{ "uniprot_canonical_ac": "P02887-1", "uniprot_ac": "P02887", "uniprot_id": "DIS1B_DICDI", "mass": { "chemical_mass": 28392.0, "monoisotopic_mass": 28392.0 }, "refseq": { "ac": "XP_644559", "name": "discoidin I, C chain and B chain", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644559" }, "gene_names": [ { "name": "dscC-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "dscC-2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "DDB_G0273065", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "DDB_G0273885", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "dscB-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "dscB-2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02887", "id": "P02887" }, { "name": "dscC-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644559", "id": "XP_644559" } ], "protein_names": [ { "name": "Discoidin-1 subunit B/C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02887" }, { "name": "Discoidin I chain C/D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02887" }, { "name": "Discoidin-1 subunit beta/gamma", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02887" }, { "name": "discoidin I, C chain and B chain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644559", "id": "XP_644559" }, { "name": "discoidin I, beta chain; discoidin I, gamma chain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644559", "id": "XP_644559" } ], "function": [ { "annotation": "Galactose- and N-acetylgalactosamine-binding lectin. May play a role in cell-substratum adhesion rather than in cell-cell adhesion. May be necessary for the maintenance of normal elongate morphology during aggregation.", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "dscC-2", "url": "https://www.uniprot.org/uniprot/P02887", "locus": {} } ], "crossref": [ { "id": "cd00057", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00057", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0273065", "url": "http://dictybase.org/gene/DDB_G0273065", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "DDB_G0273885", "url": "http://dictybase.org/gene/DDB_G0273885", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8618789", "url": "https://www.ncbi.nlm.nih.gov/gene/8618789", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8619187", "url": "https://www.ncbi.nlm.nih.gov/gene/8619187", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000421", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000421", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019019", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019019", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037221", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037221", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0273065", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273065", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ddi:DDB_G0273885", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273885", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IDCANDK", "url": "https://omabrowser.org/oma/group/IDCANDK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR46938", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46938", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46938:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46938:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00754", "url": "http://pfam.xfam.org/family/PF00754", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09458", "url": "http://pfam.xfam.org/family/PF09458", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P02887", "url": "http://purl.obolibrary.org/obo/PR_P02887", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_644559", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644559", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02887-1", "url": "https://www.uniprot.org/uniprot/P02887-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTQGLVQLISNAQCHLRTSTNYNDVHTQFNAVLNYKNKGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDHDQWVTSYKIRYSLDNVTWSEYRNGAAITGVTDRNTVVNHFFDTPIRARSIAIHPLTWNNHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNANKVYSLRADYIATALE", "length": 253, "header": "sp|P02887-1|DIS1B_DICDI Isoform 1 of Discoidin-1 subunit B/C OS=Dictyostelium discoideum OX=44689 GN=dscC-2 PE=1 SV=1 CANONICAL=P02887-1" }, "isoforms": [ { "isoform_ac": "P02887-1", "url": "", "sequence": { "sequence": "MSTQGLVQLISNAQCHLRTSTNYNDVHTQFNAVLNYKNKGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDHDQWVTSYKIRYSLDNVTWSEYRNGAAITGVTDRNTVVNHFFDTPIRARSIAIHPLTWNNHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNANKVYSLRADYIATALE", "length": 253, "header": "sp|P02887-1|DIS1B_DICDI Isoform 1 of Discoidin-1 subunit B/C OS=Dictyostelium discoideum OX=44689 GN=dscC-2 PE=1 SV=1 CANONICAL=P02887-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake.", "journal": "Mol. Cell. Proteomics", "date": "2006", "authors": "Gotthardt Daniel, Blancheteau Vincent, Bosserhoff Armin, Ruppert Thomas, Delorenzi Mauro, Soldati Thierry", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "reference": [ { "type": "PubMed", "id": "16926386", "url": "https://glygen.org/publication/PubMed/16926386" } ] }, { "title": "Sequence and expression of the discoidin I gene family in Dictyostelium discoideum.", "journal": "J. Mol. Biol.", "date": "1981", "authors": "Poole S, Firtel R A, Lamar E, Rowekamp W", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "reference": [ { "type": "PubMed", "id": "6279874", "url": "https://glygen.org/publication/PubMed/6279874" } ] }, { "title": "Discoidin I is implicated in cell-substratum attachment and ordered cell migration of Dictyostelium discoideum and resembles fibronectin.", "journal": "Cell", "date": "1984", "authors": "Springer W R, Cooper D N, Barondes S H", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "reference": [ { "type": "PubMed", "id": "6509552", "url": "https://glygen.org/publication/PubMed/6509552" } ] } ], "pathway": [ { "id": "ddi:DDB_G0273065", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273065", "resource": "KEGG Pathway" }, { "id": "ddi:DDB_G0273885", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273885", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "polysaccharide binding", "id": "GO:0030247", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030247", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "oligosaccharide binding", "id": "GO:0070492", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070492", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "N-acetylgalactosamine binding", "id": "GO:0046871", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046871", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "protein complex involved in cell adhesion", "id": "GO:0098636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098636", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "cell-cell adhesion", "id": "GO:0098609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "cytoskeleton organization", "id": "GO:0007010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007010", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "response to cAMP", "id": "GO:0051591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051591", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" }, { "name": "response to folic acid", "id": "GO:0051593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051593", "evidence": [ { "database": "UniProtKB", "id": "P02887", "url": "https://www.uniprot.org/uniprot/P02887" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" }, { "start_pos": 222, "end_pos": 224, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 212, "end_pos": 214 }, { "start_pos": 222, "end_pos": 224 }, { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }