{ "uniprot_canonical_ac": "P02774-1", "uniprot_ac": "P02774", "uniprot_id": "VTDB_HUMAN", "mass": { "chemical_mass": 52918.0, "monoisotopic_mass": 52918.0 }, "refseq": { "ac": "NP_000574", "name": "vitamin D-binding protein isoform 1 precursor", "summary": "The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, "gene_names": [ { "name": "GC", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02774", "id": "P02774" }, { "name": "DBP; DBP-maf; DBP/GC; Gc-MAF; GcMAF; GRD3; HEL-S-51; VDB; VDBG; VDBP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574", "id": "NP_000574" }, { "name": "GC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574", "id": "NP_000574" } ], "protein_names": [ { "name": "Vitamin D-binding protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02774" }, { "name": "DBP-maf", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "DBP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Gc protein-derived macrophage activating factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Gc-MAF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Gc-globulin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "GcMAF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Gc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Group-specific component", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "VDB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "Vitamin D-binding protein-macrophage activating factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02774" }, { "name": "vitamin D-binding alpha-globulin; epididymis secretory protein Li 51; vitamin D-binding protein; gc-globulin; gc protein-derived macrophage activating factor; vitamin D-binding protein-macrophage activating factor; group-specific component (vitamin D binding protein)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574", "id": "NP_000574" }, { "name": "vitamin D-binding protein isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574", "id": "NP_000574" } ], "function": [ { "annotation": "Association of Single Nucleotide Polymorphism in VDR, GC Globulin and CYP2R1 with the Risk of Esophageal Cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, { "database": "PubMed", "id": "37898838", "url": "https://glygen.org/publication/PubMed/37898838" } ] }, { "annotation": "Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774#function" }, { "database": "PubMed", "id": "16302727", "url": "https://glygen.org/publication/PubMed/16302727" }, { "database": "UniProtKB", "id": "D6RF35", "url": "https://www.uniprot.org/uniprot/D6RF35#function" }, { "database": "UniProtKB", "id": "ARBA00002354", "url": "https://www.uniprot.org/uniprot/ARBA00002354#function" }, { "database": "UniProtKB", "id": "D6RBJ7", "url": "https://www.uniprot.org/uniprot/D6RBJ7#function" }, { "database": "UniProtKB", "id": "D6RF20", "url": "https://www.uniprot.org/uniprot/D6RF20#function" } ] }, { "annotation": "Single nucleotide polymorphisms in vitamin D binding protein and 25-hydroxylase genes affect vitamin D levels in adolescents of Arab ethnicity in Kuwait. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, { "database": "PubMed", "id": "37929021", "url": "https://glygen.org/publication/PubMed/37929021" } ] }, { "annotation": "The Molecular Aspects of Functional Activity of Macrophage-Activating Factor GcMAF. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, { "database": "PubMed", "id": "38139225", "url": "https://glygen.org/publication/PubMed/38139225" } ] }, { "annotation": "The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ] }, { "annotation": "The role of free vitamin D and vitamin D binding protein in SARS-Cov-2 infection in children.", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, { "database": "PubMed", "id": "37888613", "url": "https://glygen.org/publication/PubMed/37888613" } ] }, { "annotation": "Vitamin D receptor rs3782905 and vitamin D binding protein rs7041 polymorphisms are associated with hepatocellular carcinoma susceptibility in cirrhotic HCV patients. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" }, { "database": "PubMed", "id": "38066559", "url": "https://glygen.org/publication/PubMed/38066559" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P02774", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 159, "end_pos": 159, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "F", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NQF->NQS).", "chr_id": "4", "chr_pos": "71763934", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "F159", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02774", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 177, "end_pos": 177, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SYT->NYT).", "chr_id": "4", "chr_pos": "71763880", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S177", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs111261486", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs111261486" }, { "id": "rs111261486", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs111261486" }, { "id": "rs111261486", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs111261486#frequency_tab" }, { "id": "rs111261486", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs111261486" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 229, "end_pos": 229, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "4", "chr_pos": "71763422", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K229", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769811509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769811509" }, { "id": "rs769811509", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769811509" }, { "id": "rs769811509", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769811509" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 237, "end_pos": 237, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLI->NLT).", "chr_id": "4", "chr_pos": "71758163", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I237", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1481346316", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1481346316" }, { "id": "rs1481346316", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1481346316" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 257, "end_pos": 257, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DIT->NIT).", "chr_id": "4", "chr_pos": "71758104", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D257", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs41265647", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs41265647" }, { "id": "rs41265647", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs41265647" }, { "id": "rs41265647", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs41265647" }, { "id": "rs41265647", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs41265647#frequency_tab" }, { "id": "rs41265647", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs41265647" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 288, "end_pos": 288, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "4", "chr_pos": "71756884", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N288", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs986796507", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs986796507" }, { "id": "rs986796507", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs986796507" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 288, "end_pos": 288, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "4", "chr_pos": "71756882", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N288", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs777355457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777355457" }, { "id": "rs777355457", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs777355457" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 290, "end_pos": 290, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLY).", "chr_id": "4", "chr_pos": "71756877", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S290", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1191540980", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1191540980" }, { "id": "rs1191540980", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1191540980" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 292, "end_pos": 292, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KNS->NNS).", "chr_id": "4", "chr_pos": "71756870", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P02774", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774" }, { "id": "rs756735854", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756735854" }, { "id": "rs756735854", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756735854" }, { "id": "rs756735854", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756735854#frequency_tab" }, { "id": "rs756735854", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756735854" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 39, "end_pos": 39, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DFT->NFT).", "chr_id": "4", "chr_pos": "71769344", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D39", "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P02774", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 416, "end_pos": 416, "subjects_tested": "87", "subjects_positive": "1", "frequency": "1.1", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%). In dbSNP: rs140591638.", "chr_id": "4", "chr_pos": "71754426", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T416", "disease": [ { "disease_id": "DOID:1790", "recommended_name": { "id": "DOID:1790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1790", "name": "malignant mesothelioma", "description": "A cell type cancer that has_material_basis_in mesothelial tissue that develops from the thin layer of tissue that covers many of the internal organs." }, "synonyms": [ { "id": "DOID:1790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1790", "name": "Diffuse malignant Mesothelioma", "description": "" }, { "id": "DOID:1790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1790", "name": "advanced malignant mesothelioma", "description": "" }, { "id": "DOID:1790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1790", "name": "asbestos-related malignant mesothelioma", "description": "" }, { "id": "DOID:1790", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1790", "name": "malignant tumor of Mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelioma", "description": "A malignant neoplasm of the pleura or peritoneum, arising from mesothelial cells. It is associated with exposure to asbestos." }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelial tumor", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelial tumour", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelioma", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelioma (disease)", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant neoplasm of mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant neoplasm of the mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant tumor of mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant tumor of the mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant tumour of mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant tumour of the mesothelium", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "mesothelioma, malignant", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "mesothelioma, somatic", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "advanced malignant mesothelioma", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "asbestos-related malignant mesothelioma", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "diffuse malignant mesothelioma", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "malignant mesothelial neoplasm", "description": "" }, { "id": "MONDO:0006292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006292", "name": "MESOM", "description": "" }, { "id": "MIM:156240", "resource": "MIM", "url": "https://www.omim.org/entry/156240", "name": "Mesothelioma, malignant", "description": "Mesothelioma, malignant" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P02774", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 436, "end_pos": 436, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "4", "chr_pos": "71752606", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T436", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs777041147", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777041147" }, { "id": "rs777041147", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs777041147" }, { "id": "rs777041147", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs777041147" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 98, "end_pos": 98, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNS->NNS).", "chr_id": "4", "chr_pos": "71765612", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S98", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "71.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "66.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "23.76", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "50.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "33.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "49.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "39.7", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02774" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "common_name": "Human" } ], "gene": [ { "name": "GC", "url": "https://www.uniprot.org/uniprot/P02774", "locus": { "chromosome": "4", "start_pos": 71741696, "end_pos": 71804041, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000145321", "url": "https://www.ensembl.org/id/ENSG00000145321" } ] } } ], "crossref": [ { "id": "ENSG00000145321", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000145321", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P02774", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P02774", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00015", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00015", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2259", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2259", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "GC", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GC", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2638", "url": "https://www.ncbi.nlm.nih.gov/gene/2638", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "619", "url": "https://glyconnect.expasy.org/browser/proteins/619", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4187", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4187", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "D6RF35", "url": "https://www.ebi.ac.uk/intact/interactors/id:D6RF35*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P02774", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02774*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000264", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000264", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020857", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020857", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020858", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020858", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2638", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2638", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "139200", "url": "http://www.omim.org/entry/139200", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02774", "url": "https://www.nextprot.org/entry/NX_P02774", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P02774", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02774", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "STCCISP", "url": "https://omabrowser.org/oma/group/STCCISP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5311143at2759", "url": "http://www.orthodb.org/?query=5311143at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11385", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11385", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11385:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11385:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1J78", "url": "https://www.rcsb.org/structure/1J78", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1J7E", "url": "https://www.rcsb.org/structure/1J7E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KW2", "url": "https://www.rcsb.org/structure/1KW2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1KXP", "url": "https://www.rcsb.org/structure/1KXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LOT", "url": "https://www.rcsb.org/structure/1LOT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MA9", "url": "https://www.rcsb.org/structure/1MA9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00273", "url": "http://pfam.xfam.org/family/PF00273", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09164", "url": "http://pfam.xfam.org/family/PF09164", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02774", "url": "https://pharos.nih.gov/targets/P02774", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052985", "url": "https://proconsortium.org/app/entry/PR:000052985", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02774", "url": "http://purl.obolibrary.org/obo/PR_P02774", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02774", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "D6RBJ7", "url": "https://www.uniprot.org/uniprot/D6RBJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBJ7-1", "url": "https://www.uniprot.org/uniprot/D6RBJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF20", "url": "https://www.uniprot.org/uniprot/D6RF20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF20-1", "url": "https://www.uniprot.org/uniprot/D6RF20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF35", "url": "https://www.uniprot.org/uniprot/D6RF35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF35-1", "url": "https://www.uniprot.org/uniprot/D6RF35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02774-1", "url": "https://www.uniprot.org/uniprot/P02774-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02774-2", "url": "https://www.uniprot.org/uniprot/P02774-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02774-3", "url": "https://www.uniprot.org/uniprot/P02774-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL", "length": 474, "header": "sp|P02774-1|VTDB_HUMAN Isoform 1 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=2 CANONICAL=P02774-1" }, "isoforms": [ { "isoform_ac": "D6RBJ7-1", "url": "", "sequence": { "sequence": "MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKALY", "length": 348, "header": "tr|D6RBJ7-1|D6RBJ7_HUMAN Computationally mapped isoform of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=1 CANONICAL=P02774-1" }, "locus": { "chromosome": "4", "start_pos": 71784018, "end_pos": 71754499, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000509740.5", "url": "https://www.ensembl.org/id/ENST00000509740.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000422664.1", "url": "https://www.ensembl.org/id/ENSP00000422664.1" } ] } }, { "isoform_ac": "D6RF20-1", "url": "", "sequence": { "sequence": "MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEIC", "length": 145, "header": "tr|D6RF20-1|D6RF20_HUMAN Computationally mapped isoform of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=1 CANONICAL=P02774-1" }, "locus": { "chromosome": "4", "start_pos": 71784018, "end_pos": 71765470, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000506245.1", "url": "https://www.ensembl.org/id/ENST00000506245.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000426718.1", "url": "https://www.ensembl.org/id/ENSP00000426718.1" } ] } }, { "isoform_ac": "D6RF35-1", "url": "", "sequence": { "sequence": "MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSETRVGATQGNDL", "length": 476, "header": "tr|D6RF35-1|D6RF35_HUMAN Computationally mapped isoform of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=1 CANONICAL=P02774-1" }, "locus": { "chromosome": "4", "start_pos": 71784018, "end_pos": 71741838, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513476.5", "url": "https://www.ensembl.org/id/ENST00000513476.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000426683.1", "url": "https://www.ensembl.org/id/ENSP00000426683.1" } ] } }, { "isoform_ac": "P02774-1", "url": "", "sequence": { "sequence": "MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL", "length": 474, "header": "sp|P02774-1|VTDB_HUMAN Isoform 1 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=2 CANONICAL=P02774-1" }, "locus": { "chromosome": "4", "start_pos": 71784018, "end_pos": 71746179, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000273951.13", "url": "https://www.ensembl.org/id/ENST00000273951.13" }, { "database": "Ensembl Peptide", "id": "ENSP00000273951.8", "url": "https://www.ensembl.org/id/ENSP00000273951.8" } ] } }, { "isoform_ac": "P02774-2", "url": "", "sequence": { "sequence": "MAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL", "length": 352, "header": "sp|P02774-2|VTDB_HUMAN Isoform 2 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=2 CANONICAL=P02774-1" }, "locus": {} }, { "isoform_ac": "P02774-3", "url": "", "sequence": { "sequence": "MLWSWSEERGGAARLSGRKMKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL", "length": 493, "header": "sp|P02774-3|VTDB_HUMAN Isoform 3 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=2 CANONICAL=P02774-1" }, "locus": { "chromosome": "4", "start_pos": 71803946, "end_pos": 71746179, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504199.5", "url": "https://www.ensembl.org/id/ENST00000504199.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000421725.1", "url": "https://www.ensembl.org/id/ENSP00000421725.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "P02774", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 288, "start_aa": "Asn", "end_pos": 288, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn288", "evidence": [ { "id": "619", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/619" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 451, "start_aa": "Asn", "end_pos": 451, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn451", "evidence": [ { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P02774", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02774" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "619", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/619" }, { "id": "6689265", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6689265" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "619", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/619" }, { "id": "6689265", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/6689265" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "An endocytic pathway essential for renal uptake and activation of the steroid 25-(OH) vitamin D3.", "journal": "Cell", "date": "1999", "authors": "Nykjaer A, Dragun D, Walther D, Vorum H, Jacobsen C, Herz J, Melsen F, Christensen EI, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "10052453", "url": "https://glygen.org/publication/PubMed/10052453" } ] }, { "title": "Enzymatic properties of human 25-hydroxyvitamin D3 1alpha-hydroxylase coexpression with adrenodoxin and NADPH-adrenodoxin reductase in Escherichia coli.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Sawada N, Sakaki T, Kitanaka S, Takeyama K, Kato S, Inouye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "10518789", "url": "https://glygen.org/publication/PubMed/10518789" } ] }, { "title": "Dual metabolic pathway of 25-hydroxyvitamin D3 catalyzed by human CYP24.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Sakaki T, Sawada N, Komai K, Shiozawa S, Yamada S, Yamamoto K, Ohyama Y, Inouye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11012668", "url": "https://glygen.org/publication/PubMed/11012668" } ] }, { "title": "Activation of human prolegumain by cleavage at a C-terminal asparagine residue.", "journal": "The Biochemical journal", "date": "2000", "authors": "Chen JM, Fortunato M, Barrett AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11085925", "url": "https://glygen.org/publication/PubMed/11085925" } ] }, { "title": "Double-blind, placebo-controlled, randomized, right-left study comparing calcipotriol monotherapy with a combined treatment of calcipotriol and diflucortolone valerate in chronic plaque psoriasis.", "journal": "Acta dermato-venereologica. Supplementum", "date": "2000", "authors": "Salmhofer W, Maier H, Soyer HP, Honigsmann H, Hodl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11234559", "url": "https://glygen.org/publication/PubMed/11234559" } ] }, { "title": "Cubilin dysfunction causes abnormal metabolism of the steroid hormone 25(OH) vitamin D(3).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Nykjaer A, Fyfe JC, Kozyraki R, Leheste JR, Jacobsen C, Nielsen MS, Verroust PJ, Aminoff M, de la Chapelle A, Moestrup SK, Ray R, Gliemann J, Willnow TE, Christensen EI", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11717447", "url": "https://glygen.org/publication/PubMed/11717447" } ] }, { "title": "A structural basis for the unique binding features of the human vitamin D-binding protein.", "journal": "Nat. Struct. Biol.", "date": "2002", "authors": "Verboven C, Rabijns A, De Maeyer M, Van Baelen H, Bouillon R, De Ranter C", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" }, { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11799400", "url": "https://glygen.org/publication/PubMed/11799400" } ] }, { "title": "Synthesis of 1,25-dihydroxyvitamin D(3) by human endothelial cells is regulated by inflammatory cytokines: a novel autocrine determinant of vascular cell adhesion.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2002", "authors": "Zehnder D, Bland R, Chana RS, Wheeler DC, Howie AJ, Williams MC, Stewart PM, Hewison M", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "11856765", "url": "https://glygen.org/publication/PubMed/11856765" } ] }, { "title": "Oral doxercalciferol therapy for secondary hyperparathyroidism in a peritoneal dialysis patient.", "journal": "Clinical nephrology", "date": "2002", "authors": "Sprague SM, Ho LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "12227689", "url": "https://glygen.org/publication/PubMed/12227689" } ] }, { "title": "Regulation of 25-hydroxyvitamin D3-1 alpha-hydroxylase and production of 1 alpha,25-dihydroxyvitamin D3 by human dendritic cells.", "journal": "Blood", "date": "2003", "authors": "Fritsche J, Mondal K, Ehrnsperger A, Andreesen R, Kreutz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "12855575", "url": "https://glygen.org/publication/PubMed/12855575" } ] }, { "title": "De-orphanization of cytochrome P450 2R1: a microsomal vitamin D 25-hydroxilase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Cheng JB, Motola DL, Mangelsdorf DJ, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "12867411", "url": "https://glygen.org/publication/PubMed/12867411" } ] }, { "title": "Molecular analysis of the gene for the human vitamin-D-binding protein (group-specific component): allelic differences of the common genetic GC types.", "journal": "Human genetics", "date": "1992", "authors": "Braun A, Bichlmaier R, Cleve H", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "1352271", "url": "https://glygen.org/publication/PubMed/1352271" } ] }, { "title": "Metabolism of vitamin D by human microsomal CYP2R1.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Shinkyo R, Sakaki T, Kamakura M, Ohta M, Inouye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "15465040", "url": "https://glygen.org/publication/PubMed/15465040" } ] }, { "title": "1,25-Dihydroxyvitamin D3 stimulates cyclic vitamin D receptor/retinoid X receptor DNA-binding, co-activator recruitment, and histone acetylation in intact osteoblasts.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2005", "authors": "Kim S, Shevde NK, Pike JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "15647825", "url": "https://glygen.org/publication/PubMed/15647825" } ] }, { "title": "Superagonistic action of 14-epi-analogs of 1,25-dihydroxyvitamin D explained by vitamin D receptor-coactivator interaction.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Eelen G, Verlinden L, Rochel N, Claessens F, De Clercq P, Vandewalle M, Tocchini-Valentini G, Moras D, Bouillon R, Verstuyf A", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "15728261", "url": "https://glygen.org/publication/PubMed/15728261" } ] }, { "title": "Gc protein (vitamin D-binding protein): Gc genotyping and GcMAF precursor activity.", "journal": "Anticancer research", "date": "2005", "authors": "Nagasawa H, Uto Y, Sasaki H, Okamura N, Murakami A, Kubo S, Kirk KL, Hori H", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "16302727", "url": "https://glygen.org/publication/PubMed/16302727" } ] }, { "title": "Protein chemical characterization of Gc globulin (vitamin D-binding protein) isoforms; Gc-1f, Gc-1s and Gc-2.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Christiansen M, Jorgensen CS, Laursen I, Hirschberg D, Hojrup P, Houen G", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "17360250", "url": "https://glygen.org/publication/PubMed/17360250" } ] }, { "title": "Comparison of oral falecalcitriol and intravenous calcitriol in hemodialysis patients with secondary hyperparathyroidism: a randomized, crossover trial.", "journal": "Clinical nephrology", "date": "2009", "authors": "Ito H, Ogata H, Yamamoto M, Takahashi K, Shishido K, Takahashi J, Taguchi S, Kinugasa E", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "19473635", "url": "https://glygen.org/publication/PubMed/19473635" } ] }, { "title": "The glycosylation and characterization of the candidate Gc macrophage activating factor.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Ravnsborg T, Olsen DT, Thysen AH, Christiansen M, Houen G, Hojrup P", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "20079467", "url": "https://glygen.org/publication/PubMed/20079467" } ] }, { "title": "Role of megalin and cubilin in the metabolism of vitamin D(3).", "journal": "Therapeutic apheresis and dialysis : official peer-reviewed journal of the International Society for Apheresis, the Japanese Society for Apheresis, the Japanese Society for Dialysis Therapy", "date": "2011", "authors": "Kaseda R, Hosojima M, Sato H, Saito A", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "21595846", "url": "https://glygen.org/publication/PubMed/21595846" } ] }, { "title": "Vitamin D and immune function: an overview.", "journal": "The Proceedings of the Nutrition Society", "date": "2012", "authors": "Hewison M", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "21849106", "url": "https://glygen.org/publication/PubMed/21849106" } ] }, { "title": "Molecular basis for the three major forms of human serum vitamin D binding protein (group-specific component).", "journal": "Biochemistry", "date": "1979", "authors": "Svasti J, Kurosky A, Bennett A, Bowman BH", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "218624", "url": "https://glygen.org/publication/PubMed/218624" } ] }, { "title": "PIAS4 represses vitamin D receptor-mediated signaling and acts as an E3-SUMO ligase towards vitamin D receptor.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2012", "authors": "Jena S, Lee WP, Doherty D, Thompson PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "22564762", "url": "https://glygen.org/publication/PubMed/22564762" } ] }, { "title": "Extraskeletal effects of vitamin D.", "journal": "Endocrinology and metabolism clinics of North America", "date": "2012", "authors": "Wolden-Kirk H, Gysemans C, Verstuyf A, Mathieu C", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "22877430", "url": "https://glygen.org/publication/PubMed/22877430" } ] }, { "title": "Successful treatment of alopecia areata with topical calcipotriol.", "journal": "Annals of dermatology", "date": "2012", "authors": "Kim DH, Lee JW, Kim IS, Choi SY, Lim YY, Kim HM, Kim BJ, Kim MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "22879719", "url": "https://glygen.org/publication/PubMed/22879719" } ] }, { "title": "Osteoporosis treatment by a new active vitamin D3 compound, eldecalcitol, in Japan.", "journal": "Current osteoporosis reports", "date": "2012", "authors": "Matsumoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "22918710", "url": "https://glygen.org/publication/PubMed/22918710" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Vitamin D and immune function.", "journal": "Nutrients", "date": "2013", "authors": "Prietl B, Treiber G, Pieber TR, Amrein K", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "23857223", "url": "https://glygen.org/publication/PubMed/23857223" } ] }, { "title": "Eldecalcitol for the treatment of osteoporosis.", "journal": "Clinical interventions in aging", "date": "2013", "authors": "Noguchi Y, Kawate H, Nomura M, Takayanagi R", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "24101867", "url": "https://glygen.org/publication/PubMed/24101867" } ] }, { "title": "Human group-specific component (Gc) is a member of the albumin family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Yang F, Brune JL, Naylor SL, Cupples RL, Naberhaus KH, Bowman BH", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "2415977", "url": "https://glygen.org/publication/PubMed/2415977" } ] }, { "title": "Serum vitamin D-binding protein is a third member of the albumin and alpha fetoprotein gene family.", "journal": "The Journal of clinical investigation", "date": "1985", "authors": "Cooke NE, David EV", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "2416779", "url": "https://glygen.org/publication/PubMed/2416779" } ] }, { "title": "Complete amino acid sequence of human vitamin D-binding protein (group-specific component): evidence of a three-fold internal homology as in serum albumin and alpha-fetoprotein.", "journal": "Biochim. Biophys. Acta", "date": "1986", "authors": "Schoentgen F, Metz-Boutigue M H, Joll\u00e8s J, Constans J, Joll\u00e8s P", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "2423133", "url": "https://glygen.org/publication/PubMed/2423133" } ] }, { "title": "Active vitamin D analogs, maxacalcitol and alfacalcidol, as maintenance therapy for mild secondary hyperparathyroidism in hemodialysis patients - a randomized study.", "journal": "International journal of clinical pharmacology and therapeutics", "date": "2014", "authors": "Honda H, Koiwa F, Ogata H, Shishido K, Sekiguchi T, Michihata T, Ogawa H, Mukai M, Takahashi K, Suzuki R, Kino K, Kato K, Yamamoto K, Kinugasa E, Akizawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "24569127", "url": "https://glygen.org/publication/PubMed/24569127" } ] }, { "title": "Comparison of paricalcitol with maxacalcitol injection in Japanese hemodialysis patients with secondary hyperparathyroidism.", "journal": "Therapeutic apheresis and dialysis : official peer-reviewed journal of the International Society for Apheresis, the Japanese Society for Apheresis, the Japanese Society for Dialysis Therapy", "date": "2015", "authors": "Akizawa T, Akiba T, Hirakata H, Kinugasa E, Tominaga Y, Fukagawa M, Yokoyama K, Zhang W, Linde PG, Suzuki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "25363733", "url": "https://glygen.org/publication/PubMed/25363733" } ] }, { "title": "Proactive treatment with calcipotriol reduces recurrence of plaque psoriasis.", "journal": "The Journal of dermatology", "date": "2016", "authors": "Ito K, Koga M, Shibayama Y, Tatematsu S, Nakayama J, Imafuku S", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "26434738", "url": "https://glygen.org/publication/PubMed/26434738" } ] }, { "title": "Comparison between paricalcitol and active non-selective vitamin D receptor activator for secondary hyperparathyroidism in chronic kidney disease: a systematic review and meta-analysis of randomized controlled trials.", "journal": "International urology and nephrology", "date": "2016", "authors": "Cai P, Tang X, Qin W, Ji L, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "26748501", "url": "https://glygen.org/publication/PubMed/26748501" } ] }, { "title": "Comparison of Two ELISA Methods and Mass Spectrometry for Measurement of Vitamin D-Binding Protein: Implications for the Assessment of Bioavailable Vitamin D Concentrations Across Genotypes.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2016", "authors": "Denburg MR, Hoofnagle AN, Sayed S, Gupta J, de Boer IH, Appel LJ, Durazo-Arvizu R, Whitehead K, Feldman HI, Leonard MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "27250744", "url": "https://glygen.org/publication/PubMed/27250744" } ] }, { "title": "The role of vitamin D and VDR in carcinogenesis: Through epidemiology and basic sciences.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2017", "authors": "Bandera Merchan B, Morcillo S, Martin-Nunez G, Tinahones FJ, Macias-Gonzalez M", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "27913313", "url": "https://glygen.org/publication/PubMed/27913313" } ] }, { "title": "Research on kidney and mineral metabolism in Japan: past, present, and future.", "journal": "Clinical and experimental nephrology", "date": "2017", "authors": "Mizobuchi M, Ogata H, Koiwa F, Kinugasa E, Akizawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "28005175", "url": "https://glygen.org/publication/PubMed/28005175" } ] }, { "title": "Pathogenic roles of alterations in vitamin D and vitamin D receptor in gastric tumorigenesis.", "journal": "Oncotarget", "date": "2017", "authors": "Du C, Yang S, Zhao X, Dong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "28206978", "url": "https://glygen.org/publication/PubMed/28206978" } ] }, { "title": "Comparative efficacy and safety of paricalcitol versus vitamin D receptor activators for dialysis patients with secondary hyperparathyroidism: a meta-analysis of randomized controlled trials.", "journal": "BMC nephrology", "date": "2017", "authors": "Xie Y, Su P, Sun Y, Zhang H, Zhao R, Li L, Meng L", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "28841848", "url": "https://glygen.org/publication/PubMed/28841848" } ] }, { "title": "The vitamin D-binding protein gene contains conserved nucleotide sequences that respond to heavy metal, adipocyte and mitotic signals.", "journal": "Gene", "date": "1987", "authors": "Yang F, Naberhaus K H, Adrian G S, Gardella J M, Brissenden J E, Bowman B H", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "2958390", "url": "https://glygen.org/publication/PubMed/2958390" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02774", "url": "" }, { "database": "GlyConnect", "id": "619", "url": "https://glyconnect.expasy.org/browser/proteins/619" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02774", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02774" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "The role of free vitamin D and vitamin D binding protein in SARS-Cov-2 infection in children.", "journal": "Pediatrics international : official journal of the Japan Pediatric Society", "date": "2023", "authors": "Us Mahmut Caner, Devrim Lanpir Asl\u0131, \u00d6zdatli Kurtulu\u015f \u015e\u00fckran, Yagci Mesut, Akarsu \u00d6zlem, \u015eahin Kamil, Akko\u00e7 G\u00fcl\u015fen", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ], "reference": [ { "type": "PubMed", "id": "37888613", "url": "https://glygen.org/publication/PubMed/37888613" } ] }, { "title": "Association of Single Nucleotide Polymorphism in VDR, GC Globulin and CYP2R1 with the Risk of Esophageal Cancer.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2023-10-01", "authors": "Ali Eyashin, Das Eshani, Das Partha Pratim, Kalita Manash Jyoti, Dutta Kalpajit, Kalita Simanta, Adhyapak Sampurna, Hazarika Gautam, Talukdar Jayashree, Malik Abdul, Akhtar Sohail, Bhattachrya Mallika, Choudhury Bikash Narayan, Idris Md Ghaznavi, Baruah Munindra Narayan, Medhi Subhash", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ], "reference": [ { "type": "PubMed", "id": "37898838", "url": "https://glygen.org/publication/PubMed/37898838" } ] }, { "title": "Single nucleotide polymorphisms in vitamin D binding protein and 25-hydroxylase genes affect vitamin D levels in adolescents of Arab ethnicity in Kuwait.", "journal": "Frontiers in endocrinology", "date": "2023", "authors": "Rahman Abdur, Abu-Farha Mohamed, Channanath Arshad, Hammad Maha M, Anoop Emil, Chandy Betty, Melhem Motasem, Al-Mulla Fahd, Thanaraj Thangavel Alphonse, Abubaker Jehad", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ], "reference": [ { "type": "PubMed", "id": "37929021", "url": "https://glygen.org/publication/PubMed/37929021" } ] }, { "title": "Vitamin D receptor rs3782905 and vitamin D binding protein rs7041 polymorphisms are associated with hepatocellular carcinoma susceptibility in cirrhotic HCV patients.", "journal": "BMC medical genomics", "date": "2023-12-08", "authors": "El-Masry Asmaa Samir, Medhat Amina M, El-Bendary Mahmoud, Mohamed Rania Hassan", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ], "reference": [ { "type": "PubMed", "id": "38066559", "url": "https://glygen.org/publication/PubMed/38066559" } ] }, { "title": "The Molecular Aspects of Functional Activity of Macrophage-Activating Factor GcMAF.", "journal": "International journal of molecular sciences", "date": "2023-12-12", "authors": "Kirikovich Svetlana S, Levites Evgeniy V, Proskurina Anastasia S, Ritter Genrikh S, Peltek Sergey E, Vasilieva Asya R, Ruzanova Vera S, Dolgova Evgeniya V, Oshihmina Sofya G, Sysoev Alexandr V, Koleno Danil I, Danilenko Elena D, Taranov Oleg S, Ostanin Alexandr A, Chernykh Elena R, Kolchanov Nikolay A, Bogachev Sergey S", "evidence": [ { "database": "RefSeq", "id": "NP_000574", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000574" } ], "reference": [ { "type": "PubMed", "id": "38139225", "url": "https://glygen.org/publication/PubMed/38139225" } ] }, { "title": "Isolation and characterization of the O-glycan chain of the human vitamin-D binding protein.", "journal": "Biochemical and biophysical research communications", "date": "1983", "authors": "Viau M, Constans J, Debray H, Montreuil J", "evidence": [ { "database": "GlyConnect", "id": "619", "url": "https://glyconnect.expasy.org/browser/proteins/619" } ], "reference": [ { "type": "PubMed", "id": "6689265", "url": "https://glygen.org/publication/PubMed/6689265" } ] }, { "title": "Sequence and organization of the human vitamin D-binding protein gene.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Braun A, Kofler A, Morawietz S, Cleve H", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "7505619", "url": "https://glygen.org/publication/PubMed/7505619" } ] }, { "title": "Characterization of mutants of the vitamin-D-binding protein/group specific component: GC aborigine (1A1) from Australian aborigines and South African blacks, and 2A9 from south Germany.", "journal": "Vox sanguinis", "date": "1995", "authors": "Kofler A, Braun A, Jenkins T, Serjeantson SW, Cleve H", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "7725672", "url": "https://glygen.org/publication/PubMed/7725672" } ] }, { "title": "Identification of glycoprotein 330 as an endocytic receptor for apolipoprotein J/clusterin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kounnas MZ, Loukinova EB, Stefansson S, Harmony JA, Brewer BH, Strickland DK, Argraves WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "7768901", "url": "https://glygen.org/publication/PubMed/7768901" } ] }, { "title": "Complete structure of the human Gc gene: differences and similarities between members of the albumin gene family.", "journal": "Genomics", "date": "1993", "authors": "Witke WF, Gibbs PE, Zielinski R, Yang F, Bowman BH, Dugaiczyk A", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "reference": [ { "type": "PubMed", "id": "8325650", "url": "https://glygen.org/publication/PubMed/8325650" } ] }, { "title": "Isolation and expression of human 1,25-dihydroxyvitamin D3 24-hydroxylase cDNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Chen KS, Prahl JM, DeLuca HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "8506296", "url": "https://glygen.org/publication/PubMed/8506296" } ] }, { "title": "Human 25-hydroxyvitamin D3-24-hydroxylase, a multicatalytic enzyme.", "journal": "Biochemistry", "date": "1996", "authors": "Beckman MJ, Tadikonda P, Werner E, Prahl J, Yamada S, DeLuca HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "8679605", "url": "https://glygen.org/publication/PubMed/8679605" } ] }, { "title": "Cloning and sequencing of human gp330, a Ca(2+)-binding receptor with potential intracellular signaling properties.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Hjalm G, Murray E, Crumley G, Harazim W, Lundgren S, Onyango I, Ek B, Larsson M, Juhlin C, Hellman P, Davis H, Akerstrom G, Rask L, Morse B", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "8706697", "url": "https://glygen.org/publication/PubMed/8706697" } ] }, { "title": "Autocatalytic activation of human legumain at aspartic acid residues.", "journal": "FEBS letters", "date": "1998", "authors": "Halfon S, Patel S, Vega F, Zurawski S, Zurawski G", "evidence": [ { "database": "Reactome", "id": "R-HSA-196791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791" } ], "reference": [ { "type": "PubMed", "id": "9821970", "url": "https://glygen.org/publication/PubMed/9821970" } ] } ], "pathway": [ { "id": "hsa:2638", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2638", "resource": "KEGG Pathway" }, { "id": "R-HSA-196791", "name": "Vitamin D (calciferol) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196791", "resource": "Reactome", "description": "Vitamin D (calciferol) metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P04276-1", "protein_name": "Vitamin D-binding protein", "gene_name": "Gc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKRVLVLLLALAFGHALERGRDYEKDKVCQELSTLGKDDFRSLSLILYSRKFPSSTFEQVSQLVKEVVSLTEECCAEGADPNCYDTRTSELSIKSCESDAPFPVHPGTSECCTKEGLERKLCMAALSHQPQEFPAYVEPTNDEICEAFRKDPKGFADQFLFEYSSNYGQAPLPLLVGYTKSYLSMVGSCCTSAKPTVCFLKERLQMKQLLLLTTMSNRVCSQYAAYGKEKSRMSHLIKLAQKVPTANLEDVLPLAEDLTEILSRCCKSTSEDCMARELPEHTLKICGNLSKKNSKFEECCYETTPMGIFMCSYFMPTAEPLQLPAIKLPTSKDLCGQSATQAMDQYTFELSRRTQVPEVFLSKVLDTTLKTLRECCDTQDSVSCFSTQSPLMKRQLTSFIEKGQEMCADYSENTFTEYKKKLAERLRTKMPNASPEELADMVAKHSDFASKCCSINSPPRYCSSQIDAEMRDILQS", "length": 476 }, "evidence": [ { "id": "45925400", "url": "http://www.informatics.jax.org/homology/45925400", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P21614-1", "protein_name": "Vitamin D-binding protein", "gene_name": "Gc", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKRVLVLLLALAFGHALERGRDYEKDKVCNELAMLGKEDFRSLSLILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPVHPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEYSSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSEDCMASELPEHTIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEPLQLPAIKLPTGKDLCGQSTTQAMDQYTFELSRRTQVPEVFLSKVLEPTLKTLRECCDTQDSVACFSTQSPLLKRQLTSFIEKGQEMCADYSENTFTEYKKKLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSSQIDAEMIDTLQS", "length": 476 }, "evidence": [ { "id": "45925400", "url": "http://www.informatics.jax.org/homology/45925400", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "vitamin transmembrane transporter activity", "id": "GO:0090482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090482", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "vitamin D binding", "id": "GO:0005499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005499", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "calcidiol binding", "id": "GO:1902118", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902118", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "vitamin D metabolic process", "id": "GO:0042359", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042359", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" }, { "name": "vitamin transport", "id": "GO:0051180", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051180", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "vitamin D-binding protein N-glycosylated 1 (human)", "definition": "A vitamin D-binding protein (human) that has been N-glycosylated at the residue equivalent to Asn-288 of the amino acid sequence represented by UniProtKB:P02774-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P02774-1, Asn-288, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052985", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052985" } ] } ], "site_annotation": [ { "start_pos": 288, "end_pos": 290, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Allele GC*1S is O-glycosylated at Thr-436 (PubMed:20079467). The trisaccharide sugar moiety can be modified by the successive removal of neuraminic acid and galactose leaving an O-mceeN-acetyl-galactosamine. This conversion is thought to produce a macrophage-activating factor (Gc-MAF). Only a minor proportion of plasma GC is O-glycosylated (PubMed:17360250). The potential N-glycosylation site predicted at Asn-288 is thought to be nonglycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P02774", "url": "https://www.uniprot.org/uniprot/P02774" }, { "database": "PubMed", "id": "16302727", "url": "https://glygen.org/publication/PubMed/16302727" }, { "database": "PubMed", "id": "17360250", "url": "https://glygen.org/publication/PubMed/17360250" }, { "database": "PubMed", "id": "20079467", "url": "https://glygen.org/publication/PubMed/20079467" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 288, 451 ], "o_linked_sites": [], "snv_sites": [ 39, 98, 159, 177, 229, 237, 257, 288, 290, 292, 416, 436 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 288, "end_pos": 290 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }