endocytosis of extracellular matrix fibronectin.",
"journal": "Journal of cell science",
"date": "2011",
"authors": "Shi F, Sottile J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "22159414",
"url": "https://glygen.org/publication/PubMed/22159414"
}
]
},
{
"title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22205702",
"url": "https://glygen.org/publication/PubMed/22205702"
}
]
},
{
"title": "Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Veiga-da-Cunha M, Hadi F, Balligand T, Stroobant V, Van Schaftingen E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "22241472",
"url": "https://glygen.org/publication/PubMed/22241472"
}
]
},
{
"title": "MMP mediated type V collagen degradation (C5M) is elevated in ankylosing spondylitis.",
"journal": "Clinical biochemistry",
"date": "2012",
"authors": "Veidal SS, Larsen DV, Chen X, Sun S, Zheng Q, Bay-Jensen AC, Leeming DJ, Nawrocki A, Larsen MR, Schett G, Karsdal MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "22382088",
"url": "https://glygen.org/publication/PubMed/22382088"
}
]
},
{
"title": "The Jak/STAT pathway.",
"journal": "Cold Spring Harbor perspectives in biology",
"date": "2012",
"authors": "Harrison DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22383755",
"url": "https://glygen.org/publication/PubMed/22383755"
}
]
},
{
"title": "Purification and characterization of extracellular matrix-degrading metalloproteinase, matrin (pump-1), secreted from human rectal carcinoma cell line.",
"journal": "Cancer research",
"date": "1990",
"authors": "Miyazaki K, Hattori Y, Umenishi F, Yasumitsu H, Umeda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2253219",
"url": "https://glygen.org/publication/PubMed/2253219"
}
]
},
{
"title": "Matrix metalloproteinase 2 from human rheumatoid synovial fibroblasts. Purification and activation of the precursor and enzymic properties.",
"journal": "European journal of biochemistry",
"date": "1990",
"authors": "Okada Y, Morodomi T, Enghild JJ, Suzuki K, Yasui A, Nakanishi I, Salvesen G, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2269296",
"url": "https://glygen.org/publication/PubMed/2269296"
}
]
},
{
"title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.",
"journal": "Molecular carcinogenesis",
"date": "2013",
"authors": "Han W, Carpenter RL, Cao X, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22693070",
"url": "https://glygen.org/publication/PubMed/22693070"
}
]
},
{
"title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.",
"journal": "Molecular and cellular biology",
"date": "2012",
"authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "22851691",
"url": "https://glygen.org/publication/PubMed/22851691"
}
]
},
{
"title": "Structure-function relationships in calpains.",
"journal": "The Biochemical journal",
"date": "2012",
"authors": "Campbell RL, Davies PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "23035980",
"url": "https://glygen.org/publication/PubMed/23035980"
}
]
},
{
"title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.",
"journal": "Angiogenesis",
"date": "2013",
"authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23086340",
"url": "https://glygen.org/publication/PubMed/23086340"
}
]
},
{
"title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.",
"journal": "Free radical biology & medicine",
"date": "2013",
"authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23124025",
"url": "https://glygen.org/publication/PubMed/23124025"
}
]
},
{
"title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.",
"journal": "Carcinogenesis",
"date": "2013",
"authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23172665",
"url": "https://glygen.org/publication/PubMed/23172665"
}
]
},
{
"title": "Glycoproteomic analysis of the secretome of human endothelial cells.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2013",
"authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M",
"evidence": [
{
"database": "UniCarbKB",
"id": "P03956",
"url": ""
},
{
"database": "GlyConnect",
"id": "301",
"url": "https://glyconnect.expasy.org/browser/proteins/301"
}
],
"reference": [
{
"type": "PubMed",
"id": "23345538",
"url": "https://glygen.org/publication/PubMed/23345538"
}
]
},
{
"title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.",
"journal": "Oncogene",
"date": "2014",
"authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23455323",
"url": "https://glygen.org/publication/PubMed/23455323"
}
]
},
{
"title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.",
"journal": "PloS one",
"date": "2013",
"authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23555662",
"url": "https://glygen.org/publication/PubMed/23555662"
}
]
},
{
"title": "Stepwise activation mechanisms of the precursor of matrix metalloproteinase 3 (stromelysin) by proteinases and (4-aminophenyl)mercuric acetate.",
"journal": "Biochemistry",
"date": "1990",
"authors": "Nagase H, Enghild JJ, Suzuki K, Salvesen G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2383557",
"url": "https://glygen.org/publication/PubMed/2383557"
}
]
},
{
"title": "Characterization of opticin digestion by proteases involved in osteoarthritis development.",
"journal": "Joint, bone, spine : revue du rhumatisme",
"date": "2014",
"authors": "Tio L, Martel-Pelletier J, Pelletier JP, Bishop PN, Roughley P, Farran A, Benito P, Monfort J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "23845380",
"url": "https://glygen.org/publication/PubMed/23845380"
}
]
},
{
"title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.",
"journal": "PloS one",
"date": "2013",
"authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "23967200",
"url": "https://glygen.org/publication/PubMed/23967200"
}
]
},
{
"title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.",
"journal": "Journal of molecular medicine (Berlin, Germany)",
"date": "2014",
"authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24097101",
"url": "https://glygen.org/publication/PubMed/24097101"
}
]
},
{
"title": "STAT3 Target Genes Relevant to Human Cancers.",
"journal": "Cancers",
"date": "2014",
"authors": "Carpenter RL, Lo HW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "24743777",
"url": "https://glygen.org/publication/PubMed/24743777"
}
]
},
{
"title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1989",
"authors": "Baxter RC, Martin JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2476804",
"url": "https://glygen.org/publication/PubMed/2476804"
}
]
},
{
"title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).",
"journal": "The EMBO journal",
"date": "1989",
"authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "2479552",
"url": "https://glygen.org/publication/PubMed/2479552"
}
]
},
{
"title": "A secreted tyrosine kinase acts in the extracellular environment.",
"journal": "Cell",
"date": "2014",
"authors": "Bordoli MR, Yum J, Breitkopf SB, Thon JN, Italiano JE Jr, Xiao J, Worby C, Wong SK, Lin G, Edenius M, Keller TL, Asara JM, Dixon JE, Yeo CY, Whitman M",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "iPTMnet",
"id": "P03956",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
}
]
},
{
"title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.",
"journal": "Hepatology (Baltimore, Md.)",
"date": "2015",
"authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "25234944",
"url": "https://glygen.org/publication/PubMed/25234944"
}
]
},
{
"title": "Cleavage of type VII collagen by interstitial collagenase and type IV collagenase (gelatinase) derived from human skin.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Seltzer JL, Eisen AZ, Bauer EA, Morris NP, Glanville RW, Burgeson RE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2537292",
"url": "https://glygen.org/publication/PubMed/2537292"
}
]
},
{
"title": "Activation of neutrophil collagenase by cathepsin G.",
"journal": "Inflammation",
"date": "1989",
"authors": "Capodici C, Muthukumaran G, Amoruso MA, Berg RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2546891",
"url": "https://glygen.org/publication/PubMed/2546891"
}
]
},
{
"title": "Human and rat malignant-tumor-associated mRNAs encode stromelysin-like metalloproteinases.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Nicholson R, Murphy G, Breathnach R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2548603",
"url": "https://glygen.org/publication/PubMed/2548603"
}
]
},
{
"title": "SV40-transformed human lung fibroblasts secrete a 92-kDa type IV collagenase which is identical to that secreted by normal human macrophages.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Wilhelm SM, Collier IE, Marmer BL, Eisen AZ, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2551898",
"url": "https://glygen.org/publication/PubMed/2551898"
}
]
},
{
"title": "Tissue kallikrein effectively activates latent matrix degrading metalloenzymes.",
"journal": "Advances in experimental medicine and biology",
"date": "1989",
"authors": "Tschesche H, Michaelis J, Kohnert U, Fedrowitz J, Oberhoff R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "2557753",
"url": "https://glygen.org/publication/PubMed/2557753"
}
]
},
{
"title": "Fragments of human fibroblast collagenase. Purification and characterization.",
"journal": "The Biochemical journal",
"date": "1989",
"authors": "Clark IM, Cawston TE",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "2557822",
"url": "https://glygen.org/publication/PubMed/2557822"
}
]
},
{
"title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.",
"journal": "Cell",
"date": "2015",
"authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "26091039",
"url": "https://glygen.org/publication/PubMed/26091039"
}
]
},
{
"title": "H-ras oncogene-transformed human bronchial epithelial cells (TBE-1) secrete a single metalloprotease capable of degrading basement membrane collagen.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Collier IE, Wilhelm SM, Eisen AZ, Marmer BL, Grant GA, Seltzer JL, Kronberger A, He CS, Bauer EA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2834383",
"url": "https://glygen.org/publication/PubMed/2834383"
}
]
},
{
"title": "Purification of a gelatin-degrading type IV collagenase secreted by ras oncogene-transformed fibroblasts.",
"journal": "Journal of the National Cancer Institute",
"date": "1988",
"authors": "Spinucci C, Zucker S, Wieman JM, Lysik RM, Imhof B, Ramamurthy N, Liotta LA, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "2845110",
"url": "https://glygen.org/publication/PubMed/2845110"
}
]
},
{
"title": "Human fibroblast collagenase. Complete primary structure and homology to an oncogene transformation-induced rat protein.",
"journal": "J. Biol. Chem.",
"date": "1986",
"authors": "Goldberg G I, Wilhelm S M, Kronberger A, Bauer E A, Grant G A, Eisen A Z",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "3009463",
"url": "https://glygen.org/publication/PubMed/3009463"
}
]
},
{
"title": "Molecular cloning of human synovial cell collagenase and selection of a single gene from genomic DNA.",
"journal": "J. Clin. Invest.",
"date": "1987",
"authors": "Brinckerhoff C E, Ruby P L, Austin S D, Fini M E, White H D",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "3027129",
"url": "https://glygen.org/publication/PubMed/3027129"
}
]
},
{
"title": "Comparison of human stromelysin and collagenase by cloning and sequence analysis.",
"journal": "Biochem. J.",
"date": "1986",
"authors": "Whitham S E, Murphy G, Angel P, Rahmsdorf H J, Smith B J, Lyons A, Harris T J, Reynolds J J, Herrlich P, Docherty A J",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "3030290",
"url": "https://glygen.org/publication/PubMed/3030290"
}
]
},
{
"title": "Human fibroblast collagenase contains an amino acid sequence homologous to the zinc-binding site of Serratia protease.",
"journal": "J. Biol. Chem.",
"date": "1987",
"authors": "McKerrow J H",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "3032950",
"url": "https://glygen.org/publication/PubMed/3032950"
}
]
},
{
"title": "12-O-tetradecanoyl-phorbol-13-acetate induction of the human collagenase gene is mediated by an inducible enhancer element located in the 5'-flanking region.",
"journal": "Mol. Cell. Biol.",
"date": "1987",
"authors": "Angel P, Baumann I, Stein B, Delius H, Rahmsdorf H J, Herrlich P",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "3037355",
"url": "https://glygen.org/publication/PubMed/3037355"
}
]
},
{
"title": "The collagen substrate specificity of human neutrophil collagenase.",
"journal": "The Journal of biological chemistry",
"date": "1987",
"authors": "Hasty KA, Jeffrey JJ, Hibbs MS, Welgus HG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "3038863",
"url": "https://glygen.org/publication/PubMed/3038863"
}
]
},
{
"title": "The precursor of a metalloendopeptidase from human rheumatoid synovial fibroblasts. Purification and mechanisms of activation by endopeptidases and 4-aminophenylmercuric acetate.",
"journal": "The Biochemical journal",
"date": "1988",
"authors": "Okada Y, Harris ED Jr, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "3058116",
"url": "https://glygen.org/publication/PubMed/3058116"
}
]
},
{
"title": "Degradation of basement membranes by human matrix metalloproteinase 3 (stromelysin).",
"journal": "The Biochemical journal",
"date": "1988",
"authors": "Bejarano PA, Noelken ME, Suzuki K, Hudson BG, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "3223920",
"url": "https://glygen.org/publication/PubMed/3223920"
}
]
},
{
"title": "Involvement of matrix metalloproteinase 1 and urokinase-type plasminogen activator in the PKC\u03b1-p38 MAPK pathway-mediated progression of human liver cancer cells.",
"journal": "Drug development research",
"date": "2023-04-02",
"authors": "Ye Je-Chiuan, Hsieh Yih-Shou, Chen Pei-Ni, Liu Jer-Yuh, Hsieh Yi-Hsien",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
}
],
"reference": [
{
"type": "PubMed",
"id": "37005497",
"url": "https://glygen.org/publication/PubMed/37005497"
}
]
},
{
"title": "Increased Matrix Metalloproteinase-1 Activation Enhances Disruption and Regression of k-RasV12-Expressing Arteriovenous Malformation-Like Vessels.",
"journal": "The American journal of pathology",
"date": "2023-09",
"authors": "Sun Zheying, Lin Prisca K, Yrigoin Ksenia, Kemp Scott S, Davis George E",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
}
],
"reference": [
{
"type": "PubMed",
"id": "37328101",
"url": "https://glygen.org/publication/PubMed/37328101"
}
]
},
{
"title": "N-acetyltransferase 10 promotes the progression of oral squamous cell carcinoma through N4-acetylcytidine RNA acetylation of MMP1 mRNA.",
"journal": "Cancer science",
"date": "2023-11",
"authors": "Liu Yi, Huang Hui, Zhang Cun-Bao, Fan Hua-Nan",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
}
],
"reference": [
{
"type": "PubMed",
"id": "37705232",
"url": "https://glygen.org/publication/PubMed/37705232"
}
]
},
{
"title": "Association of Matrix Metalloproteinase-1 Promoter Polymorphisms With Asthma Risk.",
"journal": "In vivo (Athens, Greece)",
"date": "2024",
"authors": "Chen Li-Hsiou, Li Chia-Hsiang, Wang Shou-Cheng, Chiu Kuo-Liang, Wu Meng-Feng, Yang Jai-Sing, Tsai Chia-Wen, Chang Wen-Shin, Hsia Te-Chun, Bau DA-Tian",
"evidence": [
{
"database": "RefSeq",
"id": "NP_002412",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_002412"
}
],
"reference": [
{
"type": "PubMed",
"id": "38148093",
"url": "https://glygen.org/publication/PubMed/38148093"
}
]
},
{
"title": "Presence of a gelatin-specific proteinase and its latent form in human leucocytes.",
"journal": "Biochimica et biophysica acta",
"date": "1974",
"authors": "Sopata I, Dancewicz AM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "4216367",
"url": "https://glygen.org/publication/PubMed/4216367"
}
]
},
{
"title": "Partial purification and characterization of a neutral protease which cleaves type IV collagen.",
"journal": "Biochemistry",
"date": "1981",
"authors": "Liotta LA, Tryggvason K, Garbisa S, Robey PG, Abe S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "6258630",
"url": "https://glygen.org/publication/PubMed/6258630"
}
]
},
{
"title": "The latent collagenase and gelatinase of human polymorphonuclear neutrophil leucocytes.",
"journal": "The Biochemical journal",
"date": "1980",
"authors": "Murphy G, Bretz U, Baggiolini M, Reynolds JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "6263256",
"url": "https://glygen.org/publication/PubMed/6263256"
}
]
},
{
"title": "The collagen substrate specificity of human skin fibroblast collagenase.",
"journal": "The Journal of biological chemistry",
"date": "1981",
"authors": "Welgus HG, Jeffrey JJ, Eisen AZ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "6270089",
"url": "https://glygen.org/publication/PubMed/6270089"
}
]
},
{
"title": "Type VIII collagen. Synthesis by normal and malignant cells in culture.",
"journal": "Laboratory investigation; a journal of technical methods and pathology",
"date": "1984",
"authors": "Sage H, Balian G, Vogel AM, Bornstein P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "6694361",
"url": "https://glygen.org/publication/PubMed/6694361"
}
]
},
{
"title": "Characterization of the binding domains in the fragments cleaved by cathepsin G from human plasma fibronectin.",
"journal": "European journal of biochemistry",
"date": "1982",
"authors": "Vartio T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "7075587",
"url": "https://glygen.org/publication/PubMed/7075587"
}
]
},
{
"title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.",
"journal": "Cell",
"date": "1994",
"authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7510216",
"url": "https://glygen.org/publication/PubMed/7510216"
}
]
},
{
"title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.",
"journal": "Cell",
"date": "1994",
"authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7512451",
"url": "https://glygen.org/publication/PubMed/7512451"
}
]
},
{
"title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Arai T, Parker A, Busby W Jr, Clemmons DR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7519608",
"url": "https://glygen.org/publication/PubMed/7519608"
}
]
},
{
"title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7523391",
"url": "https://glygen.org/publication/PubMed/7523391"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Bach LA, Hsieh S, Brown AL, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525263",
"url": "https://glygen.org/publication/PubMed/7525263"
}
]
},
{
"title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1994",
"authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525634",
"url": "https://glygen.org/publication/PubMed/7525634"
}
]
},
{
"title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.",
"journal": "The Journal of endocrinology",
"date": "1994",
"authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7525824",
"url": "https://glygen.org/publication/PubMed/7525824"
}
]
},
{
"title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.",
"journal": "Endocrinology",
"date": "1994",
"authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7527330",
"url": "https://glygen.org/publication/PubMed/7527330"
}
]
},
{
"title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1995",
"authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7529288",
"url": "https://glygen.org/publication/PubMed/7529288"
}
]
},
{
"title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.",
"journal": "Growth regulation",
"date": "1994",
"authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7538844",
"url": "https://glygen.org/publication/PubMed/7538844"
}
]
},
{
"title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1995",
"authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7543116",
"url": "https://glygen.org/publication/PubMed/7543116"
}
]
},
{
"title": "Release of biological activities from quiescent fibronectin by a conformational change and limited proteolysis by matrix metalloproteinases.",
"journal": "Biochemistry",
"date": "1995",
"authors": "Fukai F, Ohtaki M, Fujii N, Yajima H, Ishii T, Nishizawa Y, Miyazaki K, Katayama T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "7547873",
"url": "https://glygen.org/publication/PubMed/7547873"
}
]
},
{
"title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).",
"journal": "Endocrinology",
"date": "1995",
"authors": "Angelloz-Nicoud P, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7588299",
"url": "https://glygen.org/publication/PubMed/7588299"
}
]
},
{
"title": "Structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor.",
"journal": "Nat. Struct. Biol.",
"date": "1994",
"authors": "Borkakoti N, Winkler FK, Williams DH, D'Arcy A, Broadhurst MJ, Brown PA, Johnson WH, Murray EJ",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "7656013",
"url": "https://glygen.org/publication/PubMed/7656013"
}
]
},
{
"title": "Proteolytic and non-proteolytic activation of human neutrophil progelatinase B.",
"journal": "Biochimica et biophysica acta",
"date": "1995",
"authors": "Sang QX, Birkedal-Hansen H, Van Wart HE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7669817",
"url": "https://glygen.org/publication/PubMed/7669817"
}
]
},
{
"title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7683646",
"url": "https://glygen.org/publication/PubMed/7683646"
}
]
},
{
"title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.",
"journal": "Experientia",
"date": "1993",
"authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "7689487",
"url": "https://glygen.org/publication/PubMed/7689487"
}
]
},
{
"title": "Furin-dependent intracellular activation of the human stromelysin-3 zymogen.",
"journal": "Nature",
"date": "1995",
"authors": "Pei D, Weiss SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7746327",
"url": "https://glygen.org/publication/PubMed/7746327"
}
]
},
{
"title": "Activation of progelatinase B (MMP-9) by gelatinase A (MMP-2).",
"journal": "Cancer research",
"date": "1995",
"authors": "Fridman R, Toth M, Pena D, Mobashery S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7780967",
"url": "https://glygen.org/publication/PubMed/7780967"
}
]
},
{
"title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.",
"journal": "Protein science : a publication of the Protein Society",
"date": "1995",
"authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7795521",
"url": "https://glygen.org/publication/PubMed/7795521"
}
]
},
{
"title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.",
"journal": "Immunity",
"date": "1995",
"authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7796300",
"url": "https://glygen.org/publication/PubMed/7796300"
}
]
},
{
"title": "Activation of precursors for matrix metalloproteinases 1 (interstitial collagenase) and 3 (stromelysin) by rat mast-cell proteinases I and II.",
"journal": "The Biochemical journal",
"date": "1995",
"authors": "Suzuki K, Lees M, Newlands GF, Nagase H, Woolley DE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7826345",
"url": "https://glygen.org/publication/PubMed/7826345"
}
]
},
{
"title": "Mechanism of cell surface activation of 72-kDa type IV collagenase. Isolation of the activated form of the membrane metalloprotease.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Strongin AY, Collier I, Bannikov G, Marmer BL, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7890645",
"url": "https://glygen.org/publication/PubMed/7890645"
}
]
},
{
"title": "Matrix metalloproteinase-2 is an interstitial collagenase. Inhibitor-free enzyme catalyzes the cleavage of collagen fibrils and soluble native type I collagen generating the specific 3/4- and 1/4-length fragments.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Aimes RT, Quigley JP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "7890717",
"url": "https://glygen.org/publication/PubMed/7890717"
}
]
},
{
"title": "Matrix metalloproteinase 7 (matrilysin) from human rectal carcinoma cells. Activation of the precursor, interaction with other matrix metalloproteinases and enzymic properties.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Imai K, Yokohama Y, Nakanishi I, Ohuchi E, Fujii Y, Nakai N, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7896811",
"url": "https://glygen.org/publication/PubMed/7896811"
}
]
},
{
"title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.",
"journal": "Oncogene",
"date": "1995",
"authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7898939",
"url": "https://glygen.org/publication/PubMed/7898939"
}
]
},
{
"title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.",
"journal": "Immunology today",
"date": "1994",
"authors": "Zurawski G, de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "7907877",
"url": "https://glygen.org/publication/PubMed/7907877"
}
]
},
{
"title": "Reciprocated matrix metalloproteinase activation: a process performed by interstitial collagenase and progelatinase A.",
"journal": "Biochemistry",
"date": "1994",
"authors": "Crabbe T, O'Connell JP, Smith BJ, Docherty AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "7981201",
"url": "https://glygen.org/publication/PubMed/7981201"
}
]
},
{
"title": "A matrix metalloproteinase expressed on the surface of invasive tumour cells.",
"journal": "Nature",
"date": "1994",
"authors": "Sato H, Takino T, Okada Y, Cao J, Shinagawa A, Yamamoto E, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8015608",
"url": "https://glygen.org/publication/PubMed/8015608"
}
]
},
{
"title": "Crystal structures of recombinant 19-kDa human fibroblast collagenase complexed to itself.",
"journal": "Biochemistry",
"date": "1994",
"authors": "Lovejoy B, Hassell AM, Luther MA, Weigl D, Jordan SR",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "8031754",
"url": "https://glygen.org/publication/PubMed/8031754"
}
]
},
{
"title": "An interleukin-4-induced transcription factor: IL-4 Stat.",
"journal": "Science (New York, N.Y.)",
"date": "1994",
"authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8085155",
"url": "https://glygen.org/publication/PubMed/8085155"
}
]
},
{
"title": "1.56-A structure of mature truncated human fibroblast collagenase.",
"journal": "Proteins",
"date": "1994",
"authors": "Spurlino JC, Smallwood AM, Carlton DD, Banks TM, Vavra KJ, Johnson JS, Cook ER, Falvo J, Wahl RC, Pulvino TA, et al.",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "8090713",
"url": "https://glygen.org/publication/PubMed/8090713"
}
]
},
{
"title": "Human progelatinase A can be activated by matrilysin.",
"journal": "FEBS letters",
"date": "1994",
"authors": "Crabbe T, Smith B, O'Connell J, Docherty A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8194591",
"url": "https://glygen.org/publication/PubMed/8194591"
}
]
},
{
"title": "Cloning and characterization of a unique elastolytic metalloproteinase produced by human alveolar macrophages.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Shapiro SD, Kobayashi DK, Ley TJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "8226919",
"url": "https://glygen.org/publication/PubMed/8226919"
}
]
},
{
"title": "Structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor.",
"journal": "Science",
"date": "1994",
"authors": "Lovejoy B, Cleasby A, Hassell AM, Longley K, Luther MA, Weigl D, McGeehan G, McElroy AB, Drewry D, Lambert MH, et al.",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "8278810",
"url": "https://glygen.org/publication/PubMed/8278810"
}
]
},
{
"title": "Plasma membrane-dependent activation of the 72-kDa type IV collagenase is prevented by complex formation with TIMP-2.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Strongin AY, Marmer BL, Grant GA, Goldberg GI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8314771",
"url": "https://glygen.org/publication/PubMed/8314771"
}
]
},
{
"title": "Role of zinc-binding- and hemopexin domain-encoded sequences in the substrate specificity of collagenase and stromelysin-2 as revealed by chimeric proteins.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Sanchez-Lopez R, Alexander CM, Behrendtsen O, Breathnach R, Werb Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "8463259",
"url": "https://glygen.org/publication/PubMed/8463259"
}
]
},
{
"title": "Intermolecular autolytic cleavage can contribute to the activation of progelatinase A by cell membranes.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Atkinson SJ, Crabbe T, Cowell S, Ward RV, Butler MJ, Sato H, Seiki M, Reynolds JJ, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8530478",
"url": "https://glygen.org/publication/PubMed/8530478"
}
]
},
{
"title": "Biochemical characterization of human collagenase-3.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Knauper V, Lopez-Otin C, Smith B, Knight G, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "8576151",
"url": "https://glygen.org/publication/PubMed/8576151"
}
]
},
{
"title": "Essential role of Stat6 in IL-4 signalling.",
"journal": "Nature",
"date": "1996",
"authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8602263",
"url": "https://glygen.org/publication/PubMed/8602263"
}
]
},
{
"title": "Transmembrane-deletion mutants of the membrane-type matrix metalloproteinase-1 process progelatinase A and express intrinsic matrix-degrading activity.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Pei D, Weiss SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8621565",
"url": "https://glygen.org/publication/PubMed/8621565"
}
]
},
{
"title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Zhang D, Sun M, Samols D, Kushner I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8621622",
"url": "https://glygen.org/publication/PubMed/8621622"
}
]
},
{
"title": "The degradation of human endothelial cell-derived perlecan and release of bound basic fibroblast growth factor by stromelysin, collagenase, plasmin, and heparanases.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Whitelock JM, Murdoch AD, Iozzo RV, Underwood PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626565",
"url": "https://glygen.org/publication/PubMed/8626565"
}
]
},
{
"title": "Characterization of structural determinants and molecular mechanisms involved in pro-stromelysin-3 activation by 4-aminophenylmercuric acetate and furin-type convertases.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Santavicca M, Noel A, Angliker H, Stoll I, Segain JP, Anglard P, Chretien M, Seidah N, Basset P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8645182",
"url": "https://glygen.org/publication/PubMed/8645182"
}
]
},
{
"title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663118",
"url": "https://glygen.org/publication/PubMed/8663118"
}
]
},
{
"title": "Cellular mechanisms for human procollagenase-3 (MMP-13) activation. Evidence that MT1-MMP (MMP-14) and gelatinase a (MMP-2) are able to generate active enzyme.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Knauper V, Will H, Lopez-Otin C, Smith B, Atkinson SJ, Stanton H, Hembry RM, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663255",
"url": "https://glygen.org/publication/PubMed/8663255"
}
]
},
{
"title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8668165",
"url": "https://glygen.org/publication/PubMed/8668165"
}
]
},
{
"title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.",
"journal": "Biochimica et biophysica acta",
"date": "1996",
"authors": "Bach LA, Rechler MM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8781553",
"url": "https://glygen.org/publication/PubMed/8781553"
}
]
},
{
"title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.",
"journal": "European journal of biochemistry",
"date": "1996",
"authors": "Shen BJ, Hage T, Sebald W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8797861",
"url": "https://glygen.org/publication/PubMed/8797861"
}
]
},
{
"title": "Activation of a recombinant membrane type 1-matrix metalloproteinase (MT1-MMP) by furin and its interaction with tissue inhibitor of metalloproteinases (TIMP)-2.",
"journal": "FEBS letters",
"date": "1996",
"authors": "Sato H, Kinoshita T, Takino T, Nakayama K, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "8804434",
"url": "https://glygen.org/publication/PubMed/8804434"
}
]
},
{
"title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816495",
"url": "https://glygen.org/publication/PubMed/8816495"
}
]
},
{
"title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.",
"journal": "Progress in growth factor research",
"date": "1995",
"authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8817670",
"url": "https://glygen.org/publication/PubMed/8817670"
}
]
},
{
"title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.",
"journal": "Growth regulation",
"date": "1996",
"authors": "Angelloz-Nicoud P, Harel L, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8894645",
"url": "https://glygen.org/publication/PubMed/8894645"
}
]
},
{
"title": "Macrophage metalloelastase degrades matrix and myelin proteins and processes a tumour necrosis factor-alpha fusion protein.",
"journal": "Biochemical and biophysical research communications",
"date": "1996",
"authors": "Chandler S, Cossins J, Lury J, Wells G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "8920930",
"url": "https://glygen.org/publication/PubMed/8920930"
}
]
},
{
"title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.",
"journal": "Hormone research",
"date": "1996",
"authors": "Lalou C, Lassarre C, Binoux M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "8964575",
"url": "https://glygen.org/publication/PubMed/8964575"
}
]
},
{
"title": "Membrane type 1 matrix metalloproteinase digests interstitial collagens and other extracellular matrix macromolecules.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Ohuchi E, Imai K, Fujii Y, Sato H, Seiki M, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "8999957",
"url": "https://glygen.org/publication/PubMed/8999957"
}
]
},
{
"title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.",
"journal": "FEBS letters",
"date": "1997",
"authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9013879",
"url": "https://glygen.org/publication/PubMed/9013879"
}
]
},
{
"title": "The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9065415",
"url": "https://glygen.org/publication/PubMed/9065415"
}
]
},
{
"title": "Expression of three membrane-type matrix metalloproteinases (MT-MMPs) in rat vascular smooth muscle cells and characterization of MT3-MMPs with and without transmembrane domain.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Shofuda K, Yasumitsu H, Nishihashi A, Miki K, Miyazaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "9092507",
"url": "https://glygen.org/publication/PubMed/9092507"
}
]
},
{
"title": "Hydrolysis of a broad spectrum of extracellular matrix proteins by human macrophage elastase.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Gronski TJ Jr, Martin RL, Kobayashi DK, Walsh BC, Holman MC, Huber M, Van Wart HE, Shapiro SD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9115292",
"url": "https://glygen.org/publication/PubMed/9115292"
}
]
},
{
"title": "Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.",
"journal": "The Biochemical journal",
"date": "1997",
"authors": "Imai K, Hiramatsu A, Fukushima D, Pierschbacher MD, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9148753",
"url": "https://glygen.org/publication/PubMed/9148753"
}
]
},
{
"title": "Activation of type IV procollagenases by human tumor-associated trypsin-2.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Sorsa T, Salo T, Koivunen E, Tyynela J, Konttinen YT, Bergmann U, Tuuttila A, Niemi E, Teronen O, Heikkila P, Tschesche H, Leinonen J, Osman S, Stenman UH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9261109",
"url": "https://glygen.org/publication/PubMed/9261109"
}
]
},
{
"title": "Activation of progelatinase B (proMMP-9) by active collagenase-3 (MMP-13).",
"journal": "European journal of biochemistry",
"date": "1997",
"authors": "Knauper V, Smith B, Lopez-Otin C, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9346290",
"url": "https://glygen.org/publication/PubMed/9346290"
}
]
},
{
"title": "Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Berditchevski F, Chang S, Bodorova J, Hemler ME",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-210991",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991"
}
],
"reference": [
{
"type": "PubMed",
"id": "9360995",
"url": "https://glygen.org/publication/PubMed/9360995"
}
]
},
{
"title": "The TIMP2 membrane type 1 metalloproteinase `receptor` regulates the concentration and efficient activation of progelatinase A. A kinetic study.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Butler GS, Butler MJ, Atkinson SJ, Will H, Tamura T, Schade van Westrum S, Crabbe T, Clements J, d'Ortho MP, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9422744",
"url": "https://glygen.org/publication/PubMed/9422744"
}
]
},
{
"title": "Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.",
"journal": "European journal of biochemistry",
"date": "1997",
"authors": "d'Ortho MP, Will H, Atkinson S, Butler G, Messent A, Gavrilovic J, Smith B, Timpl R, Zardi L, Murphy G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461298",
"url": "https://glygen.org/publication/PubMed/9461298"
}
]
},
{
"title": "High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR.",
"journal": "Biochemistry",
"date": "1998",
"authors": "Moy FJ, Chanda PK, Cosmi S, Pisano MR, Urbano C, Wilhelm J, Powers R",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"reference": [
{
"type": "PubMed",
"id": "9484219",
"url": "https://glygen.org/publication/PubMed/9484219"
}
]
},
{
"title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9497324",
"url": "https://glygen.org/publication/PubMed/9497324"
}
]
},
{
"title": "Activation of the precursor of human stromelysin 2 and its interactions with other matrix metalloproteinases.",
"journal": "European journal of biochemistry",
"date": "1998",
"authors": "Nakamura H, Fujii Y, Ohuchi E, Yamamoto E, Okada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9578462",
"url": "https://glygen.org/publication/PubMed/9578462"
}
]
},
{
"title": "TIMP-2 promotes activation of progelatinase A by membrane-type 1 matrix metalloproteinase immobilized on agarose beads.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Kinoshita T, Sato H, Okada A, Ohuchi E, Imai K, Okada Y, Seiki M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1592389",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389"
}
],
"reference": [
{
"type": "PubMed",
"id": "9632662",
"url": "https://glygen.org/publication/PubMed/9632662"
}
]
},
{
"title": "Mutational analysis of the STAT6 SH2 domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Mikita T, Daniel C, Wu P, Schindler U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9651359",
"url": "https://glygen.org/publication/PubMed/9651359"
}
]
},
{
"title": "Cloning and characterization of a novel matrix metalloproteinase (MMP), CMMP, from chicken embryo fibroblasts. CMMP, Xenopus XMMP, and human MMP19 have a conserved unique cysteine in the catalytic domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Yang M, Kurkinen M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1442490",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490"
}
],
"reference": [
{
"type": "PubMed",
"id": "9651395",
"url": "https://glygen.org/publication/PubMed/9651395"
}
]
},
{
"title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.",
"journal": "The Journal of clinical endocrinology and metabolism",
"date": "1998",
"authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9709957",
"url": "https://glygen.org/publication/PubMed/9709957"
}
]
},
{
"title": "The role of IL-13 and its receptor in allergy and inflammatory responses.",
"journal": "The Journal of allergy and clinical immunology",
"date": "1998",
"authors": "de Vries JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9723655",
"url": "https://glygen.org/publication/PubMed/9723655"
}
]
},
{
"title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9733769",
"url": "https://glygen.org/publication/PubMed/9733769"
}
]
},
{
"title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.",
"journal": "Molecular immunology",
"date": "1998",
"authors": "Park HJ, So EY, Lee CE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9736340",
"url": "https://glygen.org/publication/PubMed/9736340"
}
]
},
{
"title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9786878",
"url": "https://glygen.org/publication/PubMed/9786878"
}
]
},
{
"title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Roy B, Cathcart MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822675",
"url": "https://glygen.org/publication/PubMed/9822675"
}
]
},
{
"title": "Human HtrA, an evolutionarily conserved serine protease identified as a differentially expressed gene product in osteoarthritic cartilage.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Hu SI, Carozza M, Klein M, Nantermet P, Luk D, Crowl RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1474228",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228"
}
],
"reference": [
{
"type": "PubMed",
"id": "9852107",
"url": "https://glygen.org/publication/PubMed/9852107"
}
]
},
{
"title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.",
"journal": "The Journal of experimental medicine",
"date": "1999",
"authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-6785807",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807"
}
],
"reference": [
{
"type": "PubMed",
"id": "9874564",
"url": "https://glygen.org/publication/PubMed/9874564"
}
]
},
{
"title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.",
"journal": "American journal of respiratory cell and molecular biology",
"date": "1999",
"authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-381426",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426"
}
],
"reference": [
{
"type": "PubMed",
"id": "9922210",
"url": "https://glygen.org/publication/PubMed/9922210"
}
]
}
],
"pathway": [
{
"id": "hsa:4312",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4312",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-1442490",
"name": "Collagen degradation",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1442490",
"resource": "Reactome",
"description": "Collagen degradation"
},
{
"id": "R-HSA-1474228",
"name": "Degradation of the extracellular matrix",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474228",
"resource": "Reactome",
"description": "Degradation of the extracellular matrix"
},
{
"id": "R-HSA-1592389",
"name": "Activation of Matrix Metalloproteinases",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592389",
"resource": "Reactome",
"description": "Activation of Matrix Metalloproteinases"
},
{
"id": "R-HSA-210991",
"name": "Basigin interactions",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-210991",
"resource": "Reactome",
"description": "Basigin interactions"
},
{
"id": "R-HSA-381426",
"name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426",
"resource": "Reactome",
"description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)"
},
{
"id": "R-HSA-6785807",
"name": "Interleukin-4 and Interleukin-13 signaling",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807",
"resource": "Reactome",
"description": "Interleukin-4 and Interleukin-13 signaling"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P81563-1",
"protein_name": "Interstitial collagenase",
"gene_name": "Mmp1",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "DTLKSEKNADFKDLY",
"length": 15
},
"evidence": [
{
"id": "45934912",
"url": "http://www.informatics.jax.org/homology/45934912",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q9EPL5-1",
"protein_name": "Interstitial collagenase A",
"gene_name": "Mmp1a",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MPSLPLLLLLWAASSYSFPVFHNGDRQNVETVWKYLENYYNLGKNMQAKNVNGKEMMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTPYLPKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDNNPFDGPNYKLAHTFQPGPGLGGDVHYDLDETWTNSSENFNLFYVTAHELGHSLGLTHSSDIGALMFPSYTWYTEDFVLNQDDINRIQDLYGPSPNPIQPTGATTPHPCNGDLTFDAITTFRGEVFFFKGRFYIRVNRFMPEPELNLIGILWPNLPVKLDAAYEASMIDQVRYFKGSKVWAVQEQSVLRGFPRDIHSFFGFPSNVTHIDAAVCEEETGKTYFFVDHMYWRYDENTQSMDPGYPRLTAEDFPGIDDKVDDVFQKGENFYFFHQSVQHRFNLQIRRVDDSRDSSTWFNC",
"length": 464
},
"evidence": [
{
"id": "45934912",
"url": "http://www.informatics.jax.org/homology/45934912",
"database": "MGI"
},
{
"id": "P03956",
"url": "https://omabrowser.org/oma/group/P03956/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q9EPL6-1",
"protein_name": "Interstitial collagenase B",
"gene_name": "Mmp1b",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MPSLPLLLRLWAASSYSFPVIQDGLQKNVKTVWKYLENYYNLGKNMQAKNVNGKEVMAEKLRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTPYLSKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDLYTFDGSKYHFAHAFLPGLGLGGNVHYDLDQKWTDNNEDFNLFYVTAHELGHSLGLSHSNDEEALMFPSYTWSNKDFVLNQDDINRIQALYGPSPNPIQLTDATLDPCNSGLTFDAIITYRGEVIFFKDRFYIRVISFLPEPLIDVIDLTWPNLPGKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLEGFPMDIQSFFGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSMDPGYPRLIAEDFPGIDYKVDDVIQKEDNFYFFHQSIQYRFNLKTRRIDDSSDINTWFNC",
"length": 463
},
"evidence": [
{
"id": "45934913",
"url": "http://www.informatics.jax.org/homology/45934913",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 5,
"go_terms": [
{
"name": "endopeptidase activity",
"id": "GO:0004175",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "metalloendopeptidase activity",
"id": "GO:0004222",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004222",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "serine-type endopeptidase activity",
"id": "GO:0004252",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "zinc ion binding",
"id": "GO:0008270",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "peptidase activity",
"id": "GO:0008233",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 3,
"go_terms": [
{
"name": "extracellular region",
"id": "GO:0005576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "extracellular matrix",
"id": "GO:0031012",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 7,
"go_terms": [
{
"name": "proteolysis",
"id": "GO:0006508",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "extracellular matrix disassembly",
"id": "GO:0022617",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022617",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "extracellular matrix organization",
"id": "GO:0030198",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "positive regulation of protein-containing complex assembly",
"id": "GO:0031334",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "collagen catabolic process",
"id": "GO:0030574",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030574",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "protein metabolic process",
"id": "GO:0019538",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019538",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
},
{
"name": "cellular response to UV-A",
"id": "GO:0071492",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071492",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [
{
"name": "interstitial collagenase N-glycosylated 1 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G15198VK. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G15198VK. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053138",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053138"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 2 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G36221RT. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G36221RT. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053139",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053139"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 3 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G38349VC. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G38349VC. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053140",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053140"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 4 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G48381WH. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G48381WH. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053141",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053141"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 5 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G52880ZN. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G52880ZN. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053142",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053142"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 6 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G58268WC. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G58268WC. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053143",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053143"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 7 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G64706DG. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G64706DG. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053144",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053144"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 8 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G76012OT. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G76012OT. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053145",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053145"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 9 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G76136FD. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G76136FD. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053146",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053146"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 10 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053147",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053147"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 11 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G85196QC. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G85196QC. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053148",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053148"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 12 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G85542KD. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G85542KD. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053149",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053149"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 13 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-120 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan structure is represented by GlyTouCan:G93856AJ. Example: UniProtKB:P03956-1, Asn-120, MOD:00160~GNO:G93856AJ. [PRO:DNx, PMID:10092871]",
"evidence": [
{
"id": "PR:000053150",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053150"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 14 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G07799LX. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G07799LX. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053151",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053151"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 15 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053152",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053152"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 16 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G16175ZV. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G16175ZV. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053153",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053153"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 17 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G22018FP. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G22018FP. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053154",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053154"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 18 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G27126ED. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G27126ED. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053155",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053155"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 19 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G30123TP. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G30123TP. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053156",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053156"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 20 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G49345XT. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G49345XT. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053157",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053157"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 21 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G70696MD. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G70696MD. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053158",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053158"
}
]
},
{
"name": "interstitial collagenase N-glycosylated 22 (human)",
"definition": "An interstitial collagenase (human) that has been N-glycosylated at the residue equivalent to Asn-143 of the amino acid sequence represented by UniProtKB:P03956-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P03956-1, Asn-143, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:23345538]",
"evidence": [
{
"id": "PR:000053159",
"database": "PRO",
"url": "https://proconsortium.org/app/entry/PR:000053159"
}
]
}
],
"site_annotation": [
{
"start_pos": 120,
"end_pos": 122,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 143,
"end_pos": 145,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Tyrosine phosphorylated in platelets by PKDCC/VLK.",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "PubMed",
"id": "25171405",
"url": "https://glygen.org/publication/PubMed/25171405"
}
]
},
{
"annotation": "Undergoes autolytic cleavage to two major forms (22 kDa and 27 kDa). A minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.",
"evidence": [
{
"database": "UniProtKB",
"id": "P03956",
"url": "https://www.uniprot.org/uniprot/P03956"
},
{
"database": "PubMed",
"id": "10092871",
"url": "https://glygen.org/publication/PubMed/10092871"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "R-HSA-1454757",
"name": "Gelatin degradation by MMP1, 2, 3, 7, 8, 9, 12, 13",
"equation": "",
"summary": "Gelatin is formed when collagen becomes partly or completely uncoiled when compared with the regular triple helix structure of fibrillar collagen. In vivo, once collagens are initially cleaved into clasical 3/4 and 1/4 fragments (by collagenases) they rapidly denature at body temperature and are degraded by gelatinases and other nonspecific tissue proteinases (Chung et al. 2004) to a semi-solid colloid gel. MMP2 and MMP9 are the major gelatinases (Collier et al. 1988, Wilhelm et al. 1989) often referred to respectively as Gelatinase A and Gelatinase B (Murphy & Crabbe 1995). However many other MMPs have gelatinase activity, including MMP1 (Murphy et al. 1982, Isaksen & Fagerhol 2001, Chung et al. 2004), MMP3 (Chin et al. 1985, Isaksen & Fagerhol 2001), MMP7 (Isaksen & Fagerhol 2001), MMP8 (Isaksen & Fagerhol 2001) MMP10 (Sanches-Lopez et al. 1993), MMP12 (Chandler et al. 1996), MMP13 (Kn\u00e4uper et al. 1993, Isaksen & Fagerhol 2001), MMP16 (Shofuda et al. 1997), MMP17 (Wang et al. 1999), MMP18 (Spinucci et al. 1988), MMP19 (Stracke et al. 2000) and MMP22 (Yang & Kurkinen 1998).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P39900-1",
"P14780-1",
"P08253-1",
"P45452-1",
"P09237-1",
"P08254-1",
"P22894-1"
],
"evidence": [
{
"id": "R-HSA-1454757",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454757"
}
]
},
{
"id": "R-HSA-1454781",
"name": "MMP1,3,13 (2, 7-12, 19) binding by Alpha-2 macroglubulin",
"equation": "",
"summary": "Alpha 2-macroglobulin (A2M) is a plasma glycoprotein consisting of 4 near-identical subunits (Andersen et al. 1995). A2M inhibits almost all endopeptidases regardless of their specificities (Barrett 1981). A2M binding to an endopeptidase is triggered by cleavage of a peptide bond in the 'bait region' of A2M, triggering a conformational change in A2M that in turn entraps the peptidase without blocking the active site (Barrett & Starkey 1973). This blocks enzyme activity against large protein substrates while not preventing activity on low molecular weight substrates.
Once bound, A2M-proteinase complexes are endocytosed by low density lipoprotein receptor-related protein-1 (LRP1) (Strickland et al. 1990).
Active metalloproteinases (MMPs) that can be entrapped by A2M include MMP3 (Enghild et al. 1989) MMP1 (Grinnell et al. 1998) and MMP 13 (Beekman et al. 1999).
The significance of this mechanism as a regulator of MMP activity is unclear (Baker et al. 2002, Nagase et al. 2006).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P39900-1",
"P14780-1",
"P08253-1",
"P24347-1",
"P45452-1",
"P09238-1",
"P09237-1",
"P08254-1",
"O60882-1",
"P22894-1",
"Q99542-1"
],
"evidence": [
{
"id": "R-HSA-1454781",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454781"
}
]
},
{
"id": "R-HSA-1454822",
"name": "Collagen type I degradation by MMP1,2,8,13, PRSS2",
"equation": "",
"summary": "MMP1 (Welgus et al. 1981), MMP8 (Hasty et al. 1987), and MMP13 (Knauper et al. 1996) known in the literature as collagenases I, II and III respectively are able to digest the intrahelical bonds of collagen type I. MMP2, also known as Gelatinase-A, was found to cleave collagen type I fibrils (Aimes & Quigley 1995). Though this was disputed (Seltzre & Eisen 1999) there is a structural explanation for the apparent discrepancies in experimental data (Patterson et al. 2001). In addition trypsin-2 is able to degrade native soluble type I collagen (Moilanen et al. 2003). ; ; Degradation is represented here at a theoretical end point where every alpha strand has been cleaved.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-2467150"
],
"enzyme_list": [
"P03956-1",
"P08253-1",
"P07478-1",
"P45452-1",
"P22894-1"
],
"evidence": [
{
"id": "R-HSA-1454822",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1454822"
}
]
},
{
"id": "R-HSA-1474197",
"name": "Collagen type II degradation by MMP1,3,8,13,PRSS2",
"equation": "",
"summary": "MMP1 (Welgus et al. 1981), MMP8 (Hasty et al. 1987), and MMP13 (Knauper et al. 1996, Mitchell et al. 1996, Billinghurst et al. 1997) known in the literature as collagenases I, II and III respectively are able to digest the intrahelical bonds of collagen type II, cleaving between amino acids Gly975 and Leu976 of the Uniprot canonical sequence. Human trypsin-2 is also capable of cleaving the triple helix of human cartilage collagen type II (Stenman et al. 2005).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P07478-1",
"P45452-1",
"P08254-1",
"P22894-1"
],
"evidence": [
{
"id": "R-HSA-1474197",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474197"
}
]
},
{
"id": "R-HSA-1474213",
"name": "Collagen type III degradation by MMP1,8,9,13",
"equation": "",
"summary": "MMP1 (Welgus et al. 1981), MMP8 (Hasty et al. 1987), and MMP13 (Knauper et al. 1996, Mitchell et al. 1996), called collagenases I, II and III respectively, are all able to cleave the intrahelical bonds of collagen type III, cleaving between amino acids Gly948 and Ile949 of the Uniprot canonical sequence. MMP9 (Bigg et al. Veidal et al. 2010) and MMP10 (Stromelysin-2) are able to degrade collagen type III (Nicholson et al. 1989).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P14780-1",
"P45452-1",
"P22894-1"
],
"evidence": [
{
"id": "R-HSA-1474213",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1474213"
}
]
},
{
"id": "R-HSA-1564120",
"name": "Collagen type VII degradation by MMP1,2,3",
"equation": "",
"summary": "Type VII collagen is the major collagen component of anchoring fibrils, which are essential for the attachment of the epidermis to the dermis. It is degraded by MMP1 (Seltzer et al. 1989), MMP2 (Seltzer et al. 1989, Sawamura et al. 1991, Karelina et al. 2000) and MMP3 (Sawamura et al. 1991). MMP2 is 3000-fold more active than MMP1 (Seltzer et al. 1989).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-2214333"
],
"output_participant_list": [
"R-HSA-2470309"
],
"enzyme_list": [
"P03956-1",
"P08253-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1564120",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564120"
}
]
},
{
"id": "R-HSA-1564143",
"name": "Collagen type X degradation by MMP1,2",
"equation": "",
"summary": "Collagen X is thought to form extended hexagonal networks (Kwan et al. 1991, Jacenko et al. 2001). It's distribution is limited to regions of hypertrophic cartilage destined for degradation during endochondral ossification (Schmid & Conrad 1982). It is also found in areas of surface fibrillation and osteophyte formation during the development of osteoarthritic lesions in articular cartilage (von der Mark et al. 1992). In Timp3 knockout mice type X collagen was observed mostly in areas of articular cartilage that stained strongly for collagen cleavage products, suggesting that deposition of type X collagen might be a damage repair mechanism (Sahebjam et al. 2007). Mutations in the gene COL10A1 are associated with Schmid/Japanese type metaphyseal chondrodysplasia (SMCD) (Warman et al. 1993, Ho et al. 2007, Woelfle et al. 2011).
Type X collagen is degraded by MMP1 (Schmid et al. 1986, Welgus et al. 1990, Cole et al. 1993), MMP2 (Cole et al. 1993, Welgus et al. 1990), MMP3 (Wu et al. 1991), MMP13 (Knauper et al. 1997) and neutrophil elastase (Kittelberger et al. 1992).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-2167968"
],
"output_participant_list": [
"R-HSA-2470532"
],
"enzyme_list": [
"P03956-1",
"P08253-1"
],
"evidence": [
{
"id": "R-HSA-1564143",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564143"
}
]
},
{
"id": "R-HSA-1564169",
"name": "Collagen type VIII degradation by MMP1",
"equation": "",
"summary": "Collagen type VIII is a short chain, network-forming collagen,thought to play a role in tissue remodeling and repair (Shuttleworth 1997, Weitkamp et al. 1999). There are two alpha chain subtypes, found in a ratio of two alpha-1 to one alpha-2 chains (Mann et al. 1990) in the typical collagen heterotrimer. Studies suggest that type VIII collagen is a major component of the hexagonal lattice seen in Descemet's membrane (Mann et al. 1990). Mutations in both alpha chains have been associated with Fuchs endothelial corneal dystrophy (FECD), a degenerative disease of the corneal endothelium (Jun et al. 2012).
; ; Collagen type VIII can be degraded by MMP1 (Sage et al. 1983, 1984).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-2168017"
],
"output_participant_list": [
"R-HSA-2470314"
],
"enzyme_list": [
"P03956-1"
],
"evidence": [
{
"id": "R-HSA-1564169",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564169"
}
]
},
{
"id": "R-HSA-1564179",
"name": "Collagen type XI degradation by MMP1,2,3,9",
"equation": "",
"summary": "Collagen type XI has 3 types of alpha chain. The alpha1(XI) and alpha2(XI) chains are distinct gene products unique to collagen XI, while alpha3(XI) is a hyperglycosylated form of the alpha1 chain for collagen II (Burgeson & Hollister 1979, Morris & B\u00e4chinger 1987). Collagen type XI is a fibril-forming collagen found in conjunction with collagens type II and IX in cartilage fibrils (Miller & Gay 1987, Mendler et al. 1989). It is thought to be the structural equivalent of collagen V in connective tissue collagen fibrils. The formation of cartilage collagen fibrils requires collagen XI, suggesting a regulatory function (Li et al. 1995, Wu & Eyre 1995).
Mutations in COL11A1 result in fibrochondrogenesis, a severe, autosomal-recessive, short-limbed skeletal dysplasia (Tompson et al. 2010). Variations in COL11A1, COL11A2 and COL2A1 are associated with the inherited chondrodysplasias Marshall and Stickler syndromes (Annunen et al. 1999).
Collagen type XI is degraded by MMP1 (Eyre et al. 1984), MMP2 (Yu et al. 1990, Smith et al. 1991, Brown et al. 1996), MMP3 (Wu et al. 1991) and MMP9 (Hirose et al. 1992, Pormotabbed et al. 1994).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-2168008"
],
"output_participant_list": [
"R-HSA-2470603"
],
"enzyme_list": [
"P03956-1",
"P14780-1",
"P08253-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1564179",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1564179"
}
]
},
{
"id": "R-HSA-1566981",
"name": "Fibronectin degradation by MMP1, 3, 7, 12, 13, 19, CTSS",
"equation": "",
"summary": "MMP1 can degrade fibronectin (Fukai et al. 1995), as can MMP3 (Gunja-Smith et al. 1985, Nicholson et al. 1989, Wilhelm et al. 1993, Fukai et al. 1995), MMP7 (Quantin et al. 1989, Miyazaki et al. 1990, Fukai et al. 1995, von Bredow et al. 1995), MMP10 (Nicholson et al. 1989), MMP12 (Gronski et al. 1997), MMP13 (Knauper et al. 1997), MMP14 (Shi & Sottile 2011) and 19 (Stracke et al. 2000). Cathepsin S is able to degrade fibronectin (Taleb et al. 2006). Studies have shown that fibronectin turnover is not prevented by protease inhibitors (Sottile & Hocking 2002) suggesting that caveolin-1-mediated endocytosis and intracellular degradation are involved (Salicioni et al. 2002, Sottile & Chandler 2004).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-2327729"
],
"output_participant_list": [
"R-HSA-2533900"
],
"enzyme_list": [
"P03956-1",
"P39900-1",
"P25774-1",
"P45452-1",
"P09237-1",
"P08254-1",
"Q99542-1"
],
"evidence": [
{
"id": "R-HSA-1566981",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1566981"
}
]
},
{
"id": "R-HSA-1592270",
"name": "NID1 degradation by MMP1, 9, 12, ELANE",
"equation": "",
"summary": "Nidogen-1 (entactin) is a member of the nidogen family of basement membrane glycoproteins. It interacts with several other components of basement membranes, notably it connects the collagen and laminin networks to each other (Yurchenko & Patton 2009). MMPs 3, 7 (Mayer et al. 1993), 1, 9, (Sires et al. 1993), 12 (Gronski et al. 1997), 14, 15 (d'Ortho et al. 1997), 19 (Stracke et al. 2000) and leukocyte elastase (Mayer et al. 1993) can all degrade Nidogen-1.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-383375"
],
"output_participant_list": [
"R-HSA-2533959",
"R-HSA-2533960"
],
"enzyme_list": [
"P08246-1",
"P03956-1",
"P39900-1",
"P14780-1"
],
"evidence": [
{
"id": "R-HSA-1592270",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592270"
}
]
},
{
"id": "R-HSA-1592297",
"name": "Full activation of MMP1",
"equation": "",
"summary": "The 42 kDa intermediate form of MMP1 is fully activated by cleavage of the Gln99-Phe100 bond, producing a 41 kDa protein. MMP2 (Crabbe et al. 1994), MMP3 (Suzuki et al. 1990, Nagase et al. 1992), MMP7 (Imai et al. 1995), MMP10 (Nicholson et al. 1989) and MMP11 (Murphy et al. 1993) are able to convert the 42 kDa intermediate to fully activated 41 kDa form though they are not able to initiate activation of proMMP1 effectively (Nagase et al. 1992). MMP3 regulates MMP1 collagenase activity in human rheumatoid synovial fibroblasts (Unemori et al. 1991).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-375064"
],
"enzyme_list": [
"P03956-1",
"P08253-1",
"P24347-1",
"P09238-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1592297",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592297"
}
]
},
{
"id": "R-HSA-1592316",
"name": "Initial activation of proMMP1",
"equation": "",
"summary": "ProMMP1 has several activators including plasmin (Eeckhout & Vaes 1977, Werb et al. 1977, Santala et al. 1999), trypsin (Grant et al. 1987, Saunders et al. 2005), plasma kallikrein (Nagase et al. 1982, Saunders et al. 2005), chymase (Saarinen et al. 1994, Suzuki et al. 1995, Saunders et al. 2005), tryptase (Gruber et al. 1989, Suzuki et al. 1995, Saunders et al. 2005), neutrophil elastase, cathepsin G (Saunders et al. 2005) and trypsin-2 (Moilanen et al. 2003). Concanavalin A (ConA) was the first cellular treatment that yielded active MMPs in culture, inducing the cellular activation of MMP1 likely through MMP14 activity (Overall and Sodek 1990).Trypsin-like serine proteinases are believed to remove 34-36 residues from the N-terminus of the secreted pro-enzyme, equivalent to positions 53-55 of the UniProt cannonical sequence which includes a signal peptide. Removal of this region is sufficient to destabilize the Cys92-Zn2+ stabilizing bond (numbered according to the Uniprot canonical sequence, Cys73 when numbered from the N terminus of the secreted peptide as typically represented in the literature) and partially activate enzyme activity. This intermediate form then undergoes autocatalysis at Thr83-Leu84 producing an MMP1 with about 20% of full collagenase activity (Suzuki et al. 1990). Full activation is brought about by a further cleavage at Gln99-Phe100. When first reported, considerable debate surrounded the activation of this archetypical MMP. Divergence of opinion resulted when competing groups studied activation in vitro using chemicals (organomercurials such as aminophenylmecuricacetate), which yield a different autolytic cleavage site in the protease susceptible loop when compared with the site cut by serine proteases such as trypsin. Different specific activities result, but in general the final autolytic cleavage site for all MMPs is the homologous Phe or Tyr at position 100 or 101. When the active enzyme commences here, full activity is realised due to the salt bridge forming between the N-terminal primary amine of the conserved Phe or Tyr with an Asp on helix C that in turn salt bridges to the active site Glu. Termini either side of this position do not result in full activity.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1602455"
],
"output_participant_list": [
"R-HSA-1602470",
"R-HSA-1602471"
],
"enzyme_list": [
"P08246-1",
"P03956-1",
"P00747-1",
"P08311-1",
"Q15661-1",
"P07478-1",
"P03952-1",
"P23946-1",
"P07477-1"
],
"evidence": [
{
"id": "R-HSA-1592316",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592316"
}
]
},
{
"id": "R-HSA-1592436",
"name": "Initial activation of proMMP9 by MMPs",
"equation": "",
"summary": "MMP1 (Sang et al. 1995), MMP2 (Fridman et al. 1995), MMP3 (Goldberg et al. 1992, Ogata et al. 1992, Okada et al. 1992), MMP7 (Imai et al. 1995, Sang et al. 1995), MMP10 (Nakamura et al. 1998) and MMP13 (Knauper et al. 1997) activate MMP9 by a stepwise mechanism but the second cleavage is apparently not an autocatalytic event as is the case for MMP1 (Okada et al. 1992). The first site is the Glu59-Met60 bond, generating an inactive 85-86 kDa intermediate (O'Connell et al. 1994), followed by cleavage of the Arg106-Phe107 peptide bond producing the fullly active 82 kDa form of MMP9 (Okada et al. 1992, Fridman et al. 1995).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604376"
],
"output_participant_list": [
"R-HSA-1604685"
],
"enzyme_list": [
"P03956-1",
"P14780-1",
"P08253-1",
"P45452-1",
"P09238-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1592436",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1592436"
}
]
},
{
"id": "R-HSA-1602473",
"name": "Autocatalytic activation of MMP1",
"equation": "",
"summary": "Following initiating proteolytic cleavage by serine proteases the Cys92-Zn2+ bond is destabilized allowing autocleavage at Thr83-Leu84, generating a 42 kDa active form of MMP1 with about 20% of the activity of the 41 kDa form (Suzuki et al. 1990). Full activation is brought about by a further cleavage at Gln99-Phe100.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [
"R-HSA-1604355",
"R-HSA-1604367"
],
"enzyme_list": [
"P03956-1"
],
"evidence": [
{
"id": "R-HSA-1602473",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1602473"
}
]
},
{
"id": "R-HSA-1604359",
"name": "Initial activation of proMMP2 by MMP1, 7",
"equation": "",
"summary": "MMP2 can be activated by MMP1 (Crabbe et al. 1994a, Sang et al. 1996) and MMP7 (Crabbe et al. 1994b, Sang et al. 1996). MMP1 initially cleaves either Pro33-Ile34 or Asn66-Leu67. This is followed by autolytic cleavage at Asn109-Tyr110 (Crabbe et al. 1994a, Okada et al. 1990, Sang et al. 1996). MMP1 and MMP7 are not efficient activators of MMP2; significant physiological activation of proMMP2 is performed by the MT-MMPs MMP14 (Sato et al. 1994), MMP15 (Butler et al. 1997, Morrison et al. 2001) and MMP16 (Takino et al. 1995). Residue numbering here refers to the UniProt canonical sequence.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604364"
],
"output_participant_list": [
"R-HSA-1604347"
],
"enzyme_list": [
"P03956-1",
"P08253-1",
"P09237-1"
],
"evidence": [
{
"id": "R-HSA-1604359",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1604359"
}
]
},
{
"id": "R-HSA-1604690",
"name": "Activation of MMP9 intermediate form by MMPs",
"equation": "",
"summary": "The intermediate form of MMP9 is activated by cleavage of the Arg106-Phe107 peptide bond producing the fullly active 82-kDa MMP-9 species (Ogata et al. 1992, Fridman et al. 1995).",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-HSA-1604726"
],
"output_participant_list": [
"R-HSA-1604699"
],
"enzyme_list": [
"P03956-1",
"P14780-1",
"P08253-1",
"P45452-1",
"P09238-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-1604690",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1604690"
}
]
},
{
"id": "R-HSA-375135",
"name": "Basigin binds Matrix metalloproteinase-1",
"equation": "",
"summary": "Basigin (BSG, CD147, EMPRIN) is a glycoprotein expressed on the surface of most tumor cells. It stimulates stromal cells to produce elevated levels of several matrix metalloproteinases (MMP), including interstitial collagenase (MMP1). MMPs have been implicated in several aspects of tumor progression, including invasion through basement membranes and interstitial matrices, angiogenesis, and tumor cell growth. Basigin not only stimulates the production of MMP1 but also forms a complex with MMP1 at the tumor cell surface. This interaction may be important in modifying the tumor cell pericellular matrix to promote invasion.",
"cellular_location": "extracellular region, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1"
],
"evidence": [
{
"id": "R-HSA-375135",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-375135"
}
]
},
{
"id": "R-HSA-3791149",
"name": "Brevican degradation by MMP1, 2, 3, 7,8,10,13,19",
"equation": "",
"summary": "Brevican, a member of the lectican family, is one of the most abundant proteoglycans in normal adult brain tissues. It is thought to form lattice structures by linking hyaluronan and tenascin-R through its N- and C-terminal globular domains, respectively. As brain extracellular matrix (ECM) contains no collagen fibrils, this matrix of hyaluronan/brevican/tenascin-R is considered essential to maintain the integrity of brain ECM. Degradation of brevican by proteinases disrupts ECM structures and facilitates invasion of glioma cells (Yamaguchi 2000). \n; \n; The major brevican cleavage site observed under physiological conditions (Yamada et al. 1994) and during glioma invasion (Zhang et al. 1998) is the Glu395-Ser396 bond present within the central domain of the core protein, forming an ~50-kDa N-terminal fragment. This bond is cleaved by ADAMTS4 and 5 (Nakamura et al. 2000, Matthews et al. 2000, Nakada et al. 2005). Matrix metalloproteinases that digest brevican (MMP-1, -2, -3, -7, -8, -10, -13 and -19) preferentially cleave the Ala360-Phe361 bond. (Nakamura et al. 2000, Nakada et al. 2005, Lettau et al. 2010).",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P08253-1",
"P45452-1",
"P09238-1",
"P09237-1",
"P08254-1",
"P22894-1",
"Q99542-1"
],
"evidence": [
{
"id": "R-HSA-3791149",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3791149"
}
]
},
{
"id": "R-HSA-3791295",
"name": "Aggrecan degradation by MMP1,2,3,7,9,12,13",
"equation": "",
"summary": "Aggrecan (large aggregating proteoglycan, chondroitin sulfate proteoglycan 1) is a major structural component of cartilage, particularly articular cartilage. The core protein has over 100 chains of chondroitin sulphate and keratan sulphate giving a MWt of about 250 kDa. The core protein has 2 N-terminal globular domains G1 and G2 and a C-terminal globular G3 domain. G2 and G3 are separated by a region heavily modified with negatively charged glycosaminoglycans (GAGs). The two main modifier moieties keratan sulfate (KS) and chondroitin sulfate (CS) are arranged into two CS regions and a KS-rich region. The 15-kDa interglobular linker (IGD) between the N-terminal G1 and G2 domains is particularly susceptible to proteolysis (Caterson et al. 2000). Degradation in this region is associated with the development of osteoarthritis (Troeberg & Nagase 2012). Members of the ADAM (A Disintegrin And Metalloprotease) protein family are believed to be largely responsible for this cleavage (East et al. 2007, Huang & Wu 2008). The majority of aggrecan fragments present in synovial fluid of OA patients are cleaved at Glu392-Ala393 (numbering used here refers to the UniProt sequence, these residues often desgnated Glu373-Ala374 in literature) in the IGD (Sandy et al. 1992).
Matrix metalloproteinase (MMP) 3 was the first protease found to degrade aggrecan. It preferentially cleaves the Asn360-Phe361 bond (numbering used here refers to the UniProt sequence, these residues often desgnated Asn341-Phe342 in literature). (Fosang et al. 1991). MMP2, 7, 9 (Fosang et al. 1992), 1, 8 (Fosang et al. 1993), 13 (Fosang et al. 1996) and 12 (Durigova et al. 2011) were all found to be able to cleave this site as well as other sites towards the C-terminus.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P39900-1",
"P14780-1",
"P08253-1",
"P45452-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-3791295",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3791295"
}
]
},
{
"id": "R-HSA-381435",
"name": "Matrix metalloproteinase proteolyzes IGF:IGFBP3:ALS",
"equation": "",
"summary": "Matrix Metalloprotease-1 and -2 cleave IGFBP-3 in the IGF:IGFBP-3:ALS Complex between amino acids 126 and 127, releasing IGF. The reaction has been demonstrated in vivo.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P08253-1"
],
"evidence": [
{
"id": "R-HSA-381435",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381435"
}
]
},
{
"id": "R-HSA-6789615",
"name": "Expression of STAT3-upregulated extracellular proteins",
"equation": "",
"summary": "Signal transducer and activator of transcription 3 (STAT3) is a key regulator of gene expression in response to signaling of many cytokines including interleukin-6 (IL6), Oncostatin M (OSM), and leukemia inhibitory factor (LIF). Using microarray techniques, hundreds of genes have been reported as potential STAT3 target genes (Dauer et al. 2005, Hsieh et al. 2005). Some have been confirmed as direct STAT3 targets using genome-wide chromatin immunoprecipitation screening (Snyder et al. 2008, Carpenter & Lo 2014).
Genes for extracellular proteins that are upregulated by STAT3 include Lipopolysaccharide-binding protein (LBP) (Schumann et al. 1996), IL10 (Schaefer et al. 2009), IL23A (Kortylewski et al. 2009), Transforming growth factor beta-1 (TGFB1) (Kinjyo et al. 2006), Matrix metalloproteinase-1 (MMP1, Interstitial collagenase) (Itoh et al. 2006), MMP2 (Xie et al. 2004), MMP3 (Liu et al. 2013), MMP9 (Song et al. 2009), Neutrophil gelatinase-associated lipocalin (LCN2) (Jung et al. 2012, Xu et al. 2015), Pro-opiomelanocortin (POMC) (Bosquet et al. 2000), Serum amyloid A-1 protein (SAA1) (Hagihara et al. 2005), Vascular endothelial growth factor A (VEGFA) (Niu et al. 2002), Fibroblast growth factor 2 (FGF2) (Huang et al. 2013), Hepatocyte growth factor (HGF) (Hung & Elliot 2001), IL17A, IL17F (Durant et al. 2010) and Metalloproteinase inhibitor 1 (TIMP1) (Adamson et al. 2013).",
"cellular_location": "extracellular region, nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P03956-1",
"P14780-1",
"P08253-1",
"P08254-1"
],
"evidence": [
{
"id": "R-HSA-6789615",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6789615"
}
]
},
{
"id": "R-NUL-2533972",
"name": "Nid1 degradation by MMP1, 9, 12, ELANE",
"equation": "",
"summary": "Nidogen-1 (entactin) is a member of the nidogen family of basement membrane glycoproteins. It interacts with several other components of basement membranes, notably it connects the collagen and laminin networks to each other (Yurchenko & Patton 2009). MMPs 3, 7 (Mayer et al. 1993), 1, 9, (Sires et al. 1993), 12 (Gronski et al. 1997), 14, 15 (d'Ortho et al. 1997), 19 (Stracke et al. 2000) and leukocyte elastase (Mayer et al. 1993) can all degrade Nidogen-1.",
"cellular_location": "extracellular region",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P08246-1",
"P03956-1",
"P39900-1",
"P14780-1"
],
"evidence": [
{
"id": "R-NUL-2533972",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-NUL-2533972"
}
]
},
{
"id": "R-NUL-3814821",
"name": "Aggrecan degradation by MMP1,2,3,7,9,12,13",
"equation": "",
"summary": "Aggrecan (large aggregating proteoglycan, chondroitin sulfate proteoglycan 1) is a major structural component of cartilage, particularly articular cartilage. The core protein has over 100 chains of chondroitin sulphate and keratan sulphate giving a MWt of about 250 kDa. The core protein has 2 N-terminal globular domains G1 and G2 and a C-terminal globular G3 domain. G2 and G3 are separated by a region heavily modified with negatively charged glycosaminoglycans (GAGs). The two main modifier moieties keratan sulfate (KS) and chondroitin sulfate (CS) are arranged into two CS regions and a KS-rich region. The 15-kDa interglobular linker (IGD) between the N-terminal G1 and G2 domains is particularly susceptible to proteolysis (Caterson et al. 2000). Degradation in this region is associated with the development of osteoarthritis (Troeberg & Nagase 2012). Members of the ADAM (A Disintegrin And Metalloprotease) protein family are believed to be largely responsible for this cleavage (East et al. 2007, Huang & Wu 2008). The majority of aggrecan fragments present in synovial fluid of OA patients are cleaved at Glu392-Ala393 (numbering used here refers to the UniProt sequence, these residues often desgnated Glu373-Ala374 in literature) in the IGD (Sandy et al. 1992).
Matrix metalloproteinase (MMP) 3 was the first protease found to degrade aggrecan. It preferentially cleaves the Asn360-Phe361 bond (numbering used here refers to the UniProt sequence, these residues often desgnated Asn341-Phe342 in literature). (Fosang et al. 1991). MMP2, 7, 9 (Fosang et al. 1992), 1, 8 (Fosang et al. 1993), 13 (Fosang et al. 1996) and 12 (Durigova et al. 2011) were all found to be able to cleave this site as well as other sites towards the C-terminus.",
"cellular_location": "extracellular region",
"input_participant_list": [
"R-SSC-3814816"
],
"output_participant_list": [
"R-SSC-3814807",
"R-SSC-3814819"
],
"enzyme_list": [
"P03956-1",
"P39900-1",
"P14780-1",
"P08253-1",
"P45452-1",
"P09237-1",
"P08254-1"
],
"evidence": [
{
"id": "R-NUL-3814821",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-NUL-3814821"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-HSA-1602455",
"participant_name": "MMP1(20-469) [extracellular region]",
"crossref": [
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1602470",
"participant_name": "MMP1(54-469) [extracellular region]",
"crossref": [
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1602471",
"participant_name": "MMP1(20-53) [extracellular region]",
"crossref": [
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604347",
"participant_name": "MMP2(30-66) [extracellular region]",
"crossref": [
{
"id": "NP_001121363.1",
"database": "RefSeq",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENST00000437642",
"database": "Ensembl",
"url": ""
},
{
"id": "7XGJ",
"database": "PDB",
"url": ""
},
{
"id": "NP_001289438.1",
"database": "RefSeq",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "ENSG00000087245",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001289437.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1GEN",
"database": "PDB",
"url": ""
},
{
"id": "NP_001289439.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1GXD",
"database": "PDB",
"url": ""
},
{
"id": "3AYU",
"database": "PDB",
"url": ""
},
{
"id": "1629",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSP00000219070",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000444143",
"database": "Ensembl",
"url": ""
},
{
"id": "7XJO",
"database": "PDB",
"url": ""
},
{
"id": "1HOV",
"database": "PDB",
"url": ""
},
{
"id": "P08253",
"database": "ZINC target",
"url": ""
},
{
"id": "ENSP00000394237",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP02804",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P08253",
"database": "UniProt",
"url": ""
},
{
"id": "ENST00000219070",
"database": "Ensembl",
"url": ""
},
{
"id": "16453",
"database": "Orphanet",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1CXW",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000087245-MMP2",
"database": "HPA",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "ENSG00000087245",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000570308",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "P08253",
"database": "GeneCards",
"url": ""
},
{
"id": "1RTG",
"database": "PDB",
"url": ""
},
{
"id": "1KS0",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000461421",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_004521.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1EAK",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000543485",
"database": "Ensembl",
"url": ""
},
{
"id": "1CK7",
"database": "PDB",
"url": ""
},
{
"id": "P08253",
"database": "PRO",
"url": ""
},
{
"id": "P08253",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1J7M",
"database": "PDB",
"url": ""
},
{
"id": "1QIB",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604355",
"participant_name": "MMP1(84-469) [extracellular region]",
"crossref": [
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604364",
"participant_name": "MMP2(30-660) [extracellular region]",
"crossref": [
{
"id": "P08253",
"database": "UniProt",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "1CK7",
"database": "PDB",
"url": ""
},
{
"id": "7XJO",
"database": "PDB",
"url": ""
},
{
"id": "1CXW",
"database": "PDB",
"url": ""
},
{
"id": "7XGJ",
"database": "PDB",
"url": ""
},
{
"id": "NP_004521.1",
"database": "RefSeq",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "NP_001289439.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P08253",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "P08253",
"database": "ZINC target",
"url": ""
},
{
"id": "16453",
"database": "Orphanet",
"url": ""
},
{
"id": "NP_001121363.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1KS0",
"database": "PDB",
"url": ""
},
{
"id": "1629",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSG00000087245",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_001289437.1",
"database": "RefSeq",
"url": ""
},
{
"id": "1QIB",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02804",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENSG00000087245-MMP2",
"database": "HPA",
"url": ""
},
{
"id": "NP_001289438.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000543485",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000444143",
"database": "Ensembl",
"url": ""
},
{
"id": "P08253",
"database": "GeneCards",
"url": ""
},
{
"id": "1GXD",
"database": "PDB",
"url": ""
},
{
"id": "P08253",
"database": "PRO",
"url": ""
},
{
"id": "1HOV",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000219070",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENSP00000461421",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000219070",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000570308",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000087245",
"database": "Ensembl",
"url": ""
},
{
"id": "1J7M",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000394237",
"database": "Ensembl",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "ENST00000437642",
"database": "Ensembl",
"url": ""
},
{
"id": "1EAK",
"database": "PDB",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "MMP2_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "1GEN",
"database": "PDB",
"url": ""
},
{
"id": "1RTG",
"database": "PDB",
"url": ""
},
{
"id": "3AYU",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604367",
"participant_name": "MMP1(54-83) [extracellular region]",
"crossref": [
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604376",
"participant_name": "MMP9(20-707) [extracellular region]",
"crossref": [
{
"id": "P14780",
"database": "UniProt",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "4XCT",
"database": "PDB",
"url": ""
},
{
"id": "2OW0",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02128",
"database": "HMDB Protein",
"url": ""
},
{
"id": "4WZV",
"database": "PDB",
"url": ""
},
{
"id": "2OVZ",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985-MMP9",
"database": "HPA",
"url": ""
},
{
"id": "P14780",
"database": "ZINC target",
"url": ""
},
{
"id": "P14780",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1ITV",
"database": "PDB",
"url": ""
},
{
"id": "4JQG",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "GeneCards",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1L6J",
"database": "PDB",
"url": ""
},
{
"id": "4JIJ",
"database": "PDB",
"url": ""
},
{
"id": "6ESM",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "2OVX",
"database": "PDB",
"url": ""
},
{
"id": "4H3X",
"database": "PDB",
"url": ""
},
{
"id": "5TH9",
"database": "PDB",
"url": ""
},
{
"id": "4H2E",
"database": "PDB",
"url": ""
},
{
"id": "5TH6",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_004985.2",
"database": "RefSeq",
"url": ""
},
{
"id": "1GKD",
"database": "PDB",
"url": ""
},
{
"id": "4HMA",
"database": "PDB",
"url": ""
},
{
"id": "5UE4",
"database": "PDB",
"url": ""
},
{
"id": "1GKC",
"database": "PDB",
"url": ""
},
{
"id": "4H82",
"database": "PDB",
"url": ""
},
{
"id": "5UE3",
"database": "PDB",
"url": ""
},
{
"id": "2OW1",
"database": "PDB",
"url": ""
},
{
"id": "5CUH",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "Ensembl",
"url": ""
},
{
"id": "18601",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSP00000361405",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000372330",
"database": "Ensembl",
"url": ""
},
{
"id": "1633",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2OW2",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "PRO",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "5I12",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "4H1Q",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604685",
"participant_name": "MMP9(20-59) [extracellular region]",
"crossref": [
{
"id": "MMP9_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1633",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSG00000100985-MMP9",
"database": "HPA",
"url": ""
},
{
"id": "4H82",
"database": "PDB",
"url": ""
},
{
"id": "4JIJ",
"database": "PDB",
"url": ""
},
{
"id": "5I12",
"database": "PDB",
"url": ""
},
{
"id": "4JQG",
"database": "PDB",
"url": ""
},
{
"id": "1GKD",
"database": "PDB",
"url": ""
},
{
"id": "2OW0",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "Ensembl",
"url": ""
},
{
"id": "4H3X",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "2OW1",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "P14780",
"database": "PRO",
"url": ""
},
{
"id": "P14780",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "OpenTargets",
"url": ""
},
{
"id": "4H1Q",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "5UE4",
"database": "PDB",
"url": ""
},
{
"id": "4WZV",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000361405",
"database": "Ensembl",
"url": ""
},
{
"id": "4H2E",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "UniProt",
"url": ""
},
{
"id": "1GKC",
"database": "PDB",
"url": ""
},
{
"id": "1L6J",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000372330",
"database": "Ensembl",
"url": ""
},
{
"id": "2OVZ",
"database": "PDB",
"url": ""
},
{
"id": "5TH6",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "1ITV",
"database": "PDB",
"url": ""
},
{
"id": "NP_004985.2",
"database": "RefSeq",
"url": ""
},
{
"id": "4XCT",
"database": "PDB",
"url": ""
},
{
"id": "5CUH",
"database": "PDB",
"url": ""
},
{
"id": "2OVX",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "6ESM",
"database": "PDB",
"url": ""
},
{
"id": "5UE3",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "ZINC target",
"url": ""
},
{
"id": "2OW2",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "HMDBP02128",
"database": "HMDB Protein",
"url": ""
},
{
"id": "5TH9",
"database": "PDB",
"url": ""
},
{
"id": "18601",
"database": "Orphanet",
"url": ""
},
{
"id": "4HMA",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "GeneCards",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604699",
"participant_name": "MMP9(60-106) [extracellular region]",
"crossref": [
{
"id": "MMP9_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "4WZV",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "ENSG00000100985-MMP9",
"database": "HPA",
"url": ""
},
{
"id": "4JQG",
"database": "PDB",
"url": ""
},
{
"id": "2OW0",
"database": "PDB",
"url": ""
},
{
"id": "1L6J",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "ZINC target",
"url": ""
},
{
"id": "HMDBP02128",
"database": "HMDB Protein",
"url": ""
},
{
"id": "P14780",
"database": "GeneCards",
"url": ""
},
{
"id": "P14780",
"database": "UniProt",
"url": ""
},
{
"id": "2OVZ",
"database": "PDB",
"url": ""
},
{
"id": "1ITV",
"database": "PDB",
"url": ""
},
{
"id": "4XCT",
"database": "PDB",
"url": ""
},
{
"id": "5TH9",
"database": "PDB",
"url": ""
},
{
"id": "18601",
"database": "Orphanet",
"url": ""
},
{
"id": "4HMA",
"database": "PDB",
"url": ""
},
{
"id": "6ESM",
"database": "PDB",
"url": ""
},
{
"id": "5UE3",
"database": "PDB",
"url": ""
},
{
"id": "2OW2",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "1GKC",
"database": "PDB",
"url": ""
},
{
"id": "5TH6",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000372330",
"database": "Ensembl",
"url": ""
},
{
"id": "2OVX",
"database": "PDB",
"url": ""
},
{
"id": "5CUH",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "NP_004985.2",
"database": "RefSeq",
"url": ""
},
{
"id": "4JIJ",
"database": "PDB",
"url": ""
},
{
"id": "5UE4",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000361405",
"database": "Ensembl",
"url": ""
},
{
"id": "4H2E",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "OpenTargets",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "2OW1",
"database": "PDB",
"url": ""
},
{
"id": "4H1Q",
"database": "PDB",
"url": ""
},
{
"id": "4H82",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "1633",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "4H3X",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "Ensembl",
"url": ""
},
{
"id": "5I12",
"database": "PDB",
"url": ""
},
{
"id": "1GKD",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-1604726",
"participant_name": "MMP9(60-707) [extracellular region]",
"crossref": [
{
"id": "P14780",
"database": "UniProt",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "4XCT",
"database": "PDB",
"url": ""
},
{
"id": "2OW0",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP02128",
"database": "HMDB Protein",
"url": ""
},
{
"id": "4WZV",
"database": "PDB",
"url": ""
},
{
"id": "2OVZ",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985-MMP9",
"database": "HPA",
"url": ""
},
{
"id": "P14780",
"database": "ZINC target",
"url": ""
},
{
"id": "P14780",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "1ITV",
"database": "PDB",
"url": ""
},
{
"id": "4JQG",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "GeneCards",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "1L6J",
"database": "PDB",
"url": ""
},
{
"id": "4JIJ",
"database": "PDB",
"url": ""
},
{
"id": "6ESM",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "2OVX",
"database": "PDB",
"url": ""
},
{
"id": "4H3X",
"database": "PDB",
"url": ""
},
{
"id": "5TH9",
"database": "PDB",
"url": ""
},
{
"id": "4H2E",
"database": "PDB",
"url": ""
},
{
"id": "5TH6",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_004985.2",
"database": "RefSeq",
"url": ""
},
{
"id": "1GKD",
"database": "PDB",
"url": ""
},
{
"id": "4HMA",
"database": "PDB",
"url": ""
},
{
"id": "5UE4",
"database": "PDB",
"url": ""
},
{
"id": "1GKC",
"database": "PDB",
"url": ""
},
{
"id": "4H82",
"database": "PDB",
"url": ""
},
{
"id": "5UE3",
"database": "PDB",
"url": ""
},
{
"id": "2OW1",
"database": "PDB",
"url": ""
},
{
"id": "5CUH",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100985",
"database": "Ensembl",
"url": ""
},
{
"id": "18601",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSP00000361405",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000372330",
"database": "Ensembl",
"url": ""
},
{
"id": "1633",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "2OW2",
"database": "PDB",
"url": ""
},
{
"id": "P14780",
"database": "PRO",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "5I12",
"database": "PDB",
"url": ""
},
{
"id": "MMP9_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "4H1Q",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2167968",
"participant_name": "Collagen type X fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2168008",
"participant_name": "Collagen type XI fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2168017",
"participant_name": "Collagen type VIII fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2214333",
"participant_name": "Collagen type VII fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2327729",
"participant_name": "Fibronectin matrix [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2467150",
"participant_name": "Cleaved collagen type I fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2470309",
"participant_name": "Cleaved collagen type VII fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2470314",
"participant_name": "Cleaved collagen type VIII fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2470532",
"participant_name": "Cleaved collagen type X fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2470603",
"participant_name": "Cleaved collagen type XI fibril [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2533900",
"participant_name": "Cleaved fibronectin matrix [extracellular region]",
"crossref": [
{
"id": "36080",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2533959",
"participant_name": "NID1(29-?) [extracellular region]",
"crossref": [
{
"id": "P14543",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000355554",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "GeneCards",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000264187",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_002499.2",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000366595",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000116962-NID1",
"database": "HPA",
"url": ""
},
{
"id": "ENST00000264187",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2533960",
"participant_name": "NID1(?-1247) [extracellular region]",
"crossref": [
{
"id": "ENSP00000355554",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "P14543",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "OpenTargets",
"url": ""
},
{
"id": "P14543",
"database": "GeneCards",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "UniProt",
"url": ""
},
{
"id": "ENSP00000264187",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_002499.2",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000366595",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000116962-NID1",
"database": "HPA",
"url": ""
},
{
"id": "ENST00000264187",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-375064",
"participant_name": "MMP1(100-469) [extracellular region]",
"crossref": [
{
"id": "2CLT",
"database": "PDB",
"url": ""
},
{
"id": "1CGL",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "HMDBP02457",
"database": "HMDB Protein",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "P03956",
"database": "GeneCards",
"url": ""
},
{
"id": "P03956",
"database": "ZINC target",
"url": ""
},
{
"id": "966C",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000322788",
"database": "Ensembl",
"url": ""
},
{
"id": "4AUO",
"database": "PDB",
"url": ""
},
{
"id": "2J0T",
"database": "PDB",
"url": ""
},
{
"id": "1HFC",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "Ensembl",
"url": ""
},
{
"id": "2AYK",
"database": "PDB",
"url": ""
},
{
"id": "P03956",
"database": "UniProt",
"url": ""
},
{
"id": "1CGE",
"database": "PDB",
"url": ""
},
{
"id": "3AYK",
"database": "PDB",
"url": ""
},
{
"id": "NP_002412.1",
"database": "RefSeq",
"url": ""
},
{
"id": "21204",
"database": "Orphanet",
"url": ""
},
{
"id": "1SU3",
"database": "PDB",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "ENST00000315274",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000196611",
"database": "OpenTargets",
"url": ""
},
{
"id": "P03956",
"database": "PRO",
"url": ""
},
{
"id": "MMP1_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "4AYK",
"database": "PDB",
"url": ""
},
{
"id": "1CGF",
"database": "PDB",
"url": ""
},
{
"id": "1AYK",
"database": "PDB",
"url": ""
},
{
"id": "3SHI",
"database": "PDB",
"url": ""
},
{
"id": "1628",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSG00000196611-MMP1",
"database": "HPA",
"url": ""
},
{
"id": "2TCL",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-383375",
"participant_name": "NID1 [extracellular region]",
"crossref": [
{
"id": "P14543",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "OpenTargets",
"url": ""
},
{
"id": "NP_002499.2",
"database": "RefSeq",
"url": ""
},
{
"id": "P14543",
"database": "PRO",
"url": ""
},
{
"id": "ENST00000264187",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000116962",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000264187",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000355554",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000116962-NID1",
"database": "HPA",
"url": ""
},
{
"id": "P14543",
"database": "GeneCards",
"url": ""
},
{
"id": "ENST00000366595",
"database": "Ensembl",
"url": ""
},
{
"id": "P14543",
"database": "Pharos - Targets",
"url": ""
}
]
},
{
"participant_id": "R-SSC-3814807",
"participant_name": "ACAN C-terminal fragment [extracellular region]",
"crossref": [
{
"id": "Q29011",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000157766",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-SSC-3814816",
"participant_name": "ACAN [extracellular region]",
"crossref": [
{
"id": "Q29011",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000157766",
"database": "OpenTargets",
"url": ""
}
]
},
{
"participant_id": "R-SSC-3814819",
"participant_name": "ACAN N-terminal fragment [extracellular region]",
"crossref": [
{
"id": "ENSG00000157766",
"database": "OpenTargets",
"url": ""
},
{
"id": "Q29011",
"database": "UniProt",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O60882",
"gene_name": "MMP20",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "O60882",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O60882"
}
]
}
]
},
{
"uniprot_ac": "P00747",
"gene_name": "PLG",
"activity": [
{
"ec_number": "3.4.21.7",
"activity": "Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747"
}
]
},
{
"ec_number": "3.4.21.7",
"activity": "",
"evidence": [
{
"id": "P00747",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00747"
}
]
}
]
},
{
"uniprot_ac": "P03952",
"gene_name": "KLKB1",
"activity": [
{
"ec_number": "3.4.21.34",
"activity": "Cleaves selectively Arg-|-Xaa and Lys-|-Xaa bonds, including Lys-|-Arg and Arg-|-Ser bonds in (human) kininogen to release bradykinin.",
"evidence": [
{
"id": "P03952",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03952"
}
]
},
{
"ec_number": "3.4.21.34",
"activity": "",
"evidence": [
{
"id": "P03952",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03952"
}
]
}
]
},
{
"uniprot_ac": "P03956",
"gene_name": "MMP1",
"activity": [
{
"ec_number": "3.4.24.7",
"activity": "Cleavage of the triple helix of collagen at about three-quarters of the length of the molecule from the N-terminus, at 775-Gly-|-Ile-776 in the alpha1(I) chain. Cleaves synthetic substrates and alpha-macroglobulins at bonds where P1' is a hydrophobic residue.",
"evidence": [
{
"id": "P03956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03956"
}
]
},
{
"ec_number": "3.4.24.7",
"activity": "",
"evidence": [
{
"id": "P03956",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P03956"
}
]
}
]
},
{
"uniprot_ac": "P07477",
"gene_name": "PRSS1",
"activity": [
{
"ec_number": "3.4.21.4",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.",
"evidence": [
{
"id": "P07477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07477"
}
]
},
{
"ec_number": "3.4.21.4",
"activity": "",
"evidence": [
{
"id": "P07477",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07477"
}
]
}
]
},
{
"uniprot_ac": "P07478",
"gene_name": "PRSS2",
"activity": [
{
"ec_number": "3.4.21.4",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.",
"evidence": [
{
"id": "P07478",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07478"
}
]
},
{
"ec_number": "3.4.21.4",
"activity": "",
"evidence": [
{
"id": "P07478",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07478"
}
]
}
]
},
{
"uniprot_ac": "P08246",
"gene_name": "ELANE",
"activity": [
{
"ec_number": "3.4.21.37",
"activity": "Hydrolysis of proteins, including elastin. Preferential cleavage: Val-|-Xaa > Ala-|-Xaa.",
"evidence": [
{
"id": "P08246",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08246"
}
]
},
{
"ec_number": "3.4.21.37",
"activity": "",
"evidence": [
{
"id": "P08246",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08246"
}
]
}
]
},
{
"uniprot_ac": "P08253",
"gene_name": "MMP2",
"activity": [
{
"ec_number": "3.4.24.24",
"activity": "Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.",
"evidence": [
{
"id": "P08253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08253"
}
]
},
{
"ec_number": "3.4.24.24",
"activity": "",
"evidence": [
{
"id": "P08253",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08253"
}
]
}
]
},
{
"uniprot_ac": "P08254",
"gene_name": "MMP3",
"activity": [
{
"ec_number": "3.4.24.17",
"activity": "Preferential cleavage where P1', P2' and P3' are hydrophobic residues.",
"evidence": [
{
"id": "P08254",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08254"
}
]
},
{
"ec_number": "3.4.24.17",
"activity": "",
"evidence": [
{
"id": "P08254",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08254"
}
]
}
]
},
{
"uniprot_ac": "P08311",
"gene_name": "CTSG",
"activity": [
{
"ec_number": "3.4.21.20",
"activity": "Specificity similar to chymotrypsin C.",
"evidence": [
{
"id": "P08311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08311"
}
]
},
{
"ec_number": "3.4.21.20",
"activity": "",
"evidence": [
{
"id": "P08311",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08311"
}
]
}
]
},
{
"uniprot_ac": "P09237",
"gene_name": "MMP7",
"activity": [
{
"ec_number": "3.4.24.23",
"activity": "Cleavage of 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in B chain of insulin. No action on collagen types I, II, IV, V. Cleaves gelatin chain alpha2(I) > alpha1(I).",
"evidence": [
{
"id": "P09237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09237"
}
]
},
{
"ec_number": "3.4.24.23",
"activity": "",
"evidence": [
{
"id": "P09237",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09237"
}
]
}
]
},
{
"uniprot_ac": "P09238",
"gene_name": "MMP10",
"activity": [
{
"ec_number": "3.4.24.22",
"activity": "Similar to stromelysin 1, but action on collagen types III, IV and V is weak.",
"evidence": [
{
"id": "P09238",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09238"
}
]
},
{
"ec_number": "3.4.24.22",
"activity": "",
"evidence": [
{
"id": "P09238",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09238"
}
]
}
]
},
{
"uniprot_ac": "P14780",
"gene_name": "MMP9",
"activity": [
{
"ec_number": "3.4.24.35",
"activity": "Cleavage of gelatin types I and V and collagen types IV and V.",
"evidence": [
{
"id": "P14780",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14780"
}
]
},
{
"ec_number": "3.4.24.35",
"activity": "",
"evidence": [
{
"id": "P14780",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14780"
}
]
}
]
},
{
"uniprot_ac": "P22894",
"gene_name": "MMP8",
"activity": [
{
"ec_number": "3.4.24.34",
"activity": "Cleavage of interstitial collagens in the triple helical domain. Unlike EC 3.4.24.7, this enzyme cleaves type III collagen more slowly than type I.",
"evidence": [
{
"id": "P22894",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22894"
}
]
},
{
"ec_number": "3.4.24.34",
"activity": "",
"evidence": [
{
"id": "P22894",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P22894"
}
]
}
]
},
{
"uniprot_ac": "P23946",
"gene_name": "CMA1",
"activity": [
{
"ec_number": "3.4.21.39",
"activity": "Preferential cleavage: Phe-|-Xaa > Tyr-|-Xaa > Trp-|-Xaa > Leu-|-Xaa.",
"evidence": [
{
"id": "P23946",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23946"
}
]
},
{
"ec_number": "3.4.21.39",
"activity": "",
"evidence": [
{
"id": "P23946",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P23946"
}
]
}
]
},
{
"uniprot_ac": "P24347",
"gene_name": "MMP11",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "P24347",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24347"
}
]
}
]
},
{
"uniprot_ac": "P25774",
"gene_name": "CTSS",
"activity": [
{
"ec_number": "3.4.22.27",
"activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.",
"evidence": [
{
"id": "P25774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25774"
}
]
},
{
"ec_number": "3.4.22.27",
"activity": "",
"evidence": [
{
"id": "P25774",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25774"
}
]
}
]
},
{
"uniprot_ac": "P39900",
"gene_name": "MMP12",
"activity": [
{
"ec_number": "3.4.24.65",
"activity": "Hydrolysis of soluble and insoluble elastin. Specific cleavages are also produced at 14-Ala-|-Leu-15 and 16-Tyr-|-Leu-17 in the B chain of insulin.",
"evidence": [
{
"id": "P39900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39900"
}
]
},
{
"ec_number": "3.4.24.65",
"activity": "",
"evidence": [
{
"id": "P39900",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P39900"
}
]
}
]
},
{
"uniprot_ac": "P45452",
"gene_name": "MMP13",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "P45452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P45452"
}
]
}
]
},
{
"uniprot_ac": "Q15661",
"gene_name": "TPSAB1",
"activity": [
{
"ec_number": "3.4.21.59",
"activity": "Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa, but with more restricted specificity than trypsin.",
"evidence": [
{
"id": "Q15661",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15661"
}
]
},
{
"ec_number": "3.4.21.59",
"activity": "",
"evidence": [
{
"id": "Q15661",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15661"
}
]
}
]
},
{
"uniprot_ac": "Q99542",
"gene_name": "MMP19",
"activity": [
{
"ec_number": "3.4.24.-",
"activity": "",
"evidence": [
{
"id": "Q99542",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99542"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [
120,
143
],
"o_linked_sites": [],
"snv_sites": [
122,
145,
182,
228,
317,
434
],
"glycation_sites": [],
"phosphorylation_sites": [
57,
274,
280,
288,
289,
360
],
"sequon_annotation_sites": [
{
"start_pos": 120,
"end_pos": 122
},
{
"start_pos": 143,
"end_pos": 145
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 55
},
{
"field": "total_sites",
"count": 3
},
{
"field": "n_linked_glycans",
"count": 48
},
{
"field": "n_linked_glycan_sites",
"count": 4
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 1
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 54
},
{
"field": "total_sites",
"count": 3
},
{
"field": "n_linked_glycans",
"count": 48
},
{
"field": "n_linked_glycan_sites",
"count": 3
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 6
},
{
"field": "total_sites",
"count": 6
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 7
},
{
"field": "total_sites",
"count": 6
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 6
},
{
"field": "total_sites",
"count": 5
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 307
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}