{ "uniprot_canonical_ac": "P02787-1", "uniprot_ac": "P02787", "uniprot_id": "TRFE_HUMAN", "mass": { "chemical_mass": 77050.0, "monoisotopic_mass": 77050.0 }, "refseq": { "ac": "NP_001054", "name": "serotransferrin isoform 1 precursor", "summary": "This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq, Sep 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, "gene_names": [ { "name": "TF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02787", "id": "P02787" }, { "name": "HEL-S-71p; PRO1557; PRO2086; TFQTL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054", "id": "NP_001054" }, { "name": "PRO1400", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02787", "id": "P02787" }, { "name": "TF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054", "id": "NP_001054" } ], "protein_names": [ { "name": "Serotransferrin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02787" }, { "name": "Beta-1 metal-binding globulin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02787" }, { "name": "Siderophilin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02787" }, { "name": "Transferrin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02787" }, { "name": "serotransferrin isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054", "id": "NP_001054" }, { "name": "serotransferrin; siderophilin; beta-1 metal-binding globulin; epididymis secretory sperm binding protein Li 71p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054", "id": "NP_001054" } ], "function": [ { "annotation": "(Microbial infection) Serves as an iron source for Neisseria species, which capture the protein and extract its iron for their own use.", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#function" }, { "database": "PubMed", "id": "22343719", "url": "https://glygen.org/publication/PubMed/22343719" }, { "database": "PubMed", "id": "22327295", "url": "https://glygen.org/publication/PubMed/22327295" } ] }, { "annotation": "(Microbial infection) Serves as an iron source for parasite T.brucei (strain 427), which capture TF via its own transferrin receptor ESAG6:ESAG7 and extract its iron for its own use.", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#function" }, { "database": "PubMed", "id": "31636418", "url": "https://glygen.org/publication/PubMed/31636418" } ] }, { "annotation": "Height of non-Hispanic white adults with homeostatic iron regulator HFE genotypes p.C282Y/p.C282Y and wt/wt.", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, { "database": "PubMed", "id": "37930135", "url": "https://glygen.org/publication/PubMed/37930135" } ] }, { "annotation": "Macromolecular Crowding Promotes Re-entrant Liquid-Liquid Phase Separation of Human Serum Transferrin and Prevents Surface-Induced Fibrillation.", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, { "database": "PubMed", "id": "37503577", "url": "https://glygen.org/publication/PubMed/37503577" } ] }, { "annotation": "Meconium Transferrin and Ferritin as Markers of Homeostasis in the Developing Fetus. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, { "database": "PubMed", "id": "37958917", "url": "https://glygen.org/publication/PubMed/37958917" } ] }, { "annotation": "The hepatic niche leads to aggressive natural killer cell leukemia proliferation through the transferrin-transferrin receptor 1 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, { "database": "PubMed", "id": "37146246", "url": "https://glygen.org/publication/PubMed/37146246" } ] }, { "annotation": "This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq, Sep 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ] }, { "annotation": "Transferrin promotes chondrogenic differentiation in condylar growth through inducing autophagy via ULK1-ATG16L1 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" }, { "database": "PubMed", "id": "37694282", "url": "https://glygen.org/publication/PubMed/37694282" } ] }, { "annotation": "Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#function" } ] } ], "disease": [ { "disease_id": "DOID:0050649", "recommended_name": { "id": "DOID:0050649", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050649", "name": "atransferrinemia", "description": "A metal metabolism disorder that is characterized by transferrin deficiency, microcytic anemia, and iron loading, and has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the structural gene for transferrin (TF) on chromosome 3q22." }, "synonyms": [ { "id": "DOID:0050649", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050649", "name": "familial hypotransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "atransferrinemia", "description": "Congenital atransferrinemia is a very rare hematologic disease caused by a transferrin (TF) deficiency and characterized by microcytic, hypochromic anemia (manifesting with pallor, fatigue and growth retardation) and iron overload, and that can be fatal if left untreated." }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "atransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "congenital atransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "congenital hypotransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "familial hypotransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "hereditary atransferrinemia", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "hypotransferrinemia, familial", "description": "" }, { "id": "MONDO:0008846", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008846", "name": "transferrin serum level quantitative trait locus 1", "description": "" }, { "id": "MIM:209300", "resource": "MIM", "url": "https://www.omim.org/entry/209300", "name": "Atransferrinemia", "description": "Atransferrinemia" } ], "evidence": [ { "id": "209300", "database": "MIM", "url": "https://www.omim.org/entry/209300" } ] } ], "snv": [ { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [], "start_pos": 273, "end_pos": 273, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "3", "chr_pos": "133756957", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R273", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 452, "end_pos": 452, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "3", "chr_pos": "133766303", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K452", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 482, "end_pos": 482, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NIP->NIS).", "chr_id": "3", "chr_pos": "133766391", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P482", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 482, "end_pos": 482, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NIP->NIT).", "chr_id": "3", "chr_pos": "133766391", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P482", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [], "start_pos": 66, "end_pos": 66, "subjects_tested": "92", "subjects_positive": "1", "frequency": "1.1", "sequence_org": "D", "sequence_mut": "E", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "chr_id": "3", "chr_pos": "133748566", "ref_nt": "T", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D66", "keywords": [ "biomuta", "somatic", "cancer" ] }, { "evidence": [ { "id": "P02787", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787" } ], "glycoeffect": [], "start_pos": 75, "end_pos": 75, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "3", "chr_pos": "133753601", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "E75", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "86.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "64.9", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "82.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "87.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "65.5", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "63.48", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "62.94", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "67.28", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "63.29", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "84.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02787" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "common_name": "Human" } ], "gene": [ { "name": "TF", "url": "https://www.uniprot.org/uniprot/P02787", "locus": { "chromosome": "3", "start_pos": 133796641, "end_pos": 133746040, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000091513", "url": "https://www.ensembl.org/id/ENSG00000091513" } ] } } ], "crossref": [ { "id": "ENSG00000091513", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000091513", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P02787", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02787", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd13617", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd13617", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd13618", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd13618", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4865", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4865", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7018", "url": "https://www.ncbi.nlm.nih.gov/gene/7018", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11740", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11740", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02787", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02787*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018195", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018195", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030685", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030685", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7018", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7018", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "190000", "url": "http://www.omim.org/entry/190000", "database": "MIM", "categories": [ "Other" ] }, { "id": "209300", "url": "http://www.omim.org/entry/209300", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02787", "url": "https://www.nextprot.org/entry/NX_P02787", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P02787", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02787", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DEWSINS", "url": "https://omabrowser.org/oma/group/DEWSINS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2906687at2759", "url": "http://www.orthodb.org/?query=2906687at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11485", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11485", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11485:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11485:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A8E", "url": "https://www.rcsb.org/structure/1A8E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A8F", "url": "https://www.rcsb.org/structure/1A8F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1B3E", "url": "https://www.rcsb.org/structure/1B3E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BP5", "url": "https://www.rcsb.org/structure/1BP5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1BTJ", "url": "https://www.rcsb.org/structure/1BTJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1D3K", "url": "https://www.rcsb.org/structure/1D3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1D4N", "url": "https://www.rcsb.org/structure/1D4N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1DTG", "url": "https://www.rcsb.org/structure/1DTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FQE", "url": "https://www.rcsb.org/structure/1FQE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1FQF", "url": "https://www.rcsb.org/structure/1FQF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JQF", "url": "https://www.rcsb.org/structure/1JQF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N7W", "url": "https://www.rcsb.org/structure/1N7W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N7X", "url": "https://www.rcsb.org/structure/1N7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N84", "url": "https://www.rcsb.org/structure/1N84", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OQG", "url": "https://www.rcsb.org/structure/1OQG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OQH", "url": "https://www.rcsb.org/structure/1OQH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RYO", "url": "https://www.rcsb.org/structure/1RYO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SUV", "url": "https://www.rcsb.org/structure/1SUV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HAU", "url": "https://www.rcsb.org/structure/2HAU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HAV", "url": "https://www.rcsb.org/structure/2HAV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2O7U", "url": "https://www.rcsb.org/structure/2O7U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2O84", "url": "https://www.rcsb.org/structure/2O84", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FGS", "url": "https://www.rcsb.org/structure/3FGS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3QYT", "url": "https://www.rcsb.org/structure/3QYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S9L", "url": "https://www.rcsb.org/structure/3S9L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S9M", "url": "https://www.rcsb.org/structure/3S9M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S9N", "url": "https://www.rcsb.org/structure/3S9N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SKP", "url": "https://www.rcsb.org/structure/3SKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V83", "url": "https://www.rcsb.org/structure/3V83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V89", "url": "https://www.rcsb.org/structure/3V89", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3V8X", "url": "https://www.rcsb.org/structure/3V8X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VE1", "url": "https://www.rcsb.org/structure/3VE1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4H0W", "url": "https://www.rcsb.org/structure/4H0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1B", "url": "https://www.rcsb.org/structure/4X1B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X1D", "url": "https://www.rcsb.org/structure/4X1D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DYH", "url": "https://www.rcsb.org/structure/5DYH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5H52", "url": "https://www.rcsb.org/structure/5H52", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WTD", "url": "https://www.rcsb.org/structure/5WTD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5X5P", "url": "https://www.rcsb.org/structure/5X5P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y6K", "url": "https://www.rcsb.org/structure/5Y6K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CTC", "url": "https://www.rcsb.org/structure/6CTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D03", "url": "https://www.rcsb.org/structure/6D03", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D04", "url": "https://www.rcsb.org/structure/6D04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D05", "url": "https://www.rcsb.org/structure/6D05", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6JAS", "url": "https://www.rcsb.org/structure/6JAS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SOY", "url": "https://www.rcsb.org/structure/6SOY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SOZ", "url": "https://www.rcsb.org/structure/6SOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJ6", "url": "https://www.rcsb.org/structure/6UJ6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FFM", "url": "https://www.rcsb.org/structure/7FFM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7FFU", "url": "https://www.rcsb.org/structure/7FFU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Q1L", "url": "https://www.rcsb.org/structure/7Q1L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BRC", "url": "https://www.rcsb.org/structure/8BRC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00405", "url": "http://pfam.xfam.org/family/PF00405", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02787", "url": "https://pharos.nih.gov/targets/P02787", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052997", "url": "https://proconsortium.org/app/entry/PR:000052997", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052998", "url": "https://proconsortium.org/app/entry/PR:000052998", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052999", "url": "https://proconsortium.org/app/entry/PR:000052999", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053000", "url": "https://proconsortium.org/app/entry/PR:000053000", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053001", "url": "https://proconsortium.org/app/entry/PR:000053001", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053002", "url": "https://proconsortium.org/app/entry/PR:000053002", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053003", "url": "https://proconsortium.org/app/entry/PR:000053003", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053004", "url": "https://proconsortium.org/app/entry/PR:000053004", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053005", "url": "https://proconsortium.org/app/entry/PR:000053005", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053006", "url": "https://proconsortium.org/app/entry/PR:000053006", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053007", "url": "https://proconsortium.org/app/entry/PR:000053007", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053008", "url": "https://proconsortium.org/app/entry/PR:000053008", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053009", "url": "https://proconsortium.org/app/entry/PR:000053009", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053010", "url": "https://proconsortium.org/app/entry/PR:000053010", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053011", "url": "https://proconsortium.org/app/entry/PR:000053011", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053012", "url": "https://proconsortium.org/app/entry/PR:000053012", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053013", "url": "https://proconsortium.org/app/entry/PR:000053013", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053014", "url": "https://proconsortium.org/app/entry/PR:000053014", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053015", "url": "https://proconsortium.org/app/entry/PR:000053015", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053016", "url": "https://proconsortium.org/app/entry/PR:000053016", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053017", "url": "https://proconsortium.org/app/entry/PR:000053017", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053018", "url": "https://proconsortium.org/app/entry/PR:000053018", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053019", "url": "https://proconsortium.org/app/entry/PR:000053019", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053020", "url": "https://proconsortium.org/app/entry/PR:000053020", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053021", "url": "https://proconsortium.org/app/entry/PR:000053021", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053022", "url": "https://proconsortium.org/app/entry/PR:000053022", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053023", "url": "https://proconsortium.org/app/entry/PR:000053023", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053024", "url": "https://proconsortium.org/app/entry/PR:000053024", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053025", "url": "https://proconsortium.org/app/entry/PR:000053025", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053026", "url": "https://proconsortium.org/app/entry/PR:000053026", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053027", "url": "https://proconsortium.org/app/entry/PR:000053027", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053028", "url": "https://proconsortium.org/app/entry/PR:000053028", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053029", "url": "https://proconsortium.org/app/entry/PR:000053029", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053030", "url": "https://proconsortium.org/app/entry/PR:000053030", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053031", "url": "https://proconsortium.org/app/entry/PR:000053031", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053032", "url": "https://proconsortium.org/app/entry/PR:000053032", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053033", "url": "https://proconsortium.org/app/entry/PR:000053033", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053034", "url": "https://proconsortium.org/app/entry/PR:000053034", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053035", "url": "https://proconsortium.org/app/entry/PR:000053035", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053036", "url": "https://proconsortium.org/app/entry/PR:000053036", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053037", "url": "https://proconsortium.org/app/entry/PR:000053037", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053038", "url": "https://proconsortium.org/app/entry/PR:000053038", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053039", "url": "https://proconsortium.org/app/entry/PR:000053039", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053040", "url": "https://proconsortium.org/app/entry/PR:000053040", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053041", "url": "https://proconsortium.org/app/entry/PR:000053041", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053042", "url": "https://proconsortium.org/app/entry/PR:000053042", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053043", "url": "https://proconsortium.org/app/entry/PR:000053043", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000053044", "url": "https://proconsortium.org/app/entry/PR:000053044", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02787", "url": "http://purl.obolibrary.org/obo/PR_P02787", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02787", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "C9JB55", "url": "https://www.uniprot.org/uniprot/C9JB55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JB55-1", "url": "https://www.uniprot.org/uniprot/C9JB55-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JVG0", "url": "https://www.uniprot.org/uniprot/C9JVG0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JVG0-1", "url": "https://www.uniprot.org/uniprot/C9JVG0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WC57", "url": "https://www.uniprot.org/uniprot/F8WC57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WC57-1", "url": "https://www.uniprot.org/uniprot/F8WC57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCI6", "url": "https://www.uniprot.org/uniprot/F8WCI6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCI6-1", "url": "https://www.uniprot.org/uniprot/F8WCI6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEK9", "url": "https://www.uniprot.org/uniprot/F8WEK9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEK9-1", "url": "https://www.uniprot.org/uniprot/F8WEK9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5E8", "url": "https://www.uniprot.org/uniprot/H7C5E8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5E8-1", "url": "https://www.uniprot.org/uniprot/H7C5E8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02787-1", "url": "https://www.uniprot.org/uniprot/P02787-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP", "length": 698, "header": "sp|P02787-1|TRFE_HUMAN Isoform 1 of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4 CANONICAL=P02787-1" }, "isoforms": [ { "isoform_ac": "C9JB55-1", "url": "", "sequence": { "sequence": "MKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAV", "length": 75, "header": "tr|C9JB55-1|TRFE_HUMAN Computationally mapped isoform of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=8 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133754526, "end_pos": 133748501, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000466911.5", "url": "https://www.ensembl.org/id/ENST00000466911.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417468.1", "url": "https://www.ensembl.org/id/ENSP00000417468.1" } ] } }, { "isoform_ac": "C9JVG0-1", "url": "", "sequence": { "sequence": "MNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCH", "length": 134, "header": "tr|C9JVG0-1|C9JVG0_HUMAN Computationally mapped isoform of Transferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=1 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133756922, "end_pos": 133754551, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000482271.5", "url": "https://www.ensembl.org/id/ENST00000482271.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000419338.1", "url": "https://www.ensembl.org/id/ENSP00000419338.1" } ] } }, { "isoform_ac": "F8WC57-1", "url": "", "sequence": { "sequence": "MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPFSYRRGPKYGRQGGLDLGASQPGPGTFWQRQIKRIPTIQLSSWEGPAV", "length": 102, "header": "tr|F8WC57-1|TRFE_HUMAN Computationally mapped isoform of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=1 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133757839, "end_pos": 133746441, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000485977.1", "url": "https://www.ensembl.org/id/ENST00000485977.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000418716.1", "url": "https://www.ensembl.org/id/ENSP00000418716.1" } ] } }, { "isoform_ac": "F8WCI6-1", "url": "", "sequence": { "sequence": "MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDFLLCCCCGEEG", "length": 120, "header": "tr|F8WCI6-1|TRFE_HUMAN Computationally mapped isoform of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=1 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133754537, "end_pos": 133746441, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000494430.5", "url": "https://www.ensembl.org/id/ENST00000494430.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000418396.1", "url": "https://www.ensembl.org/id/ENSP00000418396.1" } ] } }, { "isoform_ac": "F8WEK9-1", "url": "", "sequence": { "sequence": "MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAVSRCCLKESGRKPYFLCFQSLWNNSLLTGKRSGCCDTGCRFGV", "length": 115, "header": "tr|F8WEK9-1|F8WEK9_HUMAN Computationally mapped isoform of Transferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=1 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133753638, "end_pos": 133746441, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000414694.5", "url": "https://www.ensembl.org/id/ENST00000414694.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000401505.1", "url": "https://www.ensembl.org/id/ENSP00000401505.1" } ] } }, { "isoform_ac": "H7C5E8-1", "url": "", "sequence": { "sequence": "XYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGETIQKRRGKGAEMGYRPVSHRKKP", "length": 143, "header": "tr|H7C5E8-1|TRFE_HUMAN Computationally mapped isoform of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=1 CANONICAL=P02787-1" }, "locus": { "chromosome": "3", "start_pos": 133775443, "end_pos": 133766278, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000461695.1", "url": "https://www.ensembl.org/id/ENST00000461695.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000419714.1", "url": "https://www.ensembl.org/id/ENSP00000419714.1" } ] } }, { "isoform_ac": "P02787-1", "url": "", "sequence": { "sequence": "MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP", "length": 698, "header": "sp|P02787-1|TRFE_HUMAN Isoform 1 of Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4 CANONICAL=P02787-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 409, "start_aa": "Ser", "end_pos": 409, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser409", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G03596YS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G04055MU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12579WK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G15508AW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G17168RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-432 AND ASN-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22769FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G24084IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50143PC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G50210FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G64275UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29992770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77459ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80735OA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-432 AND ASN-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G87418CY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G89877QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-432 AND ASN-630 ; ASN-432 AND ASN-630", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" }, { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "22327295", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22327295" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "6SOZ", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6SOZ" }, { "id": "6SOY", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/6SOY" }, { "id": "31636418", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31636418" }, { "id": "3QYT", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3QYT" }, { "id": "4H0W", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4H0W" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "25425657", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25425657" }, { "id": "25425657", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25425657" }, { "id": "15536627", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/15536627" }, { "id": "24780636", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/24780636" }, { "id": "24780636", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24780636" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 491, "start_aa": "Asn", "end_pos": 491, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn491", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine; atypical; partial", "start_pos": 491, "start_aa": "Asn", "end_pos": 491, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn491", "evidence": [ { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "15474009", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/15474009" }, { "id": "15474009", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15474009" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 51, "start_aa": "Ser", "end_pos": 51, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser51", "evidence": [ { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 523, "start_aa": "Asn", "end_pos": 523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn523", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 523, "start_aa": "Asn", "end_pos": 523, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn523", "evidence": [ { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G04909DG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G17168RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "glytoucan_ac": "G26915XM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153361" }, { "id": "24417605", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50210FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59297UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77338BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G86500WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G87418CY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G89877QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-432, N-630", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "10029548", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10029548" }, { "id": "1456441", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "15536627", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15536627" }, { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "22327295", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22327295" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" }, { "id": "3QYT", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3QYT" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "24780636", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/24780636" }, { "id": "24780636", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24780636" }, { "id": "29427759", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" }, { "id": "29427759", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29427759" }, { "id": "15536627", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/15536627" }, { "id": "25425657", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25425657" }, { "id": "25425657", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25425657" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 637, "start_aa": "Asn", "end_pos": 637, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn637", "evidence": [ { "id": "P02787", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G00395TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G07483YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G07995VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G08939IS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7867791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7867791" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G11460AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G14047PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G17168RO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G19958IL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G23616ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G26864OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G27383GK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G28916LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7867791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7867791" } ] }, { "glytoucan_ac": "G31685JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G33241WC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G34499SX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G36004BS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7867791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7867791" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G36836GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G40702WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G43702IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G45889JQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G47832TO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P02787", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02787" }, { "id": "23576270", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23576270" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7867791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7867791" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G57173NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G60230HH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G61751GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G64162JC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G66665YI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G66951WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G68164MW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G68668TB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G68796US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G69411IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G72956NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G76675AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G83161QT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G87418CY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "7944531", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "glytoucan_ac": "G89877QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "8174273", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "glytoucan_ac": "G91704UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G93775KQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9666724", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "glytoucan_ac": "G94239KE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "33889819", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "10929010", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "glytoucan_ac": "G96921ZU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G97674NY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "glytoucan_ac": "G97947UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "9751792", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9751792" } ] } ], "phosphorylation": [ { "start_pos": 389, "end_pos": 389, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "iPTMnet", "id": "P02787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02787" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser389" }, { "start_pos": 536, "end_pos": 536, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02787" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" }, { "database": "phospho.ELM", "id": "P02787", "url": "http://phospho.elm.eu.org/byAccession/P02787.html" } ], "site_lbl": "Tyr536" }, { "start_pos": 685, "end_pos": 685, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "iPTMnet", "id": "P02787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02787" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser685" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32.", "journal": "Biochemistry", "date": "1999", "authors": "Bewley MC, Tam BM, Grewal J, He S, Shewry S, Murphy ME, Mason AB, Woodworth RC, Baker EN, MacGillivray RT", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "UniCarbKB", "id": "P02787", "url": "" } ], "reference": [ { "type": "PubMed", "id": "10029548", "url": "https://glygen.org/publication/PubMed/10029548" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The beta2-adrenergic receptor/betaarrestin complex recruits the clathrin adaptor AP-2 during endocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Laporte SA, Oakley RH, Zhang J, Holt JA, Ferguson SS, Caron MG, Barak LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10097102", "url": "https://glygen.org/publication/PubMed/10097102" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Molecular cloning of transferrin receptor 2. A new member of the transferrin receptor-like family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kawabata H, Yang R, Hirama T, Vuong PT, Kawano S, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "10409623", "url": "https://glygen.org/publication/PubMed/10409623" } ] }, { "title": "Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Tebar F, Bohlander SK, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10436022", "url": "https://glygen.org/publication/PubMed/10436022" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rosenthal JA, Chen H, Slepnev VI, Pellegrini L, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10567358", "url": "https://glygen.org/publication/PubMed/10567358" } ] }, { "title": "Covalent modification of all members of human cullin family proteins by NEDD8.", "journal": "Oncogene", "date": "1999", "authors": "Hori T, Osaka F, Chiba T, Miyamoto C, Okabayashi K, Shimbara N, Kato S, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "10597293", "url": "https://glygen.org/publication/PubMed/10597293" } ] }, { "title": "The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Doria M, Salcini AE, Colombo E, Parslow TG, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10613896", "url": "https://glygen.org/publication/PubMed/10613896" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.", "journal": "The Biochemical journal", "date": "2000", "authors": "Oleinikov AV, Zhao J, Makker SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10769163", "url": "https://glygen.org/publication/PubMed/10769163" } ] }, { "title": "The gene TFR2 is mutated in a new type of haemochromatosis mapping to 7q22.", "journal": "Nature genetics", "date": "2000", "authors": "Camaschella C, Roetto A, Cali A, De Gobbi M, Garozzo G, Carella M, Majorano N, Totaro A, Gasparini P", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "10802645", "url": "https://glygen.org/publication/PubMed/10802645" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase.", "journal": "Glycobiology", "date": "2000", "authors": "Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman BA, Jarvis DL, Lee YC, Betenbaugh MJ", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "10929010", "url": "https://glygen.org/publication/PubMed/10929010" } ] }, { "title": "Alternative splicing prevents transferrin secretion during differentiation of a human oligodendrocyte cell line.", "journal": "J. Neurosci. Res.", "date": "2000", "authors": "de Arriba Zerpa G A, Saleh M C, Fern\u00e1ndez P M, Guillou F, Espinosa de los Monteros A, de Vellis J, Zakin M M, Baron B", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "10931525", "url": "https://glygen.org/publication/PubMed/10931525" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "The hPLIC proteins may provide a link between the ubiquitination machinery and the proteasome.", "journal": "Molecular cell", "date": "2000", "authors": "Kleijnen MF, Shih AH, Zhou P, Kumar S, Soccio RE, Kedersha NL, Gill G, Howley PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10983987", "url": "https://glygen.org/publication/PubMed/10983987" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Multiple C-terminal motifs of the 46-kDa mannose 6-phosphate receptor tail contribute to efficient binding of medium chains of AP-2 and AP-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Storch S, Braulke T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11071885", "url": "https://glygen.org/publication/PubMed/11071885" } ] }, { "title": "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Mah AL, Perry G, Smith MA, Monteiro MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11076969", "url": "https://glygen.org/publication/PubMed/11076969" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Molecular characterization of a case of atransferrinemia.", "journal": "Blood", "date": "2000", "authors": "Beutler E, Gelbart T, Lee P, Trevino R, Fernandez MA, Fairbanks VF", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "11110675", "url": "https://glygen.org/publication/PubMed/11110675" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Morris SM, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11247302", "url": "https://glygen.org/publication/PubMed/11247302" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "A human mitochondrial ferritin encoded by an intronless gene.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Levi S, Corsi B, Bosisio M, Invernizzi R, Volz A, Sanford D, Arosio P, Drysdale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "11323407", "url": "https://glygen.org/publication/PubMed/11323407" } ] }, { "title": "Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.", "journal": "EMBO reports", "date": "2001", "authors": "Walther K, Krauss M, Diril MK, Lemke S, Ricotta D, Honing S, Kaiser S, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11454741", "url": "https://glygen.org/publication/PubMed/11454741" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Shenoy SK, McDonald PH, Kohout TA, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11588219", "url": "https://glygen.org/publication/PubMed/11588219" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "Identification of 96 single nucleotide polymorphisms in eight genes involved in iron metabolism: efficiency of bioinformatic extraction compared with a systematic sequencing approach.", "journal": "Human genetics", "date": "2001", "authors": "Douabin-Gicquel V, Soriano N, Ferran H, Wojcik F, Palierne E, Tamim S, Jovelin T, McKie AT, Le Gall JY, David V, Mosser J", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "11702220", "url": "https://glygen.org/publication/PubMed/11702220" } ] }, { "title": "Human transferrin G277S mutation: a risk factor for iron deficiency anaemia.", "journal": "British journal of haematology", "date": "2001", "authors": "Lee PL, Halloran C, Trevino R, Felitti V, Beutler E", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "11703331", "url": "https://glygen.org/publication/PubMed/11703331" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Mutational analysis of the transferrin receptor reveals overlapping HFE and transferrin binding sites.", "journal": "Journal of molecular biology", "date": "2001", "authors": "West AP Jr, Giannetti AM, Herr AB, Bennett MJ, Nangiana JS, Pierce JR, Weiner LP, Snow PM, Bjorkman PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "11800564", "url": "https://glygen.org/publication/PubMed/11800564" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.", "journal": "Nature", "date": "2002", "authors": "Polo S, Sigismund S, Faretta M, Guidi M, Capua MR, Bossi G, Chen H, De Camilli P, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11919637", "url": "https://glygen.org/publication/PubMed/11919637" } ] }, { "title": "Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.", "journal": "The EMBO journal", "date": "2002", "authors": "Morris SM, Tallquist MD, Rock CO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11927540", "url": "https://glygen.org/publication/PubMed/11927540" } ] }, { "title": "Epsins and Vps27p/Hrs contain ubiquitin-binding domains that function in receptor endocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Shih SC, Katzmann DJ, Schnell JD, Sutanto M, Emr SD, Hicke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11988742", "url": "https://glygen.org/publication/PubMed/11988742" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "Molecular architecture and functional model of the endocytic AP2 complex.", "journal": "Cell", "date": "2002", "authors": "Collins BM, McCoy AJ, Kent HM, Evans PR, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12086608", "url": "https://glygen.org/publication/PubMed/12086608" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "ARH is a modular adaptor protein that interacts with the LDL receptor, clathrin, and AP-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "He G, Gupta S, Yi M, Michaely P, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12221107", "url": "https://glygen.org/publication/PubMed/12221107" } ] }, { "title": "Disabled-2 exhibits the properties of a cargo-selective endocytic clathrin adaptor.", "journal": "The EMBO journal", "date": "2002", "authors": "Mishra SK, Keyel PA, Hawryluk MJ, Agostinelli NR, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12234931", "url": "https://glygen.org/publication/PubMed/12234931" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Yao D, Ehrlich M, Henis YI, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12429842", "url": "https://glygen.org/publication/PubMed/12429842" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "The autosomal recessive hypercholesterolemia (ARH) protein interfaces directly with the clathrin-coat machinery.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Mishra SK, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12451172", "url": "https://glygen.org/publication/PubMed/12451172" } ] }, { "title": "The neutrophil lipocalin NGAL is a bacteriostatic agent that interferes with siderophore-mediated iron acquisition.", "journal": "Molecular cell", "date": "2002", "authors": "Goetz DH, Holmes MA, Borregaard N, Bluhm ME, Raymond KN, Strong RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "12453412", "url": "https://glygen.org/publication/PubMed/12453412" } ] }, { "title": "Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braun L, Christophe T, Boulay F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12464600", "url": "https://glygen.org/publication/PubMed/12464600" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "CAND1 binds to unneddylated CUL1 and regulates the formation of SCF ubiquitin E3 ligase complex.", "journal": "Molecular cell", "date": "2002", "authors": "Zheng J, Yang X, Harrell JM, Ryzhikov S, Shim EH, Lykke-Andersen K, Wei N, Sun H, Kobayashi R, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "12504026", "url": "https://glygen.org/publication/PubMed/12504026" } ] }, { "title": "Transferrin receptor 2: a new molecule in iron metabolism.", "journal": "The international journal of biochemistry & cell biology", "date": "2003", "authors": "Trinder D, Baker E", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "12531241", "url": "https://glygen.org/publication/PubMed/12531241" } ] }, { "title": "Multiple monoubiquitination of RTKs is sufficient for their endocytosis and degradation.", "journal": "Nature cell biology", "date": "2003", "authors": "Haglund K, Sigismund S, Polo S, Szymkiewicz I, Di Fiore PP, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12717448", "url": "https://glygen.org/publication/PubMed/12717448" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Xenopus autosomal recessive hypercholesterolemia protein couples lipoprotein receptors with the AP-2 complex in oocytes and embryos and is required for vitellogenesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhou Y, Zhang J, King ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12944396", "url": "https://glygen.org/publication/PubMed/12944396" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "The expression and functional characterization of ABCG2 in brain endothelial cells and vessels.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2003", "authors": "Zhang W, Mojsilovic-Petrovic J, Andrade MF, Zhang H, Ball M, Stanimirovic DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "12958161", "url": "https://glygen.org/publication/PubMed/12958161" } ] }, { "title": "Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Chen W, ten Berge D, Brown J, Ahn S, Hu LA, Miller WE, Caron MG, Barak LS, Nusse R, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12958364", "url": "https://glygen.org/publication/PubMed/12958364" } ] }, { "title": "Characterization of the signal for rapid internalization of the bovine mannose 6-phosphate/insulin-like growth factor-II receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Jadot M, Canfield WM, Gregory W, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1317852", "url": "https://glygen.org/publication/PubMed/1317852" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy.", "journal": "Analytical biochemistry", "date": "1992", "authors": "Fu D, van Halbeek H", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "1456441", "url": "https://glygen.org/publication/PubMed/1456441" } ] }, { "title": "Multidrug resistance mediated by the breast cancer resistance protein BCRP (ABCG2).", "journal": "Oncogene", "date": "2003", "authors": "Doyle L, Ross DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "14576842", "url": "https://glygen.org/publication/PubMed/14576842" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "The ubiquitin-related protein PLIC-1 regulates heterotrimeric G protein function through association with Gbetagamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "N'Diaye EN, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14662753", "url": "https://glygen.org/publication/PubMed/14662753" } ] }, { "title": "Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Walther K, Diril MK, Jung N, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14726597", "url": "https://glygen.org/publication/PubMed/14726597" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Characterization of oligomeric human half-ABC transporter ATP-binding cassette G2.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Xu J, Liu Y, Yang Y, Bates S, Zhang JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "15001581", "url": "https://glygen.org/publication/PubMed/15001581" } ] }, { "title": "The stem cell marker Bcrp/ABCG2 enhances hypoxic cell survival through interactions with heme.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Krishnamurthy P, Ross DD, Nakanishi T, Bailey-Dell K, Zhou S, Mercer KE, Sarkadi B, Sorrentino BP, Schuetz JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "15044468", "url": "https://glygen.org/publication/PubMed/15044468" } ] }, { "title": "A proteomic analysis of human bile.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.", "journal": "Biochimie", "date": "2004", "authors": "Gallagher H, Oleinikov AV, Fenske C, Newman DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15134832", "url": "https://glygen.org/publication/PubMed/15134832" } ] }, { "title": "Crystal structure and biochemical properties of the human mitochondrial ferritin and its mutant Ser144Ala.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Langlois d'Estaintot B, Santambrogio P, Granier T, Gallois B, Chevalier JM, Precigoux G, Levi S, Arosio P", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "15201052", "url": "https://glygen.org/publication/PubMed/15201052" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains.", "journal": "Cell", "date": "1992", "authors": "Letourneur F, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1535555", "url": "https://glygen.org/publication/PubMed/1535555" } ] }, { "title": "Molecular characterization of a third case of human atransferrinemia.", "journal": "Blood", "date": "2004", "authors": "Knisely AS, Gelbart T, Beutler E", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "15466165", "url": "https://glygen.org/publication/PubMed/15466165" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Adaptors for clathrin coats: structure and function.", "journal": "Annual review of cell and developmental biology", "date": "2004", "authors": "Owen DJ, Collins BM, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15473838", "url": "https://glygen.org/publication/PubMed/15473838" } ] }, { "title": "N-glycosylation at Asn(491) in the Asn-Xaa-Cys motif of human transferrin.", "journal": "FEBS letters", "date": "2004", "authors": "Satomi Y, Shimonishi Y, Takao T", "evidence": [ { "database": "Automatic Literature Mining", "id": "15474009", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/15474009" } ], "reference": [ { "type": "PubMed", "id": "15474009", "url": "https://glygen.org/publication/PubMed/15474009" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Lipocalin 2 mediates an innate immune response to bacterial infection by sequestrating iron.", "journal": "Nature", "date": "2004", "authors": "Flo TH, Smith KD, Sato S, Rodriguez DJ, Holmes MA, Strong RK, Akira S, Aderem A", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "15531878", "url": "https://glygen.org/publication/PubMed/15531878" } ] }, { "title": "Site-specific carbohydrate profiling of human transferrin by nano-flow liquid chromatography/electrospray ionization mass spectrometry.", "journal": "Rapid communications in mass spectrometry : RCM", "date": "2004", "authors": "Satomi Y, Shimonishi Y, Hase T, Takao T", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "Automatic Literature Mining", "id": "15536627", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/15536627" } ], "reference": [ { "type": "PubMed", "id": "15536627", "url": "https://glygen.org/publication/PubMed/15536627" } ] }, { "title": "Structure of the Cand1-Cul1-Roc1 complex reveals regulatory mechanisms for the assembly of the multisubunit cullin-dependent ubiquitin ligases.", "journal": "Cell", "date": "2004", "authors": "Goldenberg SJ, Cascio TC, Shumway SD, Garbutt KC, Liu J, Xiong Y, Zheng N", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "15537541", "url": "https://glygen.org/publication/PubMed/15537541" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "Different G protein-coupled receptor kinases govern G protein and beta-arrestin-mediated signaling of V2 vasopressin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren XR, Reiter E, Ahn S, Kim J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15671180", "url": "https://glygen.org/publication/PubMed/15671180" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "Functional dissection of an AP-2 beta2 appendage-binding sequence within the autosomal recessive hypercholesterolemia protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Mishra SK, Keyel PA, Edeling MA, Dupin AL, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15728179", "url": "https://glygen.org/publication/PubMed/15728179" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Identification of an intestinal heme transporter.", "journal": "Cell", "date": "2005", "authors": "Shayeghi M, Latunde-Dada GO, Oakhill JS, Laftah AH, Takeuchi K, Halliday N, Khan Y, Warley A, McCann FE, Hider RC, Frazer DM, Anderson GJ, Vulpe CD, Simpson RJ, McKie AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "16143108", "url": "https://glygen.org/publication/PubMed/16143108" } ] }, { "title": "Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.", "journal": "Journal of cell science", "date": "2005", "authors": "Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16159959", "url": "https://glygen.org/publication/PubMed/16159959" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "Identification of a ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells.", "journal": "Nature genetics", "date": "2005", "authors": "Ohgami RS, Campagna DR, Greer EL, Antiochos B, McDonald A, Chen J, Sharp JJ, Fujiwara Y, Barker JE, Fleming MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "16227996", "url": "https://glygen.org/publication/PubMed/16227996" } ] }, { "title": "Recombinant expression and functional characterization of human hephaestin: a multicopper oxidase with ferroxidase activity.", "journal": "Biochemistry", "date": "2005", "authors": "Griffiths TA, Mauk AG, MacGillivray RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "16274220", "url": "https://glygen.org/publication/PubMed/16274220" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "A cell-surface receptor for lipocalin 24p3 selectively mediates apoptosis and iron uptake.", "journal": "Cell", "date": "2005", "authors": "Devireddy LR, Gazin C, Zhu X, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "16377569", "url": "https://glygen.org/publication/PubMed/16377569" } ] }, { "title": "Crystal structure of human iron regulatory protein 1 as cytosolic aconitase.", "journal": "Structure (London, England : 1993)", "date": "2006", "authors": "Dupuy J, Volbeda A, Carpentier P, Darnault C, Moulis JM, Fontecilla-Camps JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "16407072", "url": "https://glygen.org/publication/PubMed/16407072" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.", "journal": "Developmental cell", "date": "2006", "authors": "Diril MK, Wienisch M, Jung N, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16459302", "url": "https://glygen.org/publication/PubMed/16459302" } ] }, { "title": "The structural basis of arrestin-mediated regulation of G-protein-coupled receptors.", "journal": "Pharmacology & therapeutics", "date": "2006", "authors": "Gurevich VV, Gurevich EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16460808", "url": "https://glygen.org/publication/PubMed/16460808" } ] }, { "title": "Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells.", "journal": "American journal of physiology. Lung cellular and molecular physiology", "date": "2006", "authors": "Turi JL, Wang X, McKie AT, Nozik-Grayck E, Mamo LB, Crissman K, Piantadosi CA, Ghio AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "16510471", "url": "https://glygen.org/publication/PubMed/16510471" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "The mechanism of iron release from the transferrin-receptor 1 adduct.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Hemadi M, Ha-Duong NT, El Hage Chahine JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "16564538", "url": "https://glygen.org/publication/PubMed/16564538" } ] }, { "title": "The Steap proteins are metalloreductases.", "journal": "Blood", "date": "2006", "authors": "Ohgami RS, Campagna DR, McDonald A, Fleming MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "16609065", "url": "https://glygen.org/publication/PubMed/16609065" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.", "journal": "Journal of cell science", "date": "2006", "authors": "Schmidt U, Briese S, Leicht K, Schurmann A, Joost HG, Al-Hasani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16723738", "url": "https://glygen.org/publication/PubMed/16723738" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "The crystal structure of iron-free human serum transferrin provides insight into inter-lobe communication and receptor binding.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wally J, Halbrooks PJ, Vonrhein C, Rould MA, Everse SJ, Mason AB, Buchanan SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "16793765", "url": "https://glygen.org/publication/PubMed/16793765" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Downregulation of CD4 by human immunodeficiency virus type 1 Nef is dependent on clathrin and involves direct interaction of Nef with the AP2 clathrin adaptor.", "journal": "Journal of virology", "date": "2007", "authors": "Chaudhuri R, Lindwasser OW, Smith WJ, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17267500", "url": "https://glygen.org/publication/PubMed/17267500" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "The gamma/sigma1 and alpha/sigma2 hemicomplexes of clathrin adaptors AP-1 and AP-2 harbor the dileucine recognition site.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doray B, Lee I, Knisely J, Bu G, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17360967", "url": "https://glygen.org/publication/PubMed/17360967" } ] }, { "title": "Src-dependent phosphorylation of beta2-adaptin dissociates the beta-arrestin-AP-2 complex.", "journal": "Journal of cell science", "date": "2007", "authors": "Fessart D, Simaan M, Zimmerman B, Comeau J, Hamdan FF, Wiseman PW, Bouvier M, Laporte SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17456551", "url": "https://glygen.org/publication/PubMed/17456551" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Clathrin-dependent entry of severe acute respiratory syndrome coronavirus into target cells expressing ACE2 with the cytoplasmic tail deleted.", "journal": "Journal of virology", "date": "2007", "authors": "Inoue Y, Tanaka N, Tanaka Y, Inoue S, Morita K, Zhuang M, Hattori T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17522231", "url": "https://glygen.org/publication/PubMed/17522231" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.", "journal": "Cell", "date": "2007", "authors": "Adachi K, Oiwa K, Nishizaka T, Furuike S, Noji H, Itoh H, Yoshida M, Kinosita K Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "17662945", "url": "https://glygen.org/publication/PubMed/17662945" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "Integrating molecular and network biology to decode endocytosis.", "journal": "Nature", "date": "2007", "authors": "Schmid EM, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17713526", "url": "https://glygen.org/publication/PubMed/17713526" } ] }, { "title": "Non-HFE haemochromatosis.", "journal": "World journal of gastroenterology", "date": "2007", "authors": "Wallace DF, Subramaniam VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "17729390", "url": "https://glygen.org/publication/PubMed/17729390" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "A diacidic motif in human immunodeficiency virus type 1 Nef is a novel determinant of binding to AP-2.", "journal": "Journal of virology", "date": "2008", "authors": "Lindwasser OW, Smith WJ, Chaudhuri R, Yang P, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18032517", "url": "https://glygen.org/publication/PubMed/18032517" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P02787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02787" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "A cloned gene for human transferrin.", "journal": "Ann. N. Y. Acad. Sci.", "date": "1991", "authors": "Hershberger C L, Larson J L, Arnold B, Rosteck P R, Williams P, DeHoff B, Dunn P, O'Neal K L, Riemen M W, Tice P A", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "1809186", "url": "https://glygen.org/publication/PubMed/1809186" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Jung N, Wienisch M, Gu M, Rand JB, Muller SL, Krause G, Jorgensen EM, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18166656", "url": "https://glygen.org/publication/PubMed/18166656" } ] }, { "title": "Functional characterization of human duodenal cytochrome b (Cybrd1): Redox properties in relation to iron and ascorbate metabolism.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Oakhill JS, Marritt SJ, Gareta EG, Cammack R, McKie AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "18194661", "url": "https://glygen.org/publication/PubMed/18194661" } ] }, { "title": "The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "N'Diaye EN, Hanyaloglu AC, Kajihara KK, Puthenveedu MA, Wu P, von Zastrow M, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18199683", "url": "https://glygen.org/publication/PubMed/18199683" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry.", "journal": "Journal of chromatography. B, Analytical technologies in the biomedical and life sciences", "date": "2008", "authors": "Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "title": "Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.", "journal": "Cell", "date": "2008", "authors": "Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18775314", "url": "https://glygen.org/publication/PubMed/18775314" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "The type IV mucolipidosis-associated protein TRPML1 is an endolysosomal iron release channel.", "journal": "Nature", "date": "2008", "authors": "Dong XP, Cheng X, Mills E, Delling M, Wang F, Kurz T, Xu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "18794901", "url": "https://glygen.org/publication/PubMed/18794901" } ] }, { "title": "Role of HRB in clathrin-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chaineau M, Danglot L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18819912", "url": "https://glygen.org/publication/PubMed/18819912" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "A structural explanation for the binding of endocytic dileucine motifs by the AP2 complex.", "journal": "Nature", "date": "2008", "authors": "Kelly BT, McCoy AJ, Spate K, Miller SE, Evans PR, Honing S, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19140243", "url": "https://glygen.org/publication/PubMed/19140243" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Expression and initial characterization of five site-directed mutants of the N-terminal half-molecule of human transferrin.", "journal": "Biochemistry", "date": "1991", "authors": "Woodworth R C, Mason A B, Funk W D, MacGillivray R T", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "1932003", "url": "https://glygen.org/publication/PubMed/1932003" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "A regulated RNA binding protein also possesses aconitase activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Kaptain S, Downey WE, Tang C, Philpott C, Haile D, Orloff DG, Harford JB, Rouault TA, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "1946430", "url": "https://glygen.org/publication/PubMed/1946430" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Chen WJ, Goldstein JL, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1968060", "url": "https://glygen.org/publication/PubMed/1968060" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Endocytosis and signalling: intertwining molecular networks.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Sorkin A, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19696798", "url": "https://glygen.org/publication/PubMed/19696798" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "Stonins--specialized adaptors for synaptic vesicle recycling and beyond?", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Maritzen T, Podufall J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19732400", "url": "https://glygen.org/publication/PubMed/19732400" } ] }, { "title": "Control of iron homeostasis by an iron-regulated ubiquitin ligase.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Vashisht AA, Zumbrennen KB, Huang X, Powers DN, Durazo A, Sun D, Bhaskaran N, Persson A, Uhlen M, Sangfelt O, Spruck C, Leibold EA, Wohlschlegel JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "19762596", "url": "https://glygen.org/publication/PubMed/19762596" } ] }, { "title": "An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Salahudeen AA, Thompson JW, Ruiz JC, Ma HW, Kinch LN, Li Q, Grishin NV, Bruick RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "19762597", "url": "https://glygen.org/publication/PubMed/19762597" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Arrestin development: emerging roles for beta-arrestins in developmental signaling pathways.", "journal": "Developmental cell", "date": "2009", "authors": "Kovacs JJ, Hara MR, Davenport CL, Kim J, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19853559", "url": "https://glygen.org/publication/PubMed/19853559" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "Alpha-AP-2 directs myosin VI-dependent endocytosis of cystic fibrosis transmembrane conductance regulator chloride channels in the intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Collaco A, Jakab R, Hegan P, Mooseker M, Ameen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20351096", "url": "https://glygen.org/publication/PubMed/20351096" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "A mammalian siderophore synthesized by an enzyme with a bacterial homolog involved in enterobactin production.", "journal": "Cell", "date": "2010", "authors": "Devireddy LR, Hart DO, Goetz DH, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "20550936", "url": "https://glygen.org/publication/PubMed/20550936" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.", "journal": "The EMBO journal", "date": "2011", "authors": "Granata A, Koo SJ, Haucke V, Schiavo G, Warner TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21102408", "url": "https://glygen.org/publication/PubMed/21102408" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "Detection of multiple forms of human ceruloplasmin. A novel Mr 200,000 form.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Sato M, Schilsky ML, Stockert RJ, Morell AG, Sternlieb I", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "2154449", "url": "https://glygen.org/publication/PubMed/2154449" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Biochemical journal", "date": "2012", "authors": "Fu L, Rab A, Tang LP, Rowe SM, Bebok Z, Collawn JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21995445", "url": "https://glygen.org/publication/PubMed/21995445" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.", "journal": "Cell", "date": "2011", "authors": "Miller SE, Sahlender DA, Graham SC, Honing S, Robinson MS, Peden AA, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22118466", "url": "https://glygen.org/publication/PubMed/22118466" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "Structural basis for iron piracy by pathogenic Neisseria.", "journal": "Nature", "date": "2012", "authors": "Noinaj N, Easley NC, Oke M, Mizuno N, Gumbart J, Boura E, Steere AN, Zak O, Aisen P, Tajkhorshid E, Evans RW, Gorringe AR, Mason AB, Steven AC, Buchanan SK", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "22327295", "url": "https://glygen.org/publication/PubMed/22327295" } ] }, { "title": "The structural basis of transferrin sequestration by transferrin-binding protein B.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Calmettes C, Alcantara J, Yu RH, Schryvers AB, Moraes TF", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "22343719", "url": "https://glygen.org/publication/PubMed/22343719" } ] }, { "title": "The role of ubiquitylation in receptor endocytosis and endosomal sorting.", "journal": "Journal of cell science", "date": "2012", "authors": "Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22357968", "url": "https://glygen.org/publication/PubMed/22357968" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Transferrin receptor internalization sequence YXRF implicates a tight turn as the structural recognition motif for endocytosis.", "journal": "Cell", "date": "1990", "authors": "Collawn JF, Stangel M, Kuhn LA, Esekogwu V, Jing SQ, Trowbridge IS, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2257624", "url": "https://glygen.org/publication/PubMed/2257624" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "Resveratrol-induced changes of the human adipocyte secretion profile.", "journal": "J. Proteome Res.", "date": "2012", "authors": "Rosenow Anja, Noben Jean-Paul, Jocken Johan, Kallendrusch Sonja, Fischer-Posovszky Pamela, Mariman Edwin C M, Renes Johan", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "22905912", "url": "https://glygen.org/publication/PubMed/22905912" } ] }, { "title": "The epsin protein family: coordinators of endocytosis and signaling.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Sen A, Madhivanan K, Mukherjee D, Aguilar RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22942912", "url": "https://glygen.org/publication/PubMed/22942912" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "Proteomic analysis and abrogated expression of O-GlcNAcylated proteins associated with primary breast cancer.", "journal": "Proteomics", "date": "2013", "authors": "Champattanachai V, Netsirisawan P, Chaiyawat P, Phueaouan T, Charoenwattanasatien R, Chokchaichamnankit D, Punyarit P, Srisomsap C, Svasti J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02787", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02787" } ], "reference": [ { "type": "PubMed", "id": "23576270", "url": "https://glygen.org/publication/PubMed/23576270" } ] }, { "title": "Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Haunhorst P, Hanschmann EM, Brautigam L, Stehling O, Hoffmann B, Muhlenhoff U, Lill R, Berndt C, Lillig CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "23615448", "url": "https://glygen.org/publication/PubMed/23615448" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Ubiquitin-dependent sorting in endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Piper RC, Dikic I, Lukacs GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24384571", "url": "https://glygen.org/publication/PubMed/24384571" } ] }, { "title": "Glycomic analysis of high density lipoprotein shows a highly sialylated particle.", "journal": "Journal of proteome research", "date": "2014", "authors": "Huang J, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "24417605", "url": "https://glygen.org/publication/PubMed/24417605" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "Role of beta-arrestins and arrestin domain-containing proteins in G protein-coupled receptor trafficking.", "journal": "Current opinion in cell biology", "date": "2014", "authors": "Kang DS, Tian X, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24680432", "url": "https://glygen.org/publication/PubMed/24680432" } ] }, { "title": "Regulation of clathrin-mediated endocytosis by dynamic ubiquitination and deubiquitination.", "journal": "Current biology : CB", "date": "2014", "authors": "Weinberg JS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24746795", "url": "https://glygen.org/publication/PubMed/24746795" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Structural change of N-glycan exposes hydrophobic surface of human transferrin.", "journal": "Glycobiology", "date": "2014", "authors": "Nagae M, Morita-Matsumoto K, Arai S, Wada I, Matsumoto Y, Saito K, Hashimoto Y, Yamaguchi Y", "evidence": [ { "database": "Automatic Literature Mining", "id": "24780636", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/24780636" } ], "reference": [ { "type": "PubMed", "id": "24780636", "url": "https://glygen.org/publication/PubMed/24780636" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "Confident assignment of site-specific glycosylation in complex glycoproteins in a single step.", "journal": "Journal of proteome research", "date": "2014", "authors": "Khatri K, Staples GO, Leymarie N, Leon DR, Turiak L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "25153361", "url": "https://glygen.org/publication/PubMed/25153361" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "In situ visualization of a glycoform of transferrin: localization of alpha2,6-sialylated transferrin in the liver.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Matsumoto Y, Saito T, Hoshi K, Ito H, Kariya Y, Nagae M, Yamaguchi Y, Hagiwara Y, Kinoshita N, Wada I, Saito K, Honda T, Hashimoto Y", "evidence": [ { "database": "Automatic Literature Mining", "id": "25425657", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25425657" } ], "reference": [ { "type": "PubMed", "id": "25425657", "url": "https://glygen.org/publication/PubMed/25425657" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P02787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02787" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "beta-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.", "journal": "Nature cell biology", "date": "2016", "authors": "Eichel K, Jullie D, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "26829388", "url": "https://glygen.org/publication/PubMed/26829388" } ] }, { "title": "Changes in brain gene expression shared by scrapie and Alzheimer disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Duguid J R, Bohmont C W, Liu N G, Tourtellotte W W", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "2780570", "url": "https://glygen.org/publication/PubMed/2780570" } ] }, { "title": "Clathrin assembly proteins: affinity purification and a model for coat assembly.", "journal": "The Journal of cell biology", "date": "1987", "authors": "Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2890644", "url": "https://glygen.org/publication/PubMed/2890644" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Quantitative analysis of core fucosylation of serum proteins in liver diseases by LC-MS-MRM.", "journal": "Journal of proteomics", "date": "2018", "authors": "Ma J, Sanda M, Wei R, Zhang L, Goldman R", "evidence": [ { "database": "Automatic Literature Mining", "id": "29427759", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" } ], "reference": [ { "type": "PubMed", "id": "29427759", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum.", "journal": "Proteomics. Clinical applications", "date": "2018", "authors": "Saraswat M, Makitie A, Tohmola T, Dickinson A, Saraswat S, Joenvaara S, Renkonen S", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "29992770", "url": "https://glygen.org/publication/PubMed/29992770" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02787", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02787" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "The human transferrin gene: 5' region contains conserved sequences which match the control elements regulated by heavy metals, glucocorticoids and acute phase reaction.", "journal": "Gene", "date": "1986", "authors": "Adrian G S, Korinek B W, Bowman B H, Yang F", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "3106157", "url": "https://glygen.org/publication/PubMed/3106157" } ] }, { "title": "A Novel Mass Spectrometry Platform for Multiplexed N-Glycoprotein Biomarker Discovery from Patient Biofluids by Antibody Panel Based N-Glycan Imaging.", "journal": "Analytical chemistry", "date": "2019-07-02", "authors": "Black Alyson P, Liang Hongyan, West Connor A, Wang Mengjun, Herrera Harmin P, Haab Brian B, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31177770", "url": "https://glygen.org/publication/PubMed/31177770" } ] }, { "title": "Structure of the trypanosome transferrin receptor reveals mechanisms of ligand recognition and immune evasion.", "journal": "Nature microbiology", "date": "2019-12", "authors": "Trevor Camilla E, Gonzalez-Munoz Andrea L, Macleod Olivia J S, Woodcock Peter G, Rust Steven, Vaughan Tristan J, Garman Elspeth F, Minter Ralph, Carrington Mark, Higgins Matthew K", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787#ptm_processing" }, { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "31636418", "url": "https://glygen.org/publication/PubMed/31636418" } ] }, { "title": "Antibody Panel Based N-Glycan Imaging for N-Glycoprotein Biomarker Discovery.", "journal": "Current protocols in protein science", "date": "2019-12", "authors": "Black Alyson P, Angel Peggi M, Drake Richard R, Mehta Anand S", "evidence": [ { "database": "GlyGen", "id": "A0245", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "31721442", "url": "https://glygen.org/publication/PubMed/31721442" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Aberrant sialylation in a patient with a HNF1alpha variant and liver adenomatosis.", "journal": "iScience", "date": "2021", "authors": "Sturiale L, Nassogne MC, Palmigiano A, Messina A, Speciale I, Artuso R, Bertino G, Revencu N, Stephenne X, De Castro C, Matthijs G, Barone R, Jaeken J, Garozzo D", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "33889819", "url": "https://glygen.org/publication/PubMed/33889819" } ] }, { "title": "Deep-etch visualization of proteins involved in clathrin assembly.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Heuser JE, Keen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "3417785", "url": "https://glygen.org/publication/PubMed/3417785" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Complete structure of the human transferrin gene. Comparison with analogous chicken gene and human pseudogene.", "journal": "Gene", "date": "1987", "authors": "Schaeffer E, Lucero M A, Jeltsch J M, Py M C, Levin M J, Chambon P, Cohen G N, Zakin M M", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "3678832", "url": "https://glygen.org/publication/PubMed/3678832" } ] }, { "title": "The hepatic niche leads to aggressive natural killer cell leukemia proliferation through the transferrin-transferrin receptor 1 axis.", "journal": "Blood", "date": "2023-07-27", "authors": "Kameda Kazuaki, Yanagiya Ryo, Miyatake Yuji, Carreras Joaquim, Higuchi Hiroshi, Murayama Hiromichi, Ishida Takashi, Ito Asahi, Iida Shinsuke, Fukuhara Noriko, Harigae Hideo, Fujioka Yuki, Takahashi Naoto, Wada Hidenori, Ishida Fumihiro, Nakazawa Hideyuki, Ishihara Rei, Murakami Yuki, Tagawa Hiroyuki, Matsuura Tadashi, Nakagawa So, Iwabuchi Sadahiro, Hashimoto Shinichi, Imadome Ken-Ichi, Nakamura Naoya, Ishizawa Kenichi, Kanda Yoshinobu, Ando Kiyoshi, Kotani Ai", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ], "reference": [ { "type": "PubMed", "id": "37146246", "url": "https://glygen.org/publication/PubMed/37146246" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02787", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02787" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Macromolecular Crowding Promotes Re-entrant Liquid-Liquid Phase Separation of Human Serum Transferrin and Prevents Surface-Induced Fibrillation.", "journal": "Biomacromolecules", "date": "2023-08-14", "authors": "Patel Chinmaya Kumar, Rani Chanchal, Kumar Rajesh, Mukherjee Tushar Kanti", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ], "reference": [ { "type": "PubMed", "id": "37503577", "url": "https://glygen.org/publication/PubMed/37503577" } ] }, { "title": "Transferrin promotes chondrogenic differentiation in condylar growth through inducing autophagy via ULK1-ATG16L1 axis.", "journal": "Clinical science (London, England : 1979)", "date": "2023-09-27", "authors": "Wen Xi, Wang Yixiang, Gu Yan", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ], "reference": [ { "type": "PubMed", "id": "37694282", "url": "https://glygen.org/publication/PubMed/37694282" } ] }, { "title": "The 5' region of the human transferrin gene: structure and potential regulatory sites.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Lucero M A, Schaeffer E, Cohen G N, Zakin M M", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "3786138", "url": "https://glygen.org/publication/PubMed/3786138" } ] }, { "title": "Height of non-Hispanic white adults with homeostatic iron regulator HFE genotypes p.C282Y/p.C282Y and wt/wt.", "journal": "Molecular genetics & genomic medicine", "date": "2023-11-06", "authors": "Barton James C, Barton J Clayborn, Acton Ronald T", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ], "reference": [ { "type": "PubMed", "id": "37930135", "url": "https://glygen.org/publication/PubMed/37930135" } ] }, { "title": "Meconium Transferrin and Ferritin as Markers of Homeostasis in the Developing Fetus.", "journal": "International journal of molecular sciences", "date": "2023-11-03", "authors": "Skar\u017cy\u0144ska Ewa, Mularczyk Klaudia, Issat Tadeusz, Jakimiuk Artur, Lisowska-Myjak Barbara", "evidence": [ { "database": "RefSeq", "id": "NP_001054", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001054" } ], "reference": [ { "type": "PubMed", "id": "37958917", "url": "https://glygen.org/publication/PubMed/37958917" } ] }, { "title": "Organization of the human transferrin gene: direct evidence that it originated by gene duplication.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Park I, Schaeffer E, Sidoli A, Baralle F E, Cohen G N, Zakin M M", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "3858812", "url": "https://glygen.org/publication/PubMed/3858812" } ] }, { "title": "Morphologic characterization of the pathway of transferrin endocytosis and recycling in human KB cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Willingham MC, Hanover JA, Dickson RB, Pastan I", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "6141558", "url": "https://glygen.org/publication/PubMed/6141558" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "Receptor-mediated endocytosis of transferrin and recycling of the transferrin receptor in rat reticulocytes.", "journal": "The Journal of cell biology", "date": "1983", "authors": "Harding C, Heuser J, Stahl P", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "6309857", "url": "https://glygen.org/publication/PubMed/6309857" } ] }, { "title": "Molecular cloning and sequence analysis of cDNA for human transferrin.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1984", "authors": "Uzan G, Frain M, Park I, Besmond C, Maessen G, Tr\u00e9pat J S, Zakin M M, Kahn A", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "6322780", "url": "https://glygen.org/publication/PubMed/6322780" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Human transferrin: cDNA characterization and chromosomal localization.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1984", "authors": "Yang F, Lum J B, McGill J R, Moore C M, Naylor S L, van Bragt P H, Baldwin W D, Bowman B H", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "6585826", "url": "https://glygen.org/publication/PubMed/6585826" } ] }, { "title": "The primary structure of human serum transferrin. The structures of seven cyanogen bromide fragments and the assembly of the complete structure.", "journal": "J. Biol. Chem.", "date": "1983", "authors": "MacGillivray R T, Mendez E, Shewale J G, Sinha S K, Lineback-Zins J, Brew K", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "6833213", "url": "https://glygen.org/publication/PubMed/6833213" } ] }, { "title": "The complete amino acid sequence of human serum transferrin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1982", "authors": "MacGillivray R T, Mendez E, Sinha S K, Sutton M R, Lineback-Zins J, Brew K", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "6953407", "url": "https://glygen.org/publication/PubMed/6953407" } ] }, { "title": "The major protein expression profile and two-dimensional protein database of human heart.", "journal": "Electrophoresis", "date": "1995", "authors": "Kovalyov L I, Shishkin S S, Efimochkin A S, Kovalyova M A, Ershova E S, Egorov T A, Musalyamov A K", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "7498159", "url": "https://glygen.org/publication/PubMed/7498159" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Interaction of tyrosine-based sorting signals with clathrin-associated proteins.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Ohno H, Stewart J, Fournier MC, Bosshart H, Rhee I, Miyatake S, Saito T, Gallusser A, Kirchhausen T, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7569928", "url": "https://glygen.org/publication/PubMed/7569928" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Arrestin interactions with G protein-coupled receptors. Direct binding studies of wild type and mutant arrestins with rhodopsin, beta 2-adrenergic, and m2 muscarinic cholinergic receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gurevich VV, Dion SB, Onorato JJ, Ptasienski J, Kim CM, Sterne-Marr R, Hosey MM, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7822302", "url": "https://glygen.org/publication/PubMed/7822302" } ] }, { "title": "'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid.", "journal": "FEBS letters", "date": "1995", "authors": "Hoffmann A, Nimtz M, Getzlaff R, Conradt HS", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "7867791", "url": "https://glygen.org/publication/PubMed/7867791" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "Carbohydrate deficient glycoprotein syndrome type II: a deficiency in Golgi localised N-acetyl-glucosaminyltransferase II.", "journal": "Archives of disease in childhood", "date": "1994", "authors": "Jaeken J, Schachter H, Carchon H, De Cock P, Coddeville B, Spik G", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "7944531", "url": "https://glygen.org/publication/PubMed/7944531" } ] }, { "title": "Molecular characterization of a second iron-responsive element binding protein, iron regulatory protein 2. Structure, function, and post-translational regulation.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Samaniego F, Chin J, Iwai K, Rouault TA, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "7983023", "url": "https://glygen.org/publication/PubMed/7983023" } ] }, { "title": "The bifunctional iron-responsive element binding protein/cytosolic aconitase: the role of active-site residues in ligand binding and regulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Philpott CC, Klausner RD, Rouault TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "8041788", "url": "https://glygen.org/publication/PubMed/8041788" } ] }, { "title": "Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1994", "authors": "Matsumoto K, Maeda Y, Kato S, Yuki H", "evidence": [ { "database": "UniCarbKB", "id": "P02787", "url": "" }, { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "8174273", "url": "https://glygen.org/publication/PubMed/8174273" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Role of beta-arrestin in mediating agonist-promoted G protein-coupled receptor internalization.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Ferguson SS, Downey WE 3rd, Colapietro AM, Barak LS, Menard L, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8553074", "url": "https://glygen.org/publication/PubMed/8553074" } ] }, { "title": "The ferritins: molecular properties, iron storage function and cellular regulation.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Harrison PM, Arosio P", "evidence": [ { "database": "Reactome", "id": "R-HSA-917937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937" } ], "reference": [ { "type": "PubMed", "id": "8695634", "url": "https://glygen.org/publication/PubMed/8695634" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Beta-arrestin acts as a clathrin adaptor in endocytosis of the beta2-adrenergic receptor.", "journal": "Nature", "date": "1996", "authors": "Goodman OB Jr, Krupnick JG, Santini F, Gurevich VV, Penn RB, Gagnon AW, Keen JH, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8837779", "url": "https://glygen.org/publication/PubMed/8837779" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "Arrestin/clathrin interaction. Localization of the arrestin binding locus to the clathrin terminal domain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Goodman OB Jr, Krupnick JG, Gurevich VV, Benovic JL, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9169477", "url": "https://glygen.org/publication/PubMed/9169477" } ] }, { "title": "Human transferrin (Tf): a single mutation at codon 570 determines Tf C1 or Tf C2 variant.", "journal": "Human genetics", "date": "1997", "authors": "Namekata K, Oyama F, Imagawa M, Ihara Y", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "9272172", "url": "https://glygen.org/publication/PubMed/9272172" } ] }, { "title": "Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.", "journal": "Genes & development", "date": "1997", "authors": "Salcini AE, Confalonieri S, Doria M, Santolini E, Tassi E, Minenkova O, Cesareni G, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9303539", "url": "https://glygen.org/publication/PubMed/9303539" } ] }, { "title": "Exon/intron structure of the human transferrin receptor gene.", "journal": "Gene", "date": "1997", "authors": "Evans P, Kemp J", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "9358047", "url": "https://glygen.org/publication/PubMed/9358047" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "The hemochromatosis gene product complexes with the transferrin receptor and lowers its affinity for ligand binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Feder JN, Penny DM, Irrinki A, Lee VK, Lebron JA, Watson N, Tsuchihashi Z, Sigal E, Bjorkman PJ, Schatzman RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-917977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977" } ], "reference": [ { "type": "PubMed", "id": "9465039", "url": "https://glygen.org/publication/PubMed/9465039" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Two high-resolution crystal structures of the recombinant N-lobe of human transferrin reveal a structural change implicated in iron release.", "journal": "Biochemistry", "date": "1998", "authors": "MacGillivray R T, Moore S A, Chen J, Anderson B F, Baker H, Luo Y, Bewley M, Smith C A, Murphy M E, Wang Y, Mason A B, Woodworth R C, Brayer G D, Baker E N", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "9609685", "url": "https://glygen.org/publication/PubMed/9609685" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Two-dimensional chromatography in the analysis of complex glycans from transferrin.", "journal": "Analytical chemistry", "date": "1998", "authors": "Charlwood J, Birrell H, Tolson D, Camilleri P", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "9666724", "url": "https://glygen.org/publication/PubMed/9666724" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.", "journal": "Nature", "date": "1998", "authors": "Chen H, Fre S, Slepnev VI, Capua MR, Takei K, Butler MH, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9723620", "url": "https://glygen.org/publication/PubMed/9723620" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy.", "journal": "Glycobiology", "date": "1998", "authors": "van Rooijen JJ, Jeschke U, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "558", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "reference": [ { "type": "PubMed", "id": "9751792", "url": "https://glygen.org/publication/PubMed/9751792" } ] }, { "title": "Ligand-induced conformational change in transferrins: crystal structure of the open form of the N-terminal half-molecule of human transferrin.", "journal": "Biochemistry", "date": "1998", "authors": "Jeffrey P D, Bewley M C, MacGillivray R T, Mason A B, Woodworth R C, Baker E N", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "9760232", "url": "https://glygen.org/publication/PubMed/9760232" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Identification of a mutation (A1879G) of transferrin from cDNA prepared from peripheral blood cells.", "journal": "Annals of human genetics", "date": "1998", "authors": "Pang H, Koda Y, Soejima M, Kimura H", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "reference": [ { "type": "PubMed", "id": "9803271", "url": "https://glygen.org/publication/PubMed/9803271" } ] }, { "title": "A structural explanation for the recognition of tyrosine-based endocytotic signals.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Owen DJ, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9812899", "url": "https://glygen.org/publication/PubMed/9812899" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] } ], "pathway": [ { "id": "hsa:7018", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7018", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-917937", "name": "Iron uptake and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917937", "resource": "Reactome", "description": "Iron uptake and transport" }, { "id": "R-HSA-917977", "name": "Transferrin endocytosis and recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-917977", "resource": "Reactome", "description": "Transferrin endocytosis and recycling" } ], "orthologs": [ { "uniprot_canonical_ac": "P12346-1", "protein_name": "Serotransferrin", "gene_name": "Tf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVKKTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEFYGSLEHPQTHYLAVAVVKKGTDFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLPEPRKPLEKAVASFFSGSCVPCADPVAFPQLCQLCPGCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTIFEVLPQKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSKDFQLFGSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPVKWCALSHQERAKCDEWSVSSNGQIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQCGLVPVMAENYDISSCTNPQSDVFPKGYYAVAVVKASDSSINWNNLKGKKSCHTGVDRTAGWNIPMGLLFSRINHCKFDEFFSQGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAFQCLVEKGDVAFVKHQTVLENTNGKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQAPNHVVVSRKEKAARVSTVLTAQKDLFWKGDKDCTGNFCLFRSSTKDLLFRDDTKCLTKLPEGTTYEEYLGAEYLQAVGNIRKCSTSRLLEACTFHKS", "length": 698 }, "evidence": [ { "id": "45918145", "url": "http://www.informatics.jax.org/homology/45918145", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q921I1-1", "protein_name": "Serotransferrin", "gene_name": "Tf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDLIWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKIVNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASDTSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQEDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTGNFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTFHKH", "length": 697 }, "evidence": [ { "id": "45918145", "url": "http://www.informatics.jax.org/homology/45918145", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 22, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "clathrin-coated pit", "id": "GO:0005905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005905", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "basal part of cell", "id": "GO:0045178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045178", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle membrane", "id": "GO:0030669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030669", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "basal plasma membrane", "id": "GO:0009925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009925", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "HFE-transferrin receptor complex", "id": "GO:1990712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990712", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "osteoclast differentiation", "id": "GO:0030316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "intracellular iron ion homeostasis", "id": "GO:0006879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "positive regulation of bone resorption", "id": "GO:0045780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045780", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "regulation of protein stability", "id": "GO:0031647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031647", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "SMAD protein signal transduction", "id": "GO:0060395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060395", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "cellular response to iron ion", "id": "GO:0071281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071281", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "positive regulation of cell motility", "id": "GO:2000147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000147", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "iron ion transport", "id": "GO:0006826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006826", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "regulation of iron ion transport", "id": "GO:0034756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034756", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ferrous iron binding", "id": "GO:0008198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008198", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "iron chaperone activity", "id": "GO:0034986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034986", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "transferrin receptor binding", "id": "GO:1990459", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990459", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" }, { "name": "ferric iron binding", "id": "GO:0008199", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008199", "evidence": [ { "database": "UniProtKB", "id": "P02787", "url": "https://www.uniprot.org/uniprot/P02787" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "serotransferrin N-glycosylated 1 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24841998, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000052997", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052997" } ] }, { "name": "serotransferrin N-glycosylated 2 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G04055MU. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G04055MU. [PRO:DNx, PMID:24841998]", "evidence": [ { "id": "PR:000052998", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052998" } ] }, { "name": "serotransferrin N-glycosylated 3 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000052999", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052999" } ] }, { "name": "serotransferrin N-glycosylated 4 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053000", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053000" } ] }, { "name": "serotransferrin N-glycosylated 5 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053001", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053001" } ] }, { "name": "serotransferrin N-glycosylated 6 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G17168RO. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G17168RO. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053002", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053002" } ] }, { "name": "serotransferrin N-glycosylated 7 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053003", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053003" } ] }, { "name": "serotransferrin N-glycosylated 8 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G25520XG. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G25520XG. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053004", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053004" } ] }, { "name": "serotransferrin N-glycosylated 9 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053005", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053005" } ] }, { "name": "serotransferrin N-glycosylated 10 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G31852PQ. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G31852PQ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053006", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053006" } ] }, { "name": "serotransferrin N-glycosylated 11 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G36131WL. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G36131WL. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053007", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053007" } ] }, { "name": "serotransferrin N-glycosylated 12 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053008", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053008" } ] }, { "name": "serotransferrin N-glycosylated 13 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053009", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053009" } ] }, { "name": "serotransferrin N-glycosylated 14 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053010", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053010" } ] }, { "name": "serotransferrin N-glycosylated 15 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G50143PC. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G50143PC. [PRO:DNx, PMID:24841998]", "evidence": [ { "id": "PR:000053011", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053011" } ] }, { "name": "serotransferrin N-glycosylated 16 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G50210FA. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G50210FA. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053012", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053012" } ] }, { "name": "serotransferrin N-glycosylated 17 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053013", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053013" } ] }, { "name": "serotransferrin N-glycosylated 18 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053014", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053014" } ] }, { "name": "serotransferrin N-glycosylated 19 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053015", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053015" } ] }, { "name": "serotransferrin N-glycosylated 20 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G87418CY. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G87418CY. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053016", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053016" } ] }, { "name": "serotransferrin N-glycosylated 21 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053017", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053017" } ] }, { "name": "serotransferrin N-glycosylated 22 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G89877QI. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G89877QI. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053018", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053018" } ] }, { "name": "serotransferrin N-glycosylated 23 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-432 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G99679NM. Example: UniProtKB:P02787-1, Asn-432, MOD:00160~GNO:G99679NM. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053019", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053019" } ] }, { "name": "serotransferrin N-glycosylated 24 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-491 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P02787-1, Asn-491, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053020", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053020" } ] }, { "name": "serotransferrin N-glycosylated 25 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24841998, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000053021", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053021" } ] }, { "name": "serotransferrin N-glycosylated 26 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G04909DG. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G04909DG. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053022", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053022" } ] }, { "name": "serotransferrin N-glycosylated 27 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000053023", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053023" } ] }, { "name": "serotransferrin N-glycosylated 28 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G08146BT. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G08146BT. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053024", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053024" } ] }, { "name": "serotransferrin N-glycosylated 29 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053025", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053025" } ] }, { "name": "serotransferrin N-glycosylated 30 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G10486CT. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G10486CT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053026", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053026" } ] }, { "name": "serotransferrin N-glycosylated 31 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G17168RO. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G17168RO. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053027", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053027" } ] }, { "name": "serotransferrin N-glycosylated 32 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000053028", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053028" } ] }, { "name": "serotransferrin N-glycosylated 33 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G25520XG. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G25520XG. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053029", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053029" } ] }, { "name": "serotransferrin N-glycosylated 34 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053030", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053030" } ] }, { "name": "serotransferrin N-glycosylated 35 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053031", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053031" } ] }, { "name": "serotransferrin N-glycosylated 36 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053032", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053032" } ] }, { "name": "serotransferrin N-glycosylated 37 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G50210FA. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G50210FA. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053033", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053033" } ] }, { "name": "serotransferrin N-glycosylated 38 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G59297UK. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G59297UK. [PRO:DNx, PMID:15536627]", "evidence": [ { "id": "PR:000053034", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053034" } ] }, { "name": "serotransferrin N-glycosylated 39 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053035", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053035" } ] }, { "name": "serotransferrin N-glycosylated 40 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053036", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053036" } ] }, { "name": "serotransferrin N-glycosylated 41 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G84467IZ. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G84467IZ. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053037", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053037" } ] }, { "name": "serotransferrin N-glycosylated 42 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053038", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053038" } ] }, { "name": "serotransferrin N-glycosylated 43 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G87418CY. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G87418CY. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053039", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053039" } ] }, { "name": "serotransferrin N-glycosylated 44 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053040", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053040" } ] }, { "name": "serotransferrin N-glycosylated 45 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan structure is represented by GlyTouCan:G89877QI. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G89877QI. [PRO:DNx, PMID:10029548, PMID:10929010, PMID:1456441, PMID:7944531, PMID:8174273]", "evidence": [ { "id": "PR:000053041", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053041" } ] }, { "name": "serotransferrin N-glycosylated 46 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-630 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P02787-1, Asn-630, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000053042", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053042" } ] }, { "name": "serotransferrin N-glycosylated 47 (human)", "definition": "A serotransferrin (human) that has been N-glycosylated at the residue equivalent to Asn-637 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02787-1, Asn-637, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000053043", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053043" } ] }, { "name": "serotransferrin O-glycosylated 1 (human)", "definition": "A serotransferrin (human) that has been O-glycosylated at the residue equivalent to Ser-409 of the amino acid sequence represented by UniProtKB:P02787-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02787-1, Ser-409, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000053044", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000053044" } ] } ], "site_annotation": [ { "start_pos": 432, "end_pos": 434, "annotation": "n_glycosylation_sequon" }, { "start_pos": 630, "end_pos": 632, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Glyco-typer 50 N-glycan liver disease panel", "biomarker_id": "A0245", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" } ], "instances": [ { "best_biomarker_type": "monitoring", "status": "MALDI-MS measured N-glycans", "disease": { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000737", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000737" }, { "id": "31721442", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31721442" }, { "id": "31177770", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31177770" }, { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 432, 491, 523, 630, 637 ], "o_linked_sites": [ 51, 409 ], "snv_sites": [ 66, 75, 273, 452, 482 ], "glycation_sites": [], "phosphorylation_sites": [ 389, 536, 685 ], "sequon_annotation_sites": [ { "start_pos": 432, "end_pos": 434 }, { "start_pos": 630, "end_pos": 632 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 231 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 152 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 226 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 152 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 379 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }