{ "uniprot_canonical_ac": "P02790-1", "uniprot_ac": "P02790", "uniprot_id": "HEMO_HUMAN", "mass": { "chemical_mass": 51676.0, "monoisotopic_mass": 51676.0 }, "refseq": { "ac": "NP_000604", "name": "hemopexin precursor", "summary": "This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" }, "gene_names": [ { "name": "HPX", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02790", "id": "P02790" }, { "name": "HPX", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604", "id": "NP_000604" }, { "name": "HX", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604", "id": "NP_000604" } ], "protein_names": [ { "name": "Hemopexin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02790" }, { "name": "Beta-1B-glycoprotein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02790" }, { "name": "beta-1B-glycoprotein; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604", "id": "NP_000604" }, { "name": "hemopexin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604", "id": "NP_000604" } ], "function": [ { "annotation": "Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#function" } ] }, { "annotation": "Evaluation of the relationship between intravascular hemolysis and clinical manifestations in sickle cell disease: decreased hemopexin during vaso-occlusive crises and increased inflammation in acute chest syndrome.", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" }, { "database": "PubMed", "id": "34564750", "url": "https://glygen.org/publication/PubMed/34564750" } ] }, { "annotation": "Free heme and hemopexin in acute kidney injury after cardiopulmonary bypass and transient renal ischemia.", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" }, { "database": "PubMed", "id": "37899696", "url": "https://glygen.org/publication/PubMed/37899696" } ] }, { "annotation": "Heme oxygenase-1 and hemopexin gene polymorphisms and the risk of anti-tuberculosis drug-induced hepatotoxicity in China.", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" }, { "database": "PubMed", "id": "35470713", "url": "https://glygen.org/publication/PubMed/35470713" } ] }, { "annotation": "This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P02790", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02790" } ], "glycoeffect": [], "start_pos": 102, "end_pos": 102, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "11", "chr_pos": "6440197", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R102", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1590805267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1590805267" }, { "id": "rs1590805267", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1590805267" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 187, "end_pos": 187, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->KCS).", "chr_id": "11", "chr_pos": "6437582", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N187", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778379765", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778379765" }, { "id": "rs778379765", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778379765" }, { "id": "rs778379765", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778379765#frequency_tab" }, { "id": "rs778379765", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778379765" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 189, "end_pos": 189, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCF).", "chr_id": "11", "chr_pos": "6437577", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S189", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765865106", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765865106" }, { "id": "rs765865106", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765865106" }, { "id": "rs765865106", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765865106#frequency_tab" }, { "id": "rs765865106", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765865106" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 246, "end_pos": 246, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->SST).", "chr_id": "11", "chr_pos": "6437144", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N246", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780840467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780840467" }, { "id": "rs780840467", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780840467" }, { "id": "rs780840467", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780840467" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 24, "end_pos": 24, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "11", "chr_pos": "6440893", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T24", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780840467", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780840467" }, { "id": "rs780840467", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780840467" }, { "id": "rs780840467", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780840467" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 24, "end_pos": 24, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "11", "chr_pos": "6440893", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T24", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778281654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778281654" }, { "id": "rs778281654", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778281654" }, { "id": "rs778281654", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778281654#frequency_tab" }, { "id": "rs778281654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778281654" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 30, "end_pos": 30, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "11", "chr_pos": "6440726", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S30", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778281654", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778281654" }, { "id": "rs778281654", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778281654" }, { "id": "rs778281654", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778281654#frequency_tab" }, { "id": "rs778281654", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778281654" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 30, "end_pos": 30, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "11", "chr_pos": "6440726", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S30", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P02790", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02790" } ], "glycoeffect": [], "start_pos": 404, "end_pos": 404, "subjects_tested": "57", "subjects_positive": "1", "frequency": "1.8", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.8%).", "chr_id": "11", "chr_pos": "6431390", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D404", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs75099526", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75099526" }, { "id": "rs75099526", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs75099526" }, { "id": "rs75099526", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs75099526" }, { "id": "rs75099526", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs75099526#frequency_tab" }, { "id": "rs75099526", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs75099526" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "11", "chr_pos": "6440696", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.01957", "site_lbl": "T40", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1360115615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1360115615" }, { "id": "rs1360115615", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1360115615#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 423, "end_pos": 423, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGP->NGT).", "chr_id": "11", "chr_pos": "6431333", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P423", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1401721886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401721886" }, { "id": "rs1401721886", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1401721886#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 445, "end_pos": 445, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAS).", "chr_id": "11", "chr_pos": "6431267", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A445", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768990038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768990038" }, { "id": "rs768990038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768990038#frequency_tab" }, { "id": "rs768990038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768990038" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 453, "end_pos": 453, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->IVT).", "chr_id": "11", "chr_pos": "6431242", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N453", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138351745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138351745" }, { "id": "rs138351745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138351745#frequency_tab" }, { "id": "rs138351745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138351745" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 64, "end_pos": 64, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "11", "chr_pos": "6440490", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N64", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs142974976", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142974976" }, { "id": "rs142974976", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs142974976" }, { "id": "rs142974976", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs142974976" }, { "id": "rs142974976", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs142974976" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 66, "end_pos": 66, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGA).", "chr_id": "11", "chr_pos": "6440485", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T66", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "58.8", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "62.04", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "79.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "75.77", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "75.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "72.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "65.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "71.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "70.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "82.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "78.55", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02790" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "common_name": "Human" } ], "gene": [ { "name": "HPX", "url": "https://www.uniprot.org/uniprot/P02790", "locus": { "chromosome": "11", "start_pos": 6431049, "end_pos": 6442617, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000110169", "url": "https://www.ensembl.org/id/ENSG00000110169" } ] } } ], "crossref": [ { "id": "ENSG00000110169", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000110169", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P02790", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02790", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00094", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00094", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "HPX", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HPX", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3263", "url": "https://www.ncbi.nlm.nih.gov/gene/3263", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "5171", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5171", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02790", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02790*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000585", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000585", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018486", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018486", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018487", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018487", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036375", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036375", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3263", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3263", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "142290", "url": "http://www.omim.org/entry/142290", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02790", "url": "https://www.nextprot.org/entry/NX_P02790", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CSSAMRW", "url": "https://omabrowser.org/oma/group/CSSAMRW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5312290at2759", "url": "http://www.orthodb.org/?query=5312290at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22917", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22917", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22917:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22917:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00045", "url": "http://pfam.xfam.org/family/PF00045", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02790", "url": "https://pharos.nih.gov/targets/P02790", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000053073", "url": "https://proconsortium.org/app/entry/PR:000053073", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053074", "url": "https://proconsortium.org/app/entry/PR:000053074", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053075", "url": "https://proconsortium.org/app/entry/PR:000053075", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053076", "url": "https://proconsortium.org/app/entry/PR:000053076", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053077", "url": "https://proconsortium.org/app/entry/PR:000053077", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053078", "url": "https://proconsortium.org/app/entry/PR:000053078", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053079", "url": "https://proconsortium.org/app/entry/PR:000053079", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053080", "url": "https://proconsortium.org/app/entry/PR:000053080", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053081", "url": "https://proconsortium.org/app/entry/PR:000053081", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053082", "url": "https://proconsortium.org/app/entry/PR:000053082", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053083", "url": "https://proconsortium.org/app/entry/PR:000053083", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053084", "url": "https://proconsortium.org/app/entry/PR:000053084", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053085", "url": "https://proconsortium.org/app/entry/PR:000053085", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053086", "url": "https://proconsortium.org/app/entry/PR:000053086", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053087", "url": "https://proconsortium.org/app/entry/PR:000053087", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053088", "url": "https://proconsortium.org/app/entry/PR:000053088", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053089", "url": "https://proconsortium.org/app/entry/PR:000053089", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053090", "url": "https://proconsortium.org/app/entry/PR:000053090", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053091", "url": "https://proconsortium.org/app/entry/PR:000053091", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053092", "url": "https://proconsortium.org/app/entry/PR:000053092", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053093", "url": "https://proconsortium.org/app/entry/PR:000053093", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053094", "url": "https://proconsortium.org/app/entry/PR:000053094", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053095", "url": "https://proconsortium.org/app/entry/PR:000053095", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053096", "url": "https://proconsortium.org/app/entry/PR:000053096", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053097", "url": "https://proconsortium.org/app/entry/PR:000053097", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053098", "url": "https://proconsortium.org/app/entry/PR:000053098", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053099", "url": "https://proconsortium.org/app/entry/PR:000053099", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053100", "url": "https://proconsortium.org/app/entry/PR:000053100", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053101", "url": "https://proconsortium.org/app/entry/PR:000053101", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053102", "url": "https://proconsortium.org/app/entry/PR:000053102", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053103", "url": "https://proconsortium.org/app/entry/PR:000053103", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053104", "url": "https://proconsortium.org/app/entry/PR:000053104", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053105", "url": "https://proconsortium.org/app/entry/PR:000053105", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053106", "url": "https://proconsortium.org/app/entry/PR:000053106", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053107", "url": "https://proconsortium.org/app/entry/PR:000053107", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053108", "url": "https://proconsortium.org/app/entry/PR:000053108", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053109", "url": "https://proconsortium.org/app/entry/PR:000053109", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053110", "url": "https://proconsortium.org/app/entry/PR:000053110", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053111", "url": "https://proconsortium.org/app/entry/PR:000053111", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053112", "url": "https://proconsortium.org/app/entry/PR:000053112", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053113", "url": "https://proconsortium.org/app/entry/PR:000053113", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053114", "url": "https://proconsortium.org/app/entry/PR:000053114", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053115", "url": "https://proconsortium.org/app/entry/PR:000053115", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053116", "url": "https://proconsortium.org/app/entry/PR:000053116", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053117", "url": "https://proconsortium.org/app/entry/PR:000053117", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053118", "url": "https://proconsortium.org/app/entry/PR:000053118", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053119", "url": "https://proconsortium.org/app/entry/PR:000053119", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053120", "url": "https://proconsortium.org/app/entry/PR:000053120", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053121", "url": "https://proconsortium.org/app/entry/PR:000053121", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053122", "url": "https://proconsortium.org/app/entry/PR:000053122", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02790", "url": "http://purl.obolibrary.org/obo/PR_P02790", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02790", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02790-1", "url": "https://www.uniprot.org/uniprot/P02790-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH", "length": 462, "header": "sp|P02790-1|HEMO_HUMAN Isoform 1 of Hemopexin OS=Homo sapiens OX=9606 GN=HPX PE=1 SV=2 CANONICAL=P02790-1" }, "isoforms": [ { "isoform_ac": "P02790-1", "url": "", "sequence": { "sequence": "MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH", "length": 462, "header": "sp|P02790-1|HEMO_HUMAN Isoform 1 of Hemopexin OS=Homo sapiens OX=9606 GN=HPX PE=1 SV=2 CANONICAL=P02790-1" }, "locus": { "chromosome": "11", "start_pos": 6440963, "end_pos": 6431214, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000265983.8", "url": "https://www.ensembl.org/id/ENST00000265983.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000265983.3", "url": "https://www.ensembl.org/id/ENSP00000265983.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G06853GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G14572XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22276PO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G26267FS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44576HQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G62165AG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G74772YG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86056PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G89205CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "29427759", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" }, { "id": "29427759", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 240, "start_aa": "Asn", "end_pos": 240, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn240", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 240, "start_aa": "Asn", "end_pos": 240, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn240", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 240, "start_aa": "Asn", "end_pos": 240, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn240", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 240, "start_aa": "Asn", "end_pos": 240, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn240", "evidence": [ { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "6510521", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6510521" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "NGTGHGNSTHHGPEYMR", "relation": "attached", "comment": "", "start_pos": 240, "start_aa": "Asn", "end_pos": 256, "end_aa": "Arg", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P02790@N246", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N246" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P02790@N246", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N246" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P02790@N246", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N246" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P02790@N246", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N246" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "6510521", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6510521" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "23234360", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23234360" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "23234360", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23234360" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "6510521", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6510521" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 29, "start_aa": "Thr", "end_pos": 29, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr29", "evidence": [ { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "23234360", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23234360" } ] }, { "glytoucan_ac": "G17015OC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 30, "start_aa": "Ser", "end_pos": 30, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser30", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "26598643", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26598643" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 351, "start_aa": "Thr", "end_pos": 351, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr351", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G56284ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G76329HL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G78502KD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12579WK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790@N64", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N64" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G64275UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "25265424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "P02790", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "6371807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6371807" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] } ], "phosphorylation": [ { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02790", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02790" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "The binding and transport of heme by hemopexin.", "journal": "Annals of clinical research", "date": "1976", "authors": "Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1008494", "url": "https://glygen.org/publication/PubMed/1008494" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "Identification of the haemoglobin scavenger receptor.", "journal": "Nature", "date": "2001", "authors": "Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11196644", "url": "https://glygen.org/publication/PubMed/11196644" } ] }, { "title": "Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties.", "journal": "Blood", "date": "2002", "authors": "Allhorn M, Berggard T, Nordberg J, Olsson ML, Akerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11877257", "url": "https://glygen.org/publication/PubMed/11877257" } ] }, { "title": "Kinetics of deoxyhemoglobin subunit dissociation determined by haptoglobin binding: estimation of the equilibrium constant from forward and reverse rates.", "journal": "Biochemistry", "date": "1976", "authors": "Ip SH, Johnson ML, Ackers GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1252417", "url": "https://glygen.org/publication/PubMed/1252417" } ] }, { "title": "[Isolation of the haptoglobin-hemoglobin complex in human blood in homogenous state. II].", "journal": "Bulletin de la Societe de chimie biologique", "date": "1956", "authors": "JAYLE MF, BOUSSIER G, TONNELAT J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13342742", "url": "https://glygen.org/publication/PubMed/13342742" } ] }, { "title": "The binding of haemoglobin by plasma proteins (haptoglobins); its bearing on the renal threshold for haemoglobin and the aetiology of haemoglobinuria.", "journal": "British medical journal", "date": "1957", "authors": "ALLISON AC, REES WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13472068", "url": "https://glygen.org/publication/PubMed/13472068" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "A proteomic analysis of human bile.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" } ] }, { "title": "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Madsen M, Moller HJ, Nielsen MJ, Jacobsen C, Graversen JH, van den Berg T, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15448162", "url": "https://glygen.org/publication/PubMed/15448162" } ] }, { "title": "The lipocalin alpha(1)-microglobulin binds heme in different species.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "Larsson J, Allhorn M, Kerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15542058", "url": "https://glygen.org/publication/PubMed/15542058" } ] }, { "title": "pH- and metal ion-linked stability of the hemopexin-heme complex.", "journal": "Biochemistry", "date": "2005", "authors": "Rosell FI, Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15697213", "url": "https://glygen.org/publication/PubMed/15697213" } ] }, { "title": "Identification of the receptor scavenging hemopexin-heme complexes.", "journal": "Blood", "date": "2005", "authors": "Hvidberg V, Maniecki MB, Jacobsen C, Hojrup P, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15947085", "url": "https://glygen.org/publication/PubMed/15947085" } ] }, { "title": "Human high density lipoproteins are platforms for the assembly of multi-component innate immune complexes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shiflett AM, Bishop JR, Pahwa A, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16046400", "url": "https://glygen.org/publication/PubMed/16046400" } ] }, { "title": "CD163 is the macrophage scavenger receptor for native and chemically modified hemoglobins in the absence of haptoglobin.", "journal": "Blood", "date": "2006", "authors": "Schaer DJ, Schaer CA, Buehler PW, Boykins RA, Schoedon G, Alayash AI, Schaffner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16189277", "url": "https://glygen.org/publication/PubMed/16189277" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "The murine haemopexin receptor. Evidence that the haemopexin-binding site resides on a 20 kDa subunit and that receptor recycling is regulated by protein kinase C.", "journal": "The Biochemical journal", "date": "1991", "authors": "Smith A, Farooqui SM, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1646599", "url": "https://glygen.org/publication/PubMed/1646599" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein.", "journal": "Blood", "date": "2006", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Oxvig C, Rees D, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16778136", "url": "https://glygen.org/publication/PubMed/16778136" } ] }, { "title": "Constitutive endocytosis of CD163 mediates hemoglobin-heme uptake and determines the noninflammatory and protective transcriptional response of macrophages to hemoglobin.", "journal": "Circulation research", "date": "2006", "authors": "Schaer CA, Schoedon G, Imhof A, Kurrer MO, Schaer DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17008602", "url": "https://glygen.org/publication/PubMed/17008602" } ] }, { "title": "A unique loop extension in the serine protease domain of haptoglobin is essential for CD163 recognition of the haptoglobin-hemoglobin complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Thirup S, Enghild JJ, Graversen JH, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17102136", "url": "https://glygen.org/publication/PubMed/17102136" } ] }, { "title": "Hemoglobin is a co-factor of human trypanosome lytic factor.", "journal": "PLoS pathogens", "date": "2007", "authors": "Widener J, Nielsen MJ, Shiflett A, Moestrup SK, Hajduk S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17845074", "url": "https://glygen.org/publication/PubMed/17845074" } ] }, { "title": "The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.", "journal": "Biochemistry", "date": "2008", "authors": "Ratra Ruchi, Kar-Roy Anindita, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "18211098", "url": "https://glygen.org/publication/PubMed/18211098" } ] }, { "title": "Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry.", "journal": "Journal of chromatography. B, Analytical technologies in the biomedical and life sciences", "date": "2008", "authors": "Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "title": "Hemopexin prevents endothelial damage and liver congestion in a mouse model of heme overload.", "journal": "The American journal of pathology", "date": "2008", "authors": "Vinchi F, Gastaldi S, Silengo L, Altruda F, Tolosano E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "18556779", "url": "https://glygen.org/publication/PubMed/18556779" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Harrington JM, Howell S, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19324878", "url": "https://glygen.org/publication/PubMed/19324878" } ] }, { "title": "Heme scavenging and the other facets of hemopexin.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Tolosano E, Fagoonee S, Morello N, Vinchi F, Fiorito V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19650691", "url": "https://glygen.org/publication/PubMed/19650691" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" }, { "database": "UniCarbKB", "id": "P02790", "url": "" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Metal ions and electrolytes regulate the dissociation of heme from human hemopexin at physiological pH.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20430887", "url": "https://glygen.org/publication/PubMed/20430887" } ] }, { "title": "Kinetics and specificity of feline leukemia virus subgroup C receptor (FLVCR) export function and its dependence on hemopexin.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Yang Zhantao, Philips John D, Doty Raymond T, Giraudi Pablo, Ostrow J Donald, Tiribelli Claudio, Smith Ann, Abkowitz Janis L", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "20610401", "url": "https://glygen.org/publication/PubMed/20610401" } ] }, { "title": "Signaling through LRP1: Protection from atherosclerosis and beyond.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Boucher P, Herz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20920479", "url": "https://glygen.org/publication/PubMed/20920479" } ] }, { "title": "Insertion of heme b into the structure of the Cys34-carbamidomethylated human lipocalin alpha(1)-microglobulin: formation of a [(heme)(2) (alpha(1)-Microglobulin)](3) complex.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2012", "authors": "Siebel JF, Kosinsky RL, Akerstrom B, Knipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22492620", "url": "https://glygen.org/publication/PubMed/22492620" } ] }, { "title": "Structure of the haptoglobin-haemoglobin complex.", "journal": "Nature", "date": "2012", "authors": "Andersen CB, Torvund-Jensen M, Nielsen MJ, de Oliveira CL, Hersleth HP, Andersen NH, Pedersen JS, Andersen GR, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22922649", "url": "https://glygen.org/publication/PubMed/22922649" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.", "journal": "Journal of proteome research", "date": "2013", "authors": "Halim A, Ruetschi U, Larson G, Nilsson J", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" }, { "database": "UniCarbKB", "id": "P02790", "url": "" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "23234360", "url": "https://glygen.org/publication/PubMed/23234360" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Glycomic analysis of high density lipoprotein shows a highly sialylated particle.", "journal": "Journal of proteome research", "date": "2014", "authors": "Huang J, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "24417605", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "title": "Protein and site specificity of fucosylation in liver-secreted glycoproteins.", "journal": "Journal of proteome research", "date": "2014", "authors": "Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "25265424", "url": "https://glygen.org/publication/PubMed/25265424" } ] }, { "title": "Site-specific O-Glycosylation Analysis of Human Blood Plasma Proteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016", "authors": "Hoffmann M, Marx K, Reichl U, Wuhrer M, Rapp E", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26598643", "url": "https://glygen.org/publication/PubMed/26598643" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Increased sialylation of site specific O-glycoforms of hemopexin in liver disease.", "journal": "Clinical proteomics", "date": "2016", "authors": "Sanda Miloslav, Benicky Julius, Wu Jing, Wang Yiwen, Makambi Kepher, Ahn Jaeil, Smith Coleman I, Zhao Peng, Zhang Lihua, Goldman Radoslav", "evidence": [ { "database": "GlyGen", "id": "A0435", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "27688741", "url": "https://glygen.org/publication/PubMed/27688741" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Serum proteins as mediators of hemin efflux from red cell membranes: specificity of hemopexin.", "journal": "FEBS letters", "date": "1989", "authors": "Solar I, Muller-Eberhard U, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2806549", "url": "https://glygen.org/publication/PubMed/2806549" } ] }, { "title": "Importance of ligand-induced conformational changes in hemopexin for receptor-mediated heme transport.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Smith A, Tatum FM, Muster P, Burch MK, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2833500", "url": "https://glygen.org/publication/PubMed/2833500" } ] }, { "title": "Structure of the human hemopexin gene and evidence for intron-mediated evolution.", "journal": "J. Mol. Evol.", "date": "1988", "authors": "Altruda F, Poli V, Restagno G, Silengo L", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "2842511", "url": "https://glygen.org/publication/PubMed/2842511" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Quantitative analysis of core fucosylation of serum proteins in liver diseases by LC-MS-MRM.", "journal": "Journal of proteomics", "date": "2018", "authors": "Ma J, Sanda M, Wei R, Zhang L, Goldman R", "evidence": [ { "database": "Automatic Literature Mining", "id": "29427759", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" } ], "reference": [ { "type": "PubMed", "id": "29427759", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" }, { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "The primary structure of human hemopexin deduced from cDNA sequence: evidence for internal, repeating homology.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Altruda F, Poli V, Restagno G, Argos P, Cortese R, Silengo L", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "2989777", "url": "https://glygen.org/publication/PubMed/2989777" } ] }, { "title": "Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum.", "journal": "Proteomics. Clinical applications", "date": "2018", "authors": "Saraswat M, Makitie A, Tohmola T, Dickinson A, Saraswat S, Joenvaara S, Renkonen S", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "29992770", "url": "https://glygen.org/publication/PubMed/29992770" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02790", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "A Novel Mass Spectrometry Platform for Multiplexed N-Glycoprotein Biomarker Discovery from Patient Biofluids by Antibody Panel Based N-Glycan Imaging.", "journal": "Analytical chemistry", "date": "2019-07-02", "authors": "Black Alyson P, Liang Hongyan, West Connor A, Wang Mengjun, Herrera Harmin P, Haab Brian B, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31177770", "url": "https://glygen.org/publication/PubMed/31177770" } ] }, { "title": "Antibody Panel Based N-Glycan Imaging for N-Glycoprotein Biomarker Discovery.", "journal": "Current protocols in protein science", "date": "2019-12", "authors": "Black Alyson P, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31721442", "url": "https://glygen.org/publication/PubMed/31721442" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "The hemopexin gene maps to the same location as the beta-globin gene cluster on human chromosome 11.", "journal": "Genomics", "date": "1988", "authors": "Law ML, Cai GY, Hartz JA, Jones C, Kao FT", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "3220477", "url": "https://glygen.org/publication/PubMed/3220477" } ] }, { "title": "Evaluation of the relationship between intravascular hemolysis and clinical manifestations in sickle cell disease: decreased hemopexin during vaso-occlusive crises and increased inflammation in acute chest syndrome.", "journal": "Annals of hematology", "date": "2022", "authors": "Yildirim N, Unal S, Yalcinkaya A, Karahan F, Oztas Y", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" } ], "reference": [ { "type": "PubMed", "id": "34564750", "url": "https://glygen.org/publication/PubMed/34564750" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "757", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Heme oxygenase-1 and hemopexin gene polymorphisms and the risk of anti-tuberculosis drug-induced hepatotoxicity in China.", "journal": "Pharmacogenomics", "date": "2022", "authors": "Liu W, Lu L, Pan H, He X, Zhang M, Wang N, Zhu J, Yi H, Tang S", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" } ], "reference": [ { "type": "PubMed", "id": "35470713", "url": "https://glygen.org/publication/PubMed/35470713" } ] }, { "title": "Free heme and hemopexin in acute kidney injury after cardiopulmonary bypass and transient renal ischemia.", "journal": "Clinical and translational science", "date": "2023-12", "authors": "Greite Robert, Schott Sebastian, Wang Li, Gohlke Lukas, Kreimann Kirill, Derlin Katja, Gutberlet Marcel, Schmidbauer Martina, Leffler Andreas, Tudorache Igor, Salman Jawad, Ius Fabio, Natanov Ruslan, Fegbeutel Christine, Haverich Axel, Lichtinghagen Ralf, H\u00fcsing Anne M, von Vietinghoff Sibylle, Schmitt Roland, Shushakova Nelli, Rong Song, Haller Hermann, Schmidt-Ott Kai M, Gram Magnus, Vijayan Vijith, Scheffner Irina, Gwinner Wilfried, Immenschuh Stephan", "evidence": [ { "database": "RefSeq", "id": "NP_000604", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000604" } ], "reference": [ { "type": "PubMed", "id": "37899696", "url": "https://glygen.org/publication/PubMed/37899696" } ] }, { "title": "Complete amino acid sequence of human hemopexin, the heme-binding protein of serum.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Takahashi N, Takahashi Y, Putnam F W", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "3855550", "url": "https://glygen.org/publication/PubMed/3855550" } ] }, { "title": "Hemopexin-mediated heme transport to the liver. Evidence for a heme-binding protein in liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "3891754", "url": "https://glygen.org/publication/PubMed/3891754" } ] }, { "title": "Kinetics of hemoprotein reduction and interprotein heme transfer.", "journal": "Biochemistry", "date": "1985", "authors": "Pasternack RF, Gibbs EJ, Mauk AG, Reid LS, Wong NM, Kurokawa K, Hashim M, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4074707", "url": "https://glygen.org/publication/PubMed/4074707" } ] }, { "title": "Some spectral properties of the human hemoglobin-haptoglobin complex.", "journal": "Biochemistry", "date": "1971", "authors": "Hamaguchi H, Isomoto A, Miyake Y, Nakajima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4327491", "url": "https://glygen.org/publication/PubMed/4327491" } ] }, { "title": "Haem transport to the liver by haemopexin. Receptor-mediated uptake with recycling of the protein.", "journal": "The Biochemical journal", "date": "1979", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "496916", "url": "https://glygen.org/publication/PubMed/496916" } ] }, { "title": "Studies on the structures of haptoglobin 1-1 and hemoglobin in the haptoglobin-hemoglobin complex.", "journal": "Biochemical and biophysical research communications", "date": "1971", "authors": "Waks M, Kahn PC, Beychok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "5135507", "url": "https://glygen.org/publication/PubMed/5135507" } ] }, { "title": "Structure of human hemopexin: O-glycosyl and N-glycosyl sites and unusual clustering of tryptophan residues.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Takahashi N, Takahashi Y, Putnam FW", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "6371807", "url": "https://glygen.org/publication/PubMed/6371807" } ] }, { "title": "Hemopexin-mediated heme uptake by liver. Characterization of the interaction of heme-hemopexin with isolated rabbit liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6480598", "url": "https://glygen.org/publication/PubMed/6480598" } ] }, { "title": "Amino acid sequence of the N-terminal region of human hemopexin.", "journal": "FEBS letters", "date": "1984", "authors": "Frantikova V, Borvak J, Kluh I, Moravek L", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790#ptm_processing" }, { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "reference": [ { "type": "PubMed", "id": "6510521", "url": "https://glygen.org/publication/PubMed/6510521" } ] }, { "title": "Hemin binding to serum proteins and the catalysis of interprotein transfer.", "journal": "Biochemistry", "date": "1983", "authors": "Pasternack RF, Gibbs EJ, Hoeflin E, Kosar WP, Kubera G, Skowronek CA, Wong NM, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6849882", "url": "https://glygen.org/publication/PubMed/6849882" } ] }, { "title": "Haptoglobin-hemoglobin complex. Subunit interaction probed by cross-linking.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Greer J, Liao WD, Brown WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7263686", "url": "https://glygen.org/publication/PubMed/7263686" } ] }, { "title": "Hemopexin-mediated transport of heme into isolated rat hepatocytes.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7287740", "url": "https://glygen.org/publication/PubMed/7287740" } ] }, { "title": "Haemoglobin binding with haptoglobin. Unequivocal demonstration that the beta-chains of human haemoglobin bind to haptoglobin.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kazim AL, Atassi MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7378053", "url": "https://glygen.org/publication/PubMed/7378053" } ] }, { "title": "In vivo fate of hemopexin and heme-hemopexin complexes in the rat.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Potter D, Chroneos ZC, Baynes JW, Sinclair PR, Gorman N, Liem HH, Muller-Eberhard U, Thorpe SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8424694", "url": "https://glygen.org/publication/PubMed/8424694" } ] }, { "title": "Role of hemopexin in protection of low-density lipoprotein against hemoglobin-induced oxidation.", "journal": "Biochemistry", "date": "1996", "authors": "Miller YI, Smith A, Morgan WT, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8855948", "url": "https://glygen.org/publication/PubMed/8855948" } ] }, { "title": "Transfer of heme from heme-albumin to hemopexin.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Morgan WT, Liem HH, Sutor RP, Muller-Ebergard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "971416", "url": "https://glygen.org/publication/PubMed/971416" } ] } ], "pathway": [ { "id": "hsa:3263", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3263", "resource": "KEGG Pathway" }, { "id": "R-HSA-2168880", "name": "Scavenging of heme from plasma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "resource": "Reactome", "description": "Scavenging of heme from plasma" } ], "orthologs": [ { "uniprot_canonical_ac": "F1RMN7-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MARALGTVGAPWLLGLCCSLAIAHPLSLTAGPKHGAEGRNESKPDPDVTERCSDGWGFDASTLDEHGAMLFFKGPSVWAGQNWTRGLISERWKNAPSSVDAAFRRGHDRVFLIQGDKVWVYPPEKEKENPRSLQEEFPGVPSPLDAAVECHRGECQDEGVLFFQGTHTWFWDSTTKTTKERLWPAVGNCSSAMRWISRYYCFRGNQFLRFDPVTGHVDPKYPRDVRDYFMSCPAEGHAHRNATHRGDDRCSPDLVLTALLSDNHGATYAFRGTHYWRLDTSRDGWHSWPIDHQWSHGPSAVDAAFSWDDKLYLIQGTQVYIFLTKAGYTLVDNYPKQLEKELGSPHGISLDAVDATFVCPGTSRLHVMAGRKLWWLDLSLGAQGPWTELPWPHEKVDAALCTEKSLGPNSCSASGLGLYIVHGPHVYCYKDVEKLVSAKALPQPQSVNSLLGCHRSRGS", "length": 459 }, "evidence": [ { "id": "P02790", "url": "https://omabrowser.org/oma/group/P02790/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P20059-1", "protein_name": "Hemopexin", "gene_name": "Hpx", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MARTVVALNILVLLGLCWSLAVANPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ", "length": 460 }, "evidence": [ { "id": "45920721", "url": "http://www.informatics.jax.org/homology/45920721", "database": "MGI" }, { "id": "P02790", "url": "https://omabrowser.org/oma/group/P02790/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q91X72-1", "protein_name": "Hemopexin", "gene_name": "Hpx", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARTAVALNILVLLGLCWSLAVASPLPTANGRVAEVENGTKPDSDVPEHCLDTWSFDAATMDHNGTMLFFKGEFVWRGHSGTRELISARWKNPITSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWSTVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFVSCPGRGHGRPRNGTAHGNSTHPMHSRCSPDPGLTALLSDHRGATYAFTGSHYWRLDSSRDGWHSWPIAHHWPQGPSTVDAAFSWDDKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLETIDAAFSCPGSSRLYVSSGRRLWWLDLKSGAQATWTEVSWPHEKVDGALCLDKSLGPNTCSSNGSSLYFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ", "length": 460 }, "evidence": [ { "id": "45920721", "url": "http://www.informatics.jax.org/homology/45920721", "database": "MGI" }, { "id": "P02790", "url": "https://omabrowser.org/oma/group/P02790/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "positive regulation of humoral immune response mediated by circulating immunoglobulin", "id": "GO:0002925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002925", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "intracellular iron ion homeostasis", "id": "GO:0006879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "hemoglobin metabolic process", "id": "GO:0020027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020027", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "type II interferon-mediated signaling pathway", "id": "GO:0060333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060333", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "heme transport", "id": "GO:0015886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015886", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "positive regulation of tyrosine phosphorylation of STAT protein", "id": "GO:0042531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042531", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "heme metabolic process", "id": "GO:0042168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042168", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "positive regulation of immunoglobulin production", "id": "GO:0002639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002639", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "positive regulation of type II interferon-mediated signaling pathway", "id": "GO:0060335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060335", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "endocytic vesicle lumen", "id": "GO:0071682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071682", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" }, { "name": "heme transmembrane transporter activity", "id": "GO:0015232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015232", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "hemopexin N-glycosylated 1 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000053073", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053073" } ] }, { "name": "hemopexin N-glycosylated 2 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053074", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053074" } ] }, { "name": "hemopexin N-glycosylated 3 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053075", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053075" } ] }, { "name": "hemopexin N-glycosylated 4 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G06853GH. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G06853GH. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053076", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053076" } ] }, { "name": "hemopexin N-glycosylated 5 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053077", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053077" } ] }, { "name": "hemopexin N-glycosylated 6 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053078", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053078" } ] }, { "name": "hemopexin N-glycosylated 7 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053079", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053079" } ] }, { "name": "hemopexin N-glycosylated 8 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053080", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053080" } ] }, { "name": "hemopexin N-glycosylated 9 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053081", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053081" } ] }, { "name": "hemopexin N-glycosylated 10 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053082", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053082" } ] }, { "name": "hemopexin N-glycosylated 11 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053083", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053083" } ] }, { "name": "hemopexin N-glycosylated 12 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053084", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053084" } ] }, { "name": "hemopexin N-glycosylated 13 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053085", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053085" } ] }, { "name": "hemopexin N-glycosylated 14 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053086", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053086" } ] }, { "name": "hemopexin N-glycosylated 15 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053087", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053087" } ] }, { "name": "hemopexin N-glycosylated 16 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-187 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02790-1, Asn-187, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053088", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053088" } ] }, { "name": "hemopexin N-glycosylated 17 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24841998, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000053089", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053089" } ] }, { "name": "hemopexin N-glycosylated 18 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053090", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053090" } ] }, { "name": "hemopexin N-glycosylated 19 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053091", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053091" } ] }, { "name": "hemopexin N-glycosylated 20 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053092", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053092" } ] }, { "name": "hemopexin N-glycosylated 21 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053093", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053093" } ] }, { "name": "hemopexin N-glycosylated 22 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053094", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053094" } ] }, { "name": "hemopexin N-glycosylated 23 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053095", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053095" } ] }, { "name": "hemopexin N-glycosylated 24 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000053096", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053096" } ] }, { "name": "hemopexin N-glycosylated 25 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053097", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053097" } ] }, { "name": "hemopexin N-glycosylated 26 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053098", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053098" } ] }, { "name": "hemopexin N-glycosylated 27 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053099", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053099" } ] }, { "name": "hemopexin N-glycosylated 28 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-453 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02790-1, Asn-453, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053100", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053100" } ] }, { "name": "hemopexin N-glycosylated 29 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053101", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053101" } ] }, { "name": "hemopexin N-glycosylated 30 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053102", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053102" } ] }, { "name": "hemopexin N-glycosylated 31 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053103", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053103" } ] }, { "name": "hemopexin N-glycosylated 32 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G31852PQ. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G31852PQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053104", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053104" } ] }, { "name": "hemopexin N-glycosylated 33 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053105", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053105" } ] }, { "name": "hemopexin N-glycosylated 34 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G41247ZX. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G41247ZX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053106", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053106" } ] }, { "name": "hemopexin N-glycosylated 35 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G62765YT. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G62765YT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053107", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053107" } ] }, { "name": "hemopexin N-glycosylated 36 (human)", "definition": "A hemopexin (human) that has been N-glycosylated at the residue equivalent to Asn-64 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G80920RR. Example: UniProtKB:P02790-1, Asn-64, MOD:00160~GNO:G80920RR. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053108", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053108" } ] }, { "name": "hemopexin O-glycosylated 1 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P02790-1, Ser-30, MOD:00002~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053109", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053109" } ] }, { "name": "hemopexin O-glycosylated 2 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02790-1, Ser-30, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053110", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053110" } ] }, { "name": "hemopexin O-glycosylated 3 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Ser-30 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02790-1, Ser-30, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053111", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053111" } ] }, { "name": "hemopexin O-glycosylated 4 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-24 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P02790-1, Thr-24, MOD:00005~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053112", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053112" } ] }, { "name": "hemopexin O-glycosylated 5 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-24 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02790-1, Thr-24, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:23234360, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053113", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053113" } ] }, { "name": "hemopexin O-glycosylated 6 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G17015OC. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G17015OC. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053114", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053114" } ] }, { "name": "hemopexin O-glycosylated 7 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G27391WQ. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053115", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053115" } ] }, { "name": "hemopexin O-glycosylated 8 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053116", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053116" } ] }, { "name": "hemopexin O-glycosylated 9 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053117", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053117" } ] }, { "name": "hemopexin O-glycosylated 10 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053118", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053118" } ] }, { "name": "hemopexin O-glycosylated 11 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-29 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P02790-1, Thr-29, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:26598643, PMID:30459171]", "evidence": [ { "id": "PR:000053119", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053119" } ] }, { "name": "hemopexin O-glycosylated 12 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-351 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02790-1, Thr-351, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053120", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053120" } ] }, { "name": "hemopexin O-glycosylated 13 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-40 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02790-1, Thr-40, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053121", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053121" } ] }, { "name": "hemopexin O-glycosylated 14 (human)", "definition": "A hemopexin (human) that has been O-glycosylated at the residue equivalent to Thr-40 of the amino acid sequence represented by UniProtKB:P02790-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02790-1, Thr-40, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053122", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053122" } ] } ], "site_annotation": [ { "start_pos": 187, "end_pos": 189, "annotation": "n_glycosylation_sequon" }, { "start_pos": 240, "end_pos": 242, "annotation": "n_glycosylation_sequon" }, { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" }, { "start_pos": 453, "end_pos": 455, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans. O-glycosylation in the 30-40 region is minor compared to glycosylation at Thr-24 and Thr-29.", "evidence": [ { "database": "UniProtKB", "id": "P02790", "url": "https://www.uniprot.org/uniprot/P02790" }, { "database": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "23234360", "url": "https://glygen.org/publication/PubMed/23234360" }, { "database": "PubMed", "id": "6371807", "url": "https://glygen.org/publication/PubMed/6371807" }, { "database": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" }, { "database": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" }, { "database": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Glyco-typer 50 N-glycan liver disease panel", "biomarker_id": "A0245", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" } ], "instances": [ { "best_biomarker_type": "monitoring", "status": "MALDI-MS measured N-glycans", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] }, { "assessed_biomarker_entity": "Disialylated to monosialylated O-glycoforms of hemopexin ratio(S-HPX)", "biomarker_id": "A0435", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "27688741", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27688741" } ], "instances": [ { "best_biomarker_type": "monitoring", "status": "increased S-HPX", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "27688741", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27688741" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 64, 187, 240, 246, 416, 453 ], "o_linked_sites": [ 24, 29, 30, 40, 240, 351 ], "snv_sites": [ 24, 30, 40, 64, 66, 102, 187, 189, 246, 404, 423, 445, 453 ], "glycation_sites": [], "phosphorylation_sites": [ 87 ], "sequon_annotation_sites": [ { "start_pos": 187, "end_pos": 189 }, { "start_pos": 240, "end_pos": 242 }, { "start_pos": 246, "end_pos": 248 }, { "start_pos": 453, "end_pos": 455 }, { "start_pos": 64, "end_pos": 66 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 205 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_glycans", "count": 105 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 197 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 105 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 82 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }