{ "uniprot_canonical_ac": "P03950-1", "uniprot_ac": "P03950", "uniprot_id": "ANGI_HUMAN", "mass": { "chemical_mass": 16550.0, "monoisotopic_mass": 16550.0 }, "refseq": { "ac": "NP_001091046", "name": "angiogenin precursor", "summary": "The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called angiogenin. This protein induces angiogenesis after binding to actin on the surface of endothelial cells. This protein also accumulates at the nucleolus where it stimulates ribosomal transcription. Under stress conditions this protein translocates to the cytosol where it hydrolyzes cellular tRNAs and influences protein synthesis. A signal peptide is cleaved from the precursor protein to produce a mature protein which contains a nuclear localization signal, a cell binding motif, and a catalytic domain. This protein has been shown to be both neurotrophic and neuroprotective and the mature protein has antimicrobial activity against some bacteria and fungi, including S. pneumoniae and C. albicans. Due to its effect on rRNA production and angiogenesis this gene plays important roles in cell growth and tumor progression. Mutations in this gene are associated with progression of amyotrophic lateral sclerosis (ALS). This gene and the neighboring RNase4 gene share promoters and 5' exons though each gene then splices to a distinct 3' exon containing the complete coding region of each gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, "gene_names": [ { "name": "ANG", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P03950", "id": "P03950" }, { "name": "ALS9; HEL168; RAA1; RNASE4; RNASE5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046", "id": "NP_001091046" }, { "name": "ANG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046", "id": "NP_001091046" }, { "name": "RNASE5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P03950", "id": "P03950" } ], "protein_names": [ { "name": "Angiogenin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P03950" }, { "name": "3.1.27.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03950" }, { "name": "RNase 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03950" }, { "name": "Ribonuclease 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P03950" }, { "name": "angiogenin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046", "id": "NP_001091046" }, { "name": "epididymis luminal protein 168; RNase 5; ribonuclease 5; ribonuclease A A1; angiogenin, ribonuclease, RNase A family, 5; ribonuclease A family member 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046", "id": "NP_001091046" } ], "function": [ { "annotation": "Angiogenin and MMP-2 as potential biomarkers in the differential diagnosis of gestational trophoblastic diseases.", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, { "database": "PubMed", "id": "35119039", "url": "https://glygen.org/publication/PubMed/35119039" } ] }, { "annotation": "Angiogenin and plexin-B2 axis promotes glioblastoma progression by enhancing invasion, vascular association, proliferation and survival.", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, { "database": "PubMed", "id": "35418212", "url": "https://glygen.org/publication/PubMed/35418212" } ] }, { "annotation": "Angiogenin as a Possible Mediator of Macrophage-Mediated Regulation of Fibroblast Functions.", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, { "database": "PubMed", "id": "37861896", "url": "https://glygen.org/publication/PubMed/37861896" } ] }, { "annotation": "Human angiogenin has antimicrobial activity against C. albicans and S. pneumoniae.", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, { "database": "PubMed", "id": "12548285", "url": "https://glygen.org/publication/PubMed/12548285" } ] }, { "annotation": "Non-enzymatic glycation of human angiogenin: Effects on enzymatic activity and binding to hRI and DNA.", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" }, { "database": "PubMed", "id": "36592684", "url": "https://glygen.org/publication/PubMed/36592684" } ] }, { "annotation": "Ribonuclease that cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs) (PubMed:1400510, PubMed:21855800). Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus (PubMed:8127865). Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA (PubMed:12051708). Angiogenin induces vascularization of normal and malignant tissues (PubMed:19354288). Angiogenic activity is regulated by interaction with RNH1 in vivo (PubMed:19354288).", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950#function" }, { "database": "PubMed", "id": "19354288", "url": "https://glygen.org/publication/PubMed/19354288" }, { "database": "PubMed", "id": "21855800", "url": "https://glygen.org/publication/PubMed/21855800" }, { "database": "PubMed", "id": "12051708", "url": "https://glygen.org/publication/PubMed/12051708" }, { "database": "PubMed", "id": "8127865", "url": "https://glygen.org/publication/PubMed/8127865" }, { "database": "PubMed", "id": "1400510", "url": "https://glygen.org/publication/PubMed/1400510" } ] }, { "annotation": "The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called angiogenin. This protein induces angiogenesis after binding to actin on the surface of endothelial cells. This protein also accumulates at the nucleolus where it stimulates ribosomal transcription. Under stress conditions this protein translocates to the cytosol where it hydrolyzes cellular tRNAs and influences protein synthesis. A signal peptide is cleaved from the precursor protein to produce a mature protein which contains a nuclear localization signal, a cell binding motif, and a catalytic domain. This protein has been shown to be both neurotrophic and neuroprotective and the mature protein has antimicrobial activity against some bacteria and fungi, including S. pneumoniae and C. albicans. Due to its effect on rRNA production and angiogenesis this gene plays important roles in cell growth and tumor progression. Mutations in this gene are associated with progression of amyotrophic lateral sclerosis (ALS). This gene and the neighboring RNase4 gene share promoters and 5' exons though each gene then splices to a distinct 3' exon containing the complete coding region of each gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ] } ], "disease": [ { "disease_id": "DOID:0060200", "recommended_name": { "id": "DOID:0060200", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060200", "name": "amyotrophic lateral sclerosis type 9", "description": "An amyotrophic lateral sclerosis that has_material_basis_in mutation in the ANG gene on chromosome 14." }, "synonyms": [ { "id": "DOID:0060200", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060200", "name": "ALS9", "description": "" }, { "id": "DOID:0060200", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060200", "name": "amyotrophic lateral sclerosis 9", "description": "" }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "amyotrophic lateral sclerosis type 9", "description": "Any amyotrophic lateral sclerosis in which the cause of the disease is a mutation in the ANG gene." }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "ALS9", "description": "" }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "ANG amyotrophic lateral sclerosis", "description": "" }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "amyotrophic lateral sclerosis 9", "description": "" }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "amyotrophic lateral sclerosis caused by mutation in ANG", "description": "" }, { "id": "MONDO:0012753", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012753", "name": "amyotrophic lateral sclerosis type 9", "description": "" }, { "id": "MIM:611895", "resource": "MIM", "url": "https://www.omim.org/entry/611895", "name": "Amyotrophic lateral sclerosis 9", "description": "Amyotrophic lateral sclerosis 9" } ], "evidence": [ { "id": "611895", "database": "MIM", "url": "https://www.omim.org/entry/611895" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 109, "end_pos": 110, "sequence_org": "GG", "sequence_mut": "RR", "comment": "Significantly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "19354288", "url": "https://glygen.org/publication/PubMed/19354288" } ] }, { "start_pos": 132, "end_pos": 132, "sequence_org": "E", "sequence_mut": "A", "comment": "Slightly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" } ] }, { "start_pos": 140, "end_pos": 140, "sequence_org": "D", "sequence_mut": "A", "comment": "15- to 18-fold increase in RNase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "start_pos": 140, "end_pos": 140, "sequence_org": "D", "sequence_mut": "H", "comment": "15- to 18-fold increase in RNase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "start_pos": 140, "end_pos": 140, "sequence_org": "D", "sequence_mut": "S", "comment": "15- to 18-fold increase in RNase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "start_pos": 141, "end_pos": 141, "sequence_org": "Q", "sequence_mut": "G", "comment": "Over 18-fold increase in RNase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "start_pos": 143, "end_pos": 144, "sequence_org": "IF", "sequence_mut": "AA", "comment": "3- to 5-fold increase in RNase activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "start_pos": 29, "end_pos": 29, "sequence_org": "R", "sequence_mut": "A", "comment": "Significantly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "10413501", "url": "https://glygen.org/publication/PubMed/10413501" } ] }, { "start_pos": 32, "end_pos": 32, "sequence_org": "H", "sequence_mut": "A", "comment": "Significantly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" } ] }, { "start_pos": 36, "end_pos": 36, "sequence_org": "Q", "sequence_mut": "A", "comment": "Slightly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "L", "sequence_mut": "P", "comment": "Homodimerization is similar to wild-type; causes mislocalization in the cytoplasm; strongly reduces ribonucleolytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "25372031", "url": "https://glygen.org/publication/PubMed/25372031" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "K", "sequence_mut": "Q", "comment": "Significantly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" }, { "database": "PubMed", "id": "10413501", "url": "https://glygen.org/publication/PubMed/10413501" } ] }, { "start_pos": 92, "end_pos": 92, "sequence_org": "N", "sequence_mut": "A", "comment": "Slightly decreases binding affinity for RNH1.", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "80.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "68.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "86.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "78.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "78.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "61.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P03950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P03950" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "common_name": "Human" } ], "gene": [ { "name": "ANG", "url": "https://www.uniprot.org/uniprot/P03950", "locus": { "chromosome": "14", "start_pos": 15010, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_653", "url": "https://www.ensembl.org/id/LRG_653" } ] } } ], "crossref": [ { "id": "ENSG00000214274", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000214274", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06265", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06265", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5829", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5829", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "ANG", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ANG", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "283", "url": "https://www.ncbi.nlm.nih.gov/gene/283", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "483", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=483", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P03950", "url": "https://www.ebi.ac.uk/intact/interactors/id:P03950*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023411", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023411", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023412", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023412", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036816", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036816", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:283", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:283", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "105850", "url": "http://www.omim.org/entry/105850", "database": "MIM", "categories": [ "Other" ] }, { "id": "611895", "url": "http://www.omim.org/entry/611895", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P03950", "url": "https://www.nextprot.org/entry/NX_P03950", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P03950", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P03950", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "INTFVHG", "url": "https://omabrowser.org/oma/group/INTFVHG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4612546at2759", "url": "http://www.orthodb.org/?query=4612546at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11437", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11437", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11437:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11437:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A4Y", "url": "https://www.rcsb.org/structure/1A4Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ANG", "url": "https://www.rcsb.org/structure/1ANG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AWZ", "url": "https://www.rcsb.org/structure/1AWZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1B1E", "url": "https://www.rcsb.org/structure/1B1E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1B1I", "url": "https://www.rcsb.org/structure/1B1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1B1J", "url": "https://www.rcsb.org/structure/1B1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GV7", "url": "https://www.rcsb.org/structure/1GV7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H0D", "url": "https://www.rcsb.org/structure/1H0D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H52", "url": "https://www.rcsb.org/structure/1H52", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H53", "url": "https://www.rcsb.org/structure/1H53", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HBY", "url": "https://www.rcsb.org/structure/1HBY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K58", "url": "https://www.rcsb.org/structure/1K58", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K59", "url": "https://www.rcsb.org/structure/1K59", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K5A", "url": "https://www.rcsb.org/structure/1K5A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K5B", "url": "https://www.rcsb.org/structure/1K5B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UN3", "url": "https://www.rcsb.org/structure/1UN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UN4", "url": "https://www.rcsb.org/structure/1UN4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UN5", "url": "https://www.rcsb.org/structure/1UN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ANG", "url": "https://www.rcsb.org/structure/2ANG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHD", "url": "https://www.rcsb.org/structure/4AHD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHE", "url": "https://www.rcsb.org/structure/4AHE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHF", "url": "https://www.rcsb.org/structure/4AHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHG", "url": "https://www.rcsb.org/structure/4AHG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHH", "url": "https://www.rcsb.org/structure/4AHH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHI", "url": "https://www.rcsb.org/structure/4AHI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHJ", "url": "https://www.rcsb.org/structure/4AHJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHK", "url": "https://www.rcsb.org/structure/4AHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHL", "url": "https://www.rcsb.org/structure/4AHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHM", "url": "https://www.rcsb.org/structure/4AHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AHN", "url": "https://www.rcsb.org/structure/4AHN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4AOH", "url": "https://www.rcsb.org/structure/4AOH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4B36", "url": "https://www.rcsb.org/structure/4B36", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EOP", "url": "https://www.rcsb.org/structure/5EOP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EPZ", "url": "https://www.rcsb.org/structure/5EPZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EQO", "url": "https://www.rcsb.org/structure/5EQO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9A", "url": "https://www.rcsb.org/structure/5M9A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9C", "url": "https://www.rcsb.org/structure/5M9C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9G", "url": "https://www.rcsb.org/structure/5M9G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9J", "url": "https://www.rcsb.org/structure/5M9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9M", "url": "https://www.rcsb.org/structure/5M9M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9P", "url": "https://www.rcsb.org/structure/5M9P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9Q", "url": "https://www.rcsb.org/structure/5M9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9R", "url": "https://www.rcsb.org/structure/5M9R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9S", "url": "https://www.rcsb.org/structure/5M9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9T", "url": "https://www.rcsb.org/structure/5M9T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M9V", "url": "https://www.rcsb.org/structure/5M9V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7NPM", "url": "https://www.rcsb.org/structure/7NPM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PNJ", "url": "https://www.rcsb.org/structure/7PNJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PNP", "url": "https://www.rcsb.org/structure/7PNP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PNR", "url": "https://www.rcsb.org/structure/7PNR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AF0", "url": "https://www.rcsb.org/structure/8AF0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00074", "url": "http://pfam.xfam.org/family/PF00074", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P03950", "url": "https://pharos.nih.gov/targets/P03950", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P03950", "url": "http://purl.obolibrary.org/obo/PR_P03950", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P03950-1", "url": "https://www.uniprot.org/uniprot/P03950-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP", "length": 147, "header": "sp|P03950-1|ANGI_HUMAN Isoform 1 of Angiogenin OS=Homo sapiens OX=9606 GN=ANG PE=1 SV=1 CANONICAL=P03950-1" }, "isoforms": [ { "isoform_ac": "P03950-1", "url": "", "sequence": { "sequence": "MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP", "length": 147, "header": "sp|P03950-1|ANGI_HUMAN Isoform 1 of Angiogenin OS=Homo sapiens OX=9606 GN=ANG PE=1 SV=1 CANONICAL=P03950-1" }, "locus": { "chromosome": "14", "start_pos": 20694005, "end_pos": 20693565, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000336811.10", "url": "https://www.ensembl.org/id/ENST00000336811.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000336762.6", "url": "https://www.ensembl.org/id/ENSP00000336762.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P03950", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P03950" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 28, "end_pos": 28, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P03950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03950" }, { "database": "PubMed", "id": "27915233", "url": "https://glygen.org/publication/PubMed/27915233" } ], "site_lbl": "Ser28" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Nectin/PRR: an immunoglobulin-like cell adhesion molecule recruited to cadherin-based adherens junctions through interaction with Afadin, a PDZ domain-containing protein.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Takahashi K, Nakanishi H, Miyahara M, Mandai K, Satoh K, Satoh A, Nishioka H, Aoki J, Nomoto A, Mizoguchi A, Takai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "10225955", "url": "https://glygen.org/publication/PubMed/10225955" } ] }, { "title": "Superadditive and subadditive effects of `hot spot` mutations within the interfaces of placental ribonuclease inhibitor with angiogenin and ribonuclease A.", "journal": "Biochemistry", "date": "1999", "authors": "Chen CZ, Shapiro R", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "10413501", "url": "https://glygen.org/publication/PubMed/10413501" } ] }, { "title": "Binding of phosphate and pyrophosphate ions at the active site of human angiogenin as revealed by X-ray crystallography.", "journal": "Protein science : a publication of the Protein Society", "date": "2001", "authors": "Leonidas DD, Chavali GB, Jardine AM, Li S, Shapiro R, Acharya KR", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "11468363", "url": "https://glygen.org/publication/PubMed/11468363" } ] }, { "title": "Crystallographic studies on the role of the C-terminal segment of human angiogenin in defining enzymatic potency.", "journal": "Biochemistry", "date": "2002", "authors": "Leonidas DD, Shapiro R, Subbarao GV, Russo A, Acharya KR", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "11851402", "url": "https://glygen.org/publication/PubMed/11851402" } ] }, { "title": "Diversifying selection of the tumor-growth promoter angiogenin in primate evolution.", "journal": "Mol. Biol. Evol.", "date": "2002", "authors": "Zhang Jianzhi, Rosenberg Helene F", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "11919285", "url": "https://glygen.org/publication/PubMed/11919285" } ] }, { "title": "The tumor suppressor protein TSLC1 is involved in cell-cell adhesion.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Masuda M, Yageta M, Fukuhara H, Kuramochi M, Maruyama T, Nomoto A, Murakami Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "12050160", "url": "https://glygen.org/publication/PubMed/12050160" } ] }, { "title": "The nuclear function of angiogenin in endothelial cells is related to rRNA production.", "journal": "Biochemical and biophysical research communications", "date": "2002-06-07", "authors": "Xu Zheng-ping, Tsuji Takanori, Riordan James F, Hu Guo-fu", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "12051708", "url": "https://glygen.org/publication/PubMed/12051708" } ] }, { "title": "Angiogenins: a new class of microbicidal proteins involved in innate immunity.", "journal": "Nature immunology", "date": "2003", "authors": "Hooper LV, Stappenbeck TS, Hong CV, Gordon JI", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ], "reference": [ { "type": "PubMed", "id": "12548285", "url": "https://glygen.org/publication/PubMed/12548285" } ] }, { "title": "The crystal structure of human angiogenin in complex with an antitumor neutralizing antibody.", "journal": "Structure", "date": "2003", "authors": "Chavali Gayatri B, Papageorgiou Anastassios C, Olson Karen A, Fett James W, Hu Guo fu, Shapiro Robert, Acharya K Ravi", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "12842050", "url": "https://glygen.org/publication/PubMed/12842050" } ] }, { "title": "Angiogenin is a cytotoxic, tRNA-specific ribonuclease in the RNase A superfamily.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Saxena SK, Rybak SM, Davey RT Jr, Youle RJ, Ackerman EJ", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "1400510", "url": "https://glygen.org/publication/PubMed/1400510" } ] }, { "title": "Crystallographic studies on structural features that determine the enzymatic specificity and potency of human angiogenin: Thr44, Thr80, and residues 38-41.", "journal": "Biochemistry", "date": "2004", "authors": "Holloway Daniel E, Chavali Gayatri B, Hares Michelle C, Baker Matthew D, Subbarao Gowtham V, Shapiro Robert, Acharya K Ravi", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "14756559", "url": "https://glygen.org/publication/PubMed/14756559" } ] }, { "title": "A novel candidate region for ALS on chromosome 14q11.2.", "journal": "Neurology", "date": "2004", "authors": "Greenway MJ, Alexander MD, Ennis S, Traynor BJ, Corr B, Frost E, Green A, Hardiman O", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "15557516", "url": "https://glygen.org/publication/PubMed/15557516" } ] }, { "title": "Crystal structure of the V domain of human Nectin-like molecule-1/Syncam3/Tsll1/Igsf4b, a neural tissue-specific immunoglobulin-like cell-cell adhesion molecule.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dong X, Xu F, Gong Y, Gao J, Lin P, Chen T, Peng Y, Qiang B, Yuan J, Peng X, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "16467305", "url": "https://glygen.org/publication/PubMed/16467305" } ] }, { "title": "ANG mutations segregate with familial and 'sporadic' amyotrophic lateral sclerosis.", "journal": "Nature genetics", "date": "2006", "authors": "Greenway MJ, Andersen PM, Russ C, Ennis S, Cashman S, Donaghy C, Patterson V, Swingler R, Kieran D, Prehn J, Morrison KE, Green A, Acharya KR, Brown RH Jr, Hardiman O", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "16501576", "url": "https://glygen.org/publication/PubMed/16501576" } ] }, { "title": "A novel angiogenin gene mutation in a sporadic patient with amyotrophic lateral sclerosis from southern Italy.", "journal": "Neuromuscul. Disord.", "date": "2008", "authors": "Conforti F L, Sprovieri T, Mazzei R, Ungaro C, La Bella V, Tessitore A, Patitucci A, Magariello A, Gabriele A L, Tedeschi G, Simone I L, Majorana G, Valentino P, Condino F, Bono F, Monsurr\u00f2 M R, Muglia M, Quattrone A", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "17703939", "url": "https://glygen.org/publication/PubMed/17703939" } ] }, { "title": "Angiogenin loss-of-function mutations in amyotrophic lateral sclerosis.", "journal": "Annals of neurology", "date": "2007", "authors": "Wu D, Yu W, Kishikawa H, Folkerth RD, Iafrate AJ, Shen Y, Xin W, Sims K, Hu GF", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "17886298", "url": "https://glygen.org/publication/PubMed/17886298" } ] }, { "title": "Characterization of human angiogenin variants implicated in amyotrophic lateral sclerosis.", "journal": "Biochemistry", "date": "2007", "authors": "Crabtree B, Thiyagarajan N, Prior SH, Wilson P, Iyer S, Ferns T, Shapiro R, Brew K, Subramanian V, Acharya KR", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "17900154", "url": "https://glygen.org/publication/PubMed/17900154" } ] }, { "title": "The adhesion molecule Necl-3/SynCAM-2 localizes to myelinated axons, binds to oligodendrocytes and promotes cell adhesion.", "journal": "BMC neuroscience", "date": "2007", "authors": "Pellissier F, Gerber A, Bauer C, Ballivet M, Ossipow V", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "17967169", "url": "https://glygen.org/publication/PubMed/17967169" } ] }, { "title": "Identification of new ANG gene mutations in a large cohort of Italian patients with amyotrophic lateral sclerosis.", "journal": "Neurogenetics", "date": "2008", "authors": "Gellera C, Colombrita C, Ticozzi N, Castellotti B, Bragato C, Ratti A, Taroni F, Silani V", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "18087731", "url": "https://glygen.org/publication/PubMed/18087731" } ] }, { "title": "Stress induces tRNA cleavage by angiogenin in mammalian cells.", "journal": "FEBS letters", "date": "2009", "authors": "Fu H, Feng J, Liu Q, Sun F, Tie Y, Zhu J, Xing R, Sun Z, Zheng X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "19114040", "url": "https://glygen.org/publication/PubMed/19114040" } ] }, { "title": "Angiogenin cleaves tRNA and promotes stress-induced translational repression.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Yamasaki S, Ivanov P, Hu GF, Anderson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "19332886", "url": "https://glygen.org/publication/PubMed/19332886" } ] }, { "title": "Ribonuclease inhibitor regulates neovascularization by human angiogenin.", "journal": "Biochemistry", "date": "2009", "authors": "Dickson KA, Kang DK, Kwon YS, Kim JC, Leland PA, Kim BM, Chang SI, Raines RT", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "19354288", "url": "https://glygen.org/publication/PubMed/19354288" } ] }, { "title": "Pyrosequencing of small non-coding RNAs in HIV-1 infected cells: evidence for the processing of a viral-cellular double-stranded RNA hybrid.", "journal": "Nucleic acids research", "date": "2009", "authors": "Yeung ML, Bennasser Y, Watashi K, Le SY, Houzet L, Jeang KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "19729508", "url": "https://glygen.org/publication/PubMed/19729508" } ] }, { "title": "Filtering of deep sequencing data reveals the existence of abundant Dicer-dependent small RNAs derived from tRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Cole C, Sobala A, Lu C, Thatcher SR, Bowman A, Brown JW, Green PJ, Barton GJ, Hutvagner G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "19850906", "url": "https://glygen.org/publication/PubMed/19850906" } ] }, { "title": "A novel class of small RNAs: tRNA-derived RNA fragments (tRFs).", "journal": "Genes & development", "date": "2009", "authors": "Lee YS, Shibata Y, Malhotra A, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "19933153", "url": "https://glygen.org/publication/PubMed/19933153" } ] }, { "title": "Angiogenin-induced tRNA-derived stress-induced RNAs promote stress-induced stress granule assembly.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Emara MM, Ivanov P, Hickman T, Dawra N, Tisdale S, Kedersha N, Hu GF, Anderson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "20129916", "url": "https://glygen.org/publication/PubMed/20129916" } ] }, { "title": "Angiogenin-induced tRNA fragments inhibit translation initiation.", "journal": "Molecular cell", "date": "2011", "authors": "Ivanov P, Emara MM, Villen J, Gygi SP, Anderson P", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "21855800", "url": "https://glygen.org/publication/PubMed/21855800" } ] }, { "title": "SOD1, ANG, TARDBP and FUS mutations in amyotrophic lateral sclerosis: a United States clinical testing lab experience.", "journal": "Amyotrophic lateral sclerosis : official publication of the World Federation of Neurology Research Group on Motor Neuron Diseases", "date": "2012", "authors": "Brown JA, Min J, Staropoli JF, Collin E, Bi S, Feng X, Barone R, Cao Y, O'Malley L, Xin W, Mullen TE, Sims KB", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "22292843", "url": "https://glygen.org/publication/PubMed/22292843" } ] }, { "title": "Mechanisms of loss of functions of human angiogenin variants implicated in amyotrophic lateral sclerosis.", "journal": "PLoS ONE", "date": "2012", "authors": "Padhi Aditya K, Kumar Hirdesh, Vasaikar Suhas V, Jayaram Bhyravabhotla, Gomes James", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "22384259", "url": "https://glygen.org/publication/PubMed/22384259" } ] }, { "title": "Identification and functional characterization of tRNA-derived RNA fragments (tRFs) in respiratory syncytial virus infection.", "journal": "Molecular therapy : the journal of the American Society of Gene Therapy", "date": "2013", "authors": "Wang Q, Lee I, Ren J, Ajay SS, Lee YS, Bao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "23183536", "url": "https://glygen.org/publication/PubMed/23183536" } ] }, { "title": "tRNA-derived microRNA modulates proliferation and the DNA damage response and is down-regulated in B cell lymphoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Maute RL, Schneider C, Sumazin P, Holmes A, Califano A, Basso K, Dalla-Favera R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "23297232", "url": "https://glygen.org/publication/PubMed/23297232" } ] }, { "title": "Tissue distribution and developmental expression of the messenger RNA encoding angiogenin.", "journal": "Science", "date": "1987", "authors": "Weiner HL, Weiner LH, Swain JL", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "2440105", "url": "https://glygen.org/publication/PubMed/2440105" } ] }, { "title": "Meta-analysis of tRNA derived RNA fragments reveals that they are evolutionarily conserved and associate with AGO proteins to recognize specific RNA targets.", "journal": "BMC biology", "date": "2014", "authors": "Kumar P, Anaya J, Mudunuri SB, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "25270025", "url": "https://glygen.org/publication/PubMed/25270025" } ] }, { "title": "Computational and functional characterization of Angiogenin mutations, and correlation with amyotrophic lateral sclerosis.", "journal": "PloS one", "date": "2014", "authors": "Padhi AK, Banerjee K, Gomes J, Banerjee M", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" }, { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "25372031", "url": "https://glygen.org/publication/PubMed/25372031" } ] }, { "title": "Small tRNA-derived RNAs are increased and more abundant than microRNAs in chronic hepatitis B and C.", "journal": "Scientific reports", "date": "2015", "authors": "Selitsky SR, Baran-Gale J, Honda M, Yamane D, Masaki T, Fannin EE, Guerra B, Shirasaki T, Shimakami T, Kaneko S, Lanford RE, Lemon SM, Sethupathy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "25567797", "url": "https://glygen.org/publication/PubMed/25567797" } ] }, { "title": "Sex hormone-dependent tRNA halves enhance cell proliferation in breast and prostate cancers.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Honda S, Loher P, Shigematsu M, Palazzo JP, Suzuki R, Imoto I, Rigoutsos I, Kirino Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "26124144", "url": "https://glygen.org/publication/PubMed/26124144" } ] }, { "title": "Characterization of ribonucleolytic activity of angiogenin towards tRNA.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Lee FS, Vallee BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "2730651", "url": "https://glygen.org/publication/PubMed/2730651" } ] }, { "title": "The Lupus Autoantigen La Prevents Mis-channeling of tRNA Fragments into the Human MicroRNA Pathway.", "journal": "Molecular cell", "date": "2016", "authors": "Hasler D, Lehmann G, Murakawa Y, Klironomos F, Jakob L, Grasser FA, Rajewsky N, Landthaler M, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "27345152", "url": "https://glygen.org/publication/PubMed/27345152" } ] }, { "title": "Molecular basis for the autonomous promotion of cell proliferation by angiogenin.", "journal": "Nucleic acids research", "date": "2017", "authors": "Hoang TT, Raines RT", "evidence": [ { "database": "iPTMnet", "id": "P03950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P03950" } ], "reference": [ { "type": "PubMed", "id": "27915233", "url": "https://glygen.org/publication/PubMed/27915233" } ] }, { "title": "Amino acid sequence of human tumor derived angiogenin.", "journal": "Biochemistry", "date": "1985", "authors": "Strydom DJ, Fett JW, Lobb RR, Alderman EM, Bethune JL, Riordan JF, Vallee BL", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "2866794", "url": "https://glygen.org/publication/PubMed/2866794" } ] }, { "title": "Sequence of the cDNA and gene for angiogenin, a human angiogenesis factor.", "journal": "Biochemistry", "date": "1985", "authors": "Kurachi K, Davie E W, Strydom D J, Riordan J F, Vallee B L", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "2866795", "url": "https://glygen.org/publication/PubMed/2866795" } ] }, { "title": "tRNA fragments (tRFs) guide Ago to regulate gene expression post-transcriptionally in a Dicer-independent manner.", "journal": "RNA (New York, N.Y.)", "date": "2018", "authors": "Kuscu C, Kumar P, Kiran M, Su Z, Malik A, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "29844106", "url": "https://glygen.org/publication/PubMed/29844106" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P03950", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P03950" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Angiogenin generates specific stress-induced tRNA halves and is not involved in tRF-3-mediated gene silencing.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Su Z, Kuscu C, Malik A, Shibata E, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "31582561", "url": "https://glygen.org/publication/PubMed/31582561" } ] }, { "title": "Production and purification of endogenously modified tRNA-derived small RNAs.", "journal": "RNA biology", "date": "2020", "authors": "Drino A, Oberbauer V, Troger C, Janisiw E, Anrather D, Hartl M, Kaiser S, Kellner S, Schaefer MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9708296", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296" } ], "reference": [ { "type": "PubMed", "id": "32138588", "url": "https://glygen.org/publication/PubMed/32138588" } ] }, { "title": "Angiogenin and MMP-2 as potential biomarkers in the differential diagnosis of gestational trophoblastic diseases.", "journal": "Medicine", "date": "2022", "authors": "Weng D, Han T, Dong J, Zhang M, Mi Y, He Y, Li X, Zhu X", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ], "reference": [ { "type": "PubMed", "id": "35119039", "url": "https://glygen.org/publication/PubMed/35119039" } ] }, { "title": "Angiogenin and plexin-B2 axis promotes glioblastoma progression by enhancing invasion, vascular association, proliferation and survival.", "journal": "British journal of cancer", "date": "2022", "authors": "Yang H, Yuan L, Ibaragi S, Li S, Shapiro R, Vanli N, Goncalves KA, Yu W, Kishikawa H, Jiang Y, Hu AJ, Jay D, Cochran B, Holland EC, Hu GF", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ], "reference": [ { "type": "PubMed", "id": "35418212", "url": "https://glygen.org/publication/PubMed/35418212" } ] }, { "title": "Non-enzymatic glycation of human angiogenin: Effects on enzymatic activity and binding to hRI and DNA.", "journal": "Biochimie", "date": "2022-12-30", "authors": "Panda Atashi, Sabnam Kabira, De Soumya, Dasgupta Swagata", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ], "reference": [ { "type": "PubMed", "id": "36592684", "url": "https://glygen.org/publication/PubMed/36592684" } ] }, { "title": "Angiogenin as a Possible Mediator of Macrophage-Mediated Regulation of Fibroblast Functions.", "journal": "Bulletin of experimental biology and medicine", "date": "2023-09", "authors": "Maksimova A A, Shevela E Ya, Tikhonova M A, Tyrinova T V, Bogachev S S, Ostanin A A, Chernykh E R", "evidence": [ { "database": "RefSeq", "id": "NP_001091046", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001091046" } ], "reference": [ { "type": "PubMed", "id": "37861896", "url": "https://glygen.org/publication/PubMed/37861896" } ] }, { "title": "E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Hulsken J, Birchmeier W, Behrens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "7806582", "url": "https://glygen.org/publication/PubMed/7806582" } ] }, { "title": "Identification of the nucleolar targeting signal of human angiogenin.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1994", "authors": "Moroianu J, Riordan J F", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "7945327", "url": "https://glygen.org/publication/PubMed/7945327" } ] }, { "title": "Nuclear translocation of angiogenin in proliferating endothelial cells is essential to its angiogenic activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-03-01", "authors": "Moroianu J, Riordan J F", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "8127865", "url": "https://glygen.org/publication/PubMed/8127865" } ] }, { "title": "Crystal structure of human angiogenin reveals the structural basis for its functional divergence from ribonuclease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Acharya K R, Shapiro R, Allen S C, Riordan J F, Vallee B L", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "8159679", "url": "https://glygen.org/publication/PubMed/8159679" } ] }, { "title": "Site-specific mutagenesis reveals differences in the structural bases for tight binding of RNase inhibitor to angiogenin and RNase A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Chen CZ, Shapiro R", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "9050852", "url": "https://glygen.org/publication/PubMed/9050852" } ] }, { "title": "Vascular endothelial cadherin (VE-cadherin): cloning and role in endothelial cell-cell adhesion.", "journal": "Microcirculation (New York, N.Y. : 1994)", "date": "1997", "authors": "Ali J, Liao F, Martens E, Muller WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "9219219", "url": "https://glygen.org/publication/PubMed/9219219" } ] }, { "title": "Molecular recognition of human angiogenin by placental ribonuclease inhibitor -- an X-ray crystallographic study at 2.0-A resolution.", "journal": "EMBO J.", "date": "1997", "authors": "Papageorgiou A C, Shapiro R, Acharya K R", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "9311977", "url": "https://glygen.org/publication/PubMed/9311977" } ] }, { "title": "Three-dimensional solution structure of human angiogenin determined by 1H,15N-NMR spectroscopy -- characterization of histidine protonation states and pKa values.", "journal": "Eur. J. Biochem.", "date": "1997", "authors": "Lequin O, Th\u00fcring H, Robin M, Lallemand J Y", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "9461294", "url": "https://glygen.org/publication/PubMed/9461294" } ] }, { "title": "The human poliovirus receptor related 2 protein is a new hematopoietic/endothelial homophilic adhesion molecule.", "journal": "Blood", "date": "1998", "authors": "Lopez M, Aoubala M, Jordier F, Isnardon D, Gomez S, Dubreuil P", "evidence": [ { "database": "Reactome", "id": "R-HSA-418990", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990" } ], "reference": [ { "type": "PubMed", "id": "9845526", "url": "https://glygen.org/publication/PubMed/9845526" } ] }, { "title": "Refined crystal structures of native human angiogenin and two active site variants: implications for the unique functional properties of an enzyme involved in neovascularisation during tumour growth.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Leonidas DD, Shapiro R, Allen SC, Subbarao GV, Veluraja K, Acharya KR", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "reference": [ { "type": "PubMed", "id": "9918722", "url": "https://glygen.org/publication/PubMed/9918722" } ] } ], "pathway": [ { "id": "hsa:283", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:283", "resource": "KEGG Pathway" }, { "id": "R-HSA-418990", "name": "Adherens junctions interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418990", "resource": "Reactome", "description": "Adherens junctions interactions" }, { "id": "R-HSA-9708296", "name": "tRNA-derived small RNA (tsRNA or tRNA-related fragment, tRF) biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708296", "resource": "Reactome", "description": "tRNA-derived small RNA (tsRNA or tRNA-related fragment, tRF) biogenesis" } ], "orthologs": [ { "uniprot_canonical_ac": "P21570-1", "protein_name": "Angiogenin", "gene_name": "Ang", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL", "length": 145 }, "evidence": [ { "id": "45921615", "url": "http://www.informatics.jax.org/homology/45921615", "database": "MGI" }, { "id": "P03950", "url": "https://omabrowser.org/oma/group/P03950/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P97802-1", "protein_name": "Angiogenin-3", "gene_name": "Ang3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVMSPGSLLLVFLLSLDVIPPTLAQDNYRYIKFLTQHYDAKPTGRDYRYCESMMKKRKLTSPCKEVNTFIHDTKNNIKAICGENGRPYGVNFRISNSRFQVTTCTHKGGSPRPPCQYNAFKDFRYIVIACEDGWPVHFDESFISP", "length": 145 }, "evidence": [ { "id": "45921614", "url": "http://www.informatics.jax.org/homology/45921614", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q3TMQ6-1", "protein_name": "Angiogenin-4", "gene_name": "Ang4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTMSPCPLLLVFVLGLVVIPPTLAQNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP", "length": 144 }, "evidence": [ { "id": "45921616", "url": "http://www.informatics.jax.org/homology/45921616", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5GAM5-1", "protein_name": "Angiogenin, ribonuclease A family, member 2", "gene_name": "Ang2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEMSLRPLLLVFVLSLVATPSTLAQDDPRYTKFLTQHYDAKPKGRDARYCESMMKRRGLTSPCKEVNTFIHGNKGSIKAVCGANGSPYGENLRISQSPFQITTCKHTGGSPRPPCRYRASAGFRHVVIACENGLPVHFDESFISLYSAGPRRRPSSVLFLSPLTPEH", "length": 167 }, "evidence": [ { "id": "45921616", "url": "http://www.informatics.jax.org/homology/45921616", "database": "MGI" }, { "id": "45921614", "url": "http://www.informatics.jax.org/homology/45921614", "database": "MGI" }, { "id": "45921615", "url": "http://www.informatics.jax.org/homology/45921615", "database": "MGI" }, { "id": "45921612", "url": "http://www.informatics.jax.org/homology/45921612", "database": "MGI" }, { "id": "45921613", "url": "http://www.informatics.jax.org/homology/45921613", "database": "MGI" }, { "id": "45921611", "url": "http://www.informatics.jax.org/homology/45921611", "database": "MGI" }, { "id": "P03950", "url": "https://omabrowser.org/oma/group/P03950/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5GAN0-1", "protein_name": "Angiogenin ribonuclease 6", "gene_name": "Ang6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVMSPGSLMLVFVLSLVVISPTLAKDNYRYIKFLTQHYDAKPTGWDHRYCYLCMMKKRIQETLKCKEANTFIHDTKKNIKAICGENGGPYGANFRISNSPFQITTCNHSGGSPKPPCQYRDFKDFRYIVIACEDAWPVHFDESFISL", "length": 147 }, "evidence": [ { "id": "45921612", "url": "http://www.informatics.jax.org/homology/45921612", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5GAN1-1", "protein_name": "Angiogenin, ribonuclease A family, member 5", "gene_name": "Ang5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVISPGSLLLVFLLSLDVIPPTLAQDNYRYKNFLNQHYDAKPTGRDYRYCESMMKKRKLTSPCKEVNTFIHDTKNNIKAICGENGRPYGVNLRISNSRFQITTCKHKGGSPKPPCQYKAFKDFRYIVIACEDGWPVHFDESFISM", "length": 145 }, "evidence": [ { "id": "45921611", "url": "http://www.informatics.jax.org/homology/45921611", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q64438-1", "protein_name": "Angiogenin-2", "gene_name": "Ang2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAMSPGPLFLVFLLGLVVIPPTLSQDDSRYTKFLTQHYDAKPKGRDDRYCESMMVKRKLTSFCKDVNTFIHDTKNNIKAICGKKGSPYGRNLRISKSHFQVTTCTHKGRSPRPPCRYRASKGFRYIIIGCENGWPVHFDESFISP", "length": 145 }, "evidence": [ { "id": "45921613", "url": "http://www.informatics.jax.org/homology/45921613", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 25, "go_terms": [ { "name": "tRNA catabolic process", "id": "GO:0016078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016078", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "positive regulation of protein secretion", "id": "GO:0050714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050714", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "placenta development", "id": "GO:0001890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001890", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "activation of protein kinase B activity", "id": "GO:0032148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032148", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell proliferation", "id": "GO:0001938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001938", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "activation of phospholipase C activity", "id": "GO:0007202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007202", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "ovarian follicle development", "id": "GO:0001541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001541", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "oocyte maturation", "id": "GO:0001556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001556", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "diacylglycerol biosynthetic process", "id": "GO:0006651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006651", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "cell communication", "id": "GO:0007154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007154", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "rRNA transcription", "id": "GO:0009303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009303", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "response to hormone", "id": "GO:0009725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009725", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "actin filament polymerization", "id": "GO:0030041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "activation of phospholipase A2 activity", "id": "GO:0032431", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032431", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "homeostatic process", "id": "GO:0042592", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042592", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "negative regulation of smooth muscle cell proliferation", "id": "GO:0048662", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048662", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "endonuclease activity", "id": "GO:0004519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004519", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "RNA nuclease activity", "id": "GO:0004540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004540", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "copper ion binding", "id": "GO:0005507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005507", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "rRNA binding", "id": "GO:0019843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019843", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "peptide binding", "id": "GO:0042277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042277", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "RNA endonuclease activity", "id": "GO:0004521", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004521", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "basement membrane", "id": "GO:0005604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005604", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "angiogenin-PRI complex", "id": "GO:0032311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032311", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "P03950", "url": "https://www.uniprot.org/uniprot/P03950" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-HSA-5692437", "name": "ANG binds F-actin", "equation": "", "summary": "Angiogenin (ANG) binds to F-actin on the surface of endothelial cells. Once bound, ANG is endocytosed and translocated to the nucleus where it stimulates ribosomal RNA syntheses which induce vascularisation of normal and malignant tissues (Dickson et al. 2009). Defects in ANG can cause amyotrophic lateral sclerosis 9 (ALS9; MIM:611895), a fatal progressive neurodegenerative disorder characterised by the preferential loss of motor neurons in the brain stem, motor cortex and spinal cord, resulting in paralysis and respiratory failure between 3 to 5 years of onset of symptoms (Padhi et al. 2014).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60709-1", "P63261-1", "P03950-1" ], "evidence": [ { "id": "R-HSA-5692437", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5692437" } ] }, { "id": "R-HSA-9708327", "name": "ANG cleaves tRNA to yield tRNA halves", "equation": "", "summary": "Angiogenin (ANG) cleaves within or near the anticodon of specific tRNAs including but not limited to: tRNA Arg ACG (Fu et al. 2009), tRNA Arg CCG (Fu et al. 2009), tRNA Glu CTC (Fu et al. 2009), tRNA Gly CCC (Fu et al. 2009), tRNA Gly GCC (Fu et al. 2009), tRNA Met CAT (Fu et al. 2009, Su et al. 2019), tRNA Pro AGG (Yamasaki et al. 2009), tRNA Pro TGG (Yamasaki et al. 2009), tRNA Val AAC (Fu et al. 2009), tRNA Ala AGC (Su et al. 2019), tRNA Ala CGC (Su et al. 2019), tRNA Ala TGC (Su et al. 2019), tRNA Asp GTC (Su et al. 2019), tRNA Glu TTC (Su et al. 2019), tRNA His GTG (Su et al. 2019), tRNA Leu CAG (Su et al. 2019), tRNA Leu TAG (Su et al. 2019), tRNA Lys TTT (Su et al. 2019), tRNA Ser GCT (Su et al. 2019), tRNA Ser CGA (Su et al. 2019), tRNA Val CAC (Su et al. 2019), tRNA Val TAC (Su et al. 2019) (also Lee and Vallee 1989, Saxena et al. 1992, Emara et al. 2010, Ivanov et al. 2011). The products are a 5' fragment of about 30-35 nt and a 3' fragment of about 40 nt known as tRNA halves or stress-induced tRNA fragments (tiRNAs) (Emara et al. 2010). As a result of ANG cleavage, the 5\u2019 tRNA halves contain 5' monophosphates (Emara et al. 2010) and 3' cyclic monophosphates (Shigematsu et al. 2018), while the 3\u2019 tRNA halves contain 5' hydroxyl groups (Shigematsu et al., 2018). ANG cleaves tRNA in response to biological conditions such as exposure to sex hormones and stresses such as starvation, oxidative stress, and virus infection (Fu et al. 2009, Emara et al. 2010, Ivanov et al. 2011, Wang et al. 2013, Honda et al. 2015, Selitsky et al. 2015), but several tRNA halves are still produced after stress in ANG knockout cells (Su et al. 2020). The 5' tiRNAs inhibit translation by displacing eIF4F from the m(7)G caps of mRNAs (Emara et al. 2010, Ivanov et al. 2011). The 3\u2019 tiRNAs protect cells against stress-induced apoptosis by interacting with cytochrome C (inferred from mouse homologs in Saikia et al, 2014). The products of ANG have modifications present on mature tRNAs (Drino et al. 2020); therefore, the cleavage is believed to occur in the cytosol (Yamasaki et al. 2009, reviewed in Lyons et al. 2018) perhaps as ANG is translocated from receptors on the plasma membrane through the cytosol to the nucleus.", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P03950-1" ], "evidence": [ { "id": "R-HSA-9708327", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9708327" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P03950", "gene_name": "ANG", "activity": [ { "ec_number": "3.1.27.-", "activity": "", "evidence": [ { "id": "P03950", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03950" } ] } ] }, { "uniprot_ac": "P60709", "gene_name": "ACTB", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P60709", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60709" } ] } ] }, { "uniprot_ac": "P63261", "gene_name": "ACTG1", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P63261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63261" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 28 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 59 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }