{ "uniprot_canonical_ac": "P02655-1", "uniprot_ac": "P02655", "uniprot_id": "APOC2_HUMAN", "mass": { "chemical_mass": 11284.0, "monoisotopic_mass": 11284.0 }, "refseq": { "ac": "NP_000474", "name": "apolipoprotein C-II precursor", "summary": "This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" }, "gene_names": [ { "name": "APOC2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02655", "id": "P02655" }, { "name": "APC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02655", "id": "P02655" }, { "name": "APO-CII; APOC-II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474", "id": "NP_000474" }, { "name": "APOC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474", "id": "NP_000474" } ], "protein_names": [ { "name": "Apolipoprotein C-II", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02655" }, { "name": "Apo-CII", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02655" }, { "name": "ApoC-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02655" }, { "name": "Apolipoprotein C2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02655" }, { "name": "apolipoprotein C-II precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474", "id": "NP_000474" }, { "name": "apolipoprotein C-II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474", "id": "NP_000474" } ], "function": [ { "annotation": "Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase.", "evidence": [ { "database": "UniProtKB", "id": "Q6P163", "url": "https://www.uniprot.org/uniprot/Q6P163#function" }, { "database": "UniProtKB", "id": "RU368054", "url": "https://www.uniprot.org/uniprot/RU368054#function" }, { "database": "UniProtKB", "id": "V9GYJ8", "url": "https://www.uniprot.org/uniprot/V9GYJ8#function" }, { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655#function" }, { "database": "PubMed", "id": "2209608", "url": "https://glygen.org/publication/PubMed/2209608" }, { "database": "PubMed", "id": "22304839", "url": "https://glygen.org/publication/PubMed/22304839" } ] }, { "annotation": "Includes the observation of APOC4-APOC2 read-through transcription", "evidence": [ { "database": "RefSeq", "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" }, { "database": "PubMed", "id": "8530039", "url": "https://glygen.org/publication/PubMed/8530039" } ] }, { "annotation": "Sequence Variant Analysis of the APOCII Locus among an Arab Cohort. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" }, { "database": "PubMed", "id": "38003484", "url": "https://glygen.org/publication/PubMed/38003484" } ] }, { "annotation": "This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" } ] } ], "disease": [ { "disease_id": "DOID:0111418", "recommended_name": { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "familial apolipoprotein C-II deficiency", "description": "A familial chylomicronemia syndrome characterized by onset in adolescence or adulthood of hypertriglyceridemia and fasting chylomicronemia that has_material_basis_in homozygous or compound heterozygous mutation in the APOC2 gene on chromosome 19q13.32." }, "synonyms": [ { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "C-II anapolipoproteinemia", "description": "" }, { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "familial APOC2 deficiency", "description": "" }, { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "familial apoC-II deficiency", "description": "" }, { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "hyperlipoproteinemia, type 1b", "description": "" }, { "id": "DOID:0111418", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111418", "name": "hyperlipoproteinemia, type Ib", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "familial apolipoprotein C-II deficiency", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "familial apoC-II deficiency", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "familial apolipoprotein C-II deficiency", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "hyperlipoproteinemia, type IB", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "Apoc2 deficiency", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "C-II Anapolipoproteinemia", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "apolipoprotein C-II deficiency", "description": "" }, { "id": "MONDO:0008810", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008810", "name": "hyperlipoproteinemia, type 1B", "description": "" }, { "id": "MIM:207750", "resource": "MIM", "url": "https://www.omim.org/entry/207750", "name": "Hyperlipoproteinemia 1B", "description": "Hyperlipoproteinemia 1B" } ], "evidence": [ { "id": "207750", "database": "MIM", "url": "https://www.omim.org/entry/207750" } ] } ], "snv": [ { "evidence": [ { "id": "rs994371401", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs994371401" }, { "id": "rs994371401", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs994371401#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 23, "end_pos": 23, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "19", "chr_pos": "44948713", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T23", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1344873637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1344873637" }, { "id": "rs1344873637", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1344873637#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "19", "chr_pos": "44948742", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761724352", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761724352" }, { "id": "rs761724352", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761724352" }, { "id": "rs761724352", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761724352#frequency_tab" }, { "id": "rs761724352", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761724352" }, { "id": "rs1331380599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1331380599" }, { "id": "rs1331380599", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1331380599" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "19", "chr_pos": "44948806", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1483358366", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483358366" }, { "id": "rs1483358366", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1483358366" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 35, "end_pos": 35, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "19", "chr_pos": "44948749", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T35", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "64.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "57.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "58.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "47.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "50.03", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "60.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02655", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02655" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "common_name": "Human" } ], "gene": [ { "name": "APOC2", "url": "https://www.uniprot.org/uniprot/P02655", "locus": { "chromosome": "19", "start_pos": 44949565, "end_pos": 44946035, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000234906", "url": "https://www.ensembl.org/id/ENSG00000234906" } ] } } ], "crossref": [ { "id": "ENSG00000234906", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234906", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "APOC2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APOC2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "344", "url": "https://www.ncbi.nlm.nih.gov/gene/344", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "609", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=609", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02655", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02655*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008019", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008019", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023121", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023121", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:344", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:344", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "207750", "url": "http://www.omim.org/entry/207750", "database": "MIM", "categories": [ "Other" ] }, { "id": "608083", "url": "http://www.omim.org/entry/608083", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02655", "url": "https://www.nextprot.org/entry/NX_P02655", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P02655", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02655", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EVQGAHL", "url": "https://omabrowser.org/oma/group/EVQGAHL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4640492at2759", "url": "http://www.orthodb.org/?query=4640492at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16566", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16566", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16566:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16566:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BY6", "url": "https://www.rcsb.org/structure/1BY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1I5J", "url": "https://www.rcsb.org/structure/1I5J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1O8T", "url": "https://www.rcsb.org/structure/1O8T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SOH", "url": "https://www.rcsb.org/structure/1SOH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05355", "url": "http://pfam.xfam.org/family/PF05355", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02655", "url": "https://pharos.nih.gov/targets/P02655", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052498", "url": "https://proconsortium.org/app/entry/PR:000052498", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052499", "url": "https://proconsortium.org/app/entry/PR:000052499", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052500", "url": "https://proconsortium.org/app/entry/PR:000052500", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052501", "url": "https://proconsortium.org/app/entry/PR:000052501", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052502", "url": "https://proconsortium.org/app/entry/PR:000052502", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02655", "url": "http://purl.obolibrary.org/obo/PR_P02655", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02655", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02655-1", "url": "https://www.uniprot.org/uniprot/P02655-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P163", "url": "https://www.uniprot.org/uniprot/Q6P163", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6P163-1", "url": "https://www.uniprot.org/uniprot/Q6P163-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYJ8", "url": "https://www.uniprot.org/uniprot/V9GYJ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYJ8-1", "url": "https://www.uniprot.org/uniprot/V9GYJ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GZ01", "url": "https://www.uniprot.org/uniprot/V9GZ01", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GZ01-1", "url": "https://www.uniprot.org/uniprot/V9GZ01-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE", "length": 101, "header": "sp|P02655-1|APOC2_HUMAN Isoform 1 of Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1 CANONICAL=P02655-1" }, "isoforms": [ { "isoform_ac": "P02655-1", "url": "", "sequence": { "sequence": "MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE", "length": 101, "header": "sp|P02655-1|APOC2_HUMAN Isoform 1 of Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1 CANONICAL=P02655-1" }, "locus": { "chromosome": "19", "start_pos": 44949246, "end_pos": 44948479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000252490.7", "url": "https://www.ensembl.org/id/ENST00000252490.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000252490.5", "url": "https://www.ensembl.org/id/ENSP00000252490.5" } ] } }, { "isoform_ac": "Q6P163-1", "url": "", "sequence": { "sequence": "MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLR", "length": 72, "header": "tr|Q6P163-1|APOC2_HUMAN Computationally mapped isoform of Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1 CANONICAL=P02655-1" }, "locus": { "chromosome": "19", "start_pos": 44948861, "end_pos": 44948479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000585786.1", "url": "https://www.ensembl.org/id/ENST00000585786.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465001.1", "url": "https://www.ensembl.org/id/ENSP00000465001.1" } ] } }, { "isoform_ac": "V9GYJ8-1", "url": "", "sequence": { "sequence": "MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLDLYSKSTAAMSTYTGIFTDQVLSVLKGEE", "length": 87, "header": "tr|V9GYJ8-1|APOC2_HUMAN Computationally mapped isoform of Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1 CANONICAL=P02655-1" }, "locus": { "chromosome": "19", "start_pos": 44949246, "end_pos": 44948479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591597.5", "url": "https://www.ensembl.org/id/ENST00000591597.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000476835.1", "url": "https://www.ensembl.org/id/ENSP00000476835.1" } ] } }, { "isoform_ac": "V9GZ01-1", "url": "", "sequence": { "sequence": "MGTRLLPALFLVLLVLGFGEGISLQLLGVSKDSRPEPVREDIPARCR", "length": 47, "header": "tr|V9GZ01-1|APOC2_HUMAN Computationally mapped isoform of Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1 CANONICAL=P02655-1" }, "locus": { "chromosome": "19", "start_pos": 44948848, "end_pos": 44948479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592257.5", "url": "https://www.ensembl.org/id/ENST00000592257.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000477261.1", "url": "https://www.ensembl.org/id/ENSP00000477261.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 33, "start_aa": "Ser", "end_pos": 33, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser33", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 35, "start_aa": "Thr", "end_pos": 35, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr35", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 35, "start_aa": "Thr", "end_pos": 35, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr35", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ESLSSYWESAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 42, "start_aa": "Glu", "end_pos": 52, "end_aa": "Lys", "evidence": [ { "id": "P02655", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P02655", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02655" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P02655", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.", "journal": "Nature genetics", "date": "1999", "authors": "Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "10391210", "url": "https://glygen.org/publication/PubMed/10391210" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "Sterol-dependent transactivation of the ABC1 promoter by the liver X receptor/retinoid X receptor.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Costet P, Luo Y, Wang N, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "10858438", "url": "https://glygen.org/publication/PubMed/10858438" } ] }, { "title": "The proprotein convertases furin and PACE4 play a significant role in tumor progression.", "journal": "Molecular carcinogenesis", "date": "2000", "authors": "Bassi DE, Mahloogi H, Klein-Szanto AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "10900462", "url": "https://glygen.org/publication/PubMed/10900462" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Laffitte BA, Repa JJ, Joseph SB, Wilpitz DC, Kast HR, Mangelsdorf DJ, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11149950", "url": "https://glygen.org/publication/PubMed/11149950" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Expression of the apolipoprotein C-II gene during myelomonocytic differentiation of human leukemic cells.", "journal": "J. Leukoc. Biol.", "date": "2001", "authors": "Chun E M, Park Y J, Kang H S, Cho H M, Jun D Y, Kim Y H", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "11310852", "url": "https://glygen.org/publication/PubMed/11310852" } ] }, { "title": "Characterization of the human ABCG1 gene: liver X receptor activates an internal promoter that produces a novel transcript encoding an alternative form of the protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kennedy MA, Venkateswaran A, Tarr PT, Xenarios I, Kudoh J, Shimizu N, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11500512", "url": "https://glygen.org/publication/PubMed/11500512" } ] }, { "title": "Autoregulation of the human liver X receptor alpha promoter.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Laffitte BA, Joseph SB, Walczak R, Pei L, Wilpitz DC, Collins JL, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11604492", "url": "https://glygen.org/publication/PubMed/11604492" } ] }, { "title": "Induction of human liver X receptor alpha gene expression via an autoregulatory loop mechanism.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Li Y, Bolten C, Bhat BG, Woodring-Dietz J, Li S, Prayaga SK, Xia C, Lala DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "11875109", "url": "https://glygen.org/publication/PubMed/11875109" } ] }, { "title": "Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mak PA, Laffitte BA, Desrumaux C, Joseph SB, Curtiss LK, Mangelsdorf DJ, Tontonoz P, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12032151", "url": "https://glygen.org/publication/PubMed/12032151" } ] }, { "title": "Comparative genome analysis of potential regulatory elements in the ABCG5-ABCG8 gene cluster.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Remaley AT, Bark S, Walts AD, Freeman L, Shulenin S, Annilo T, Elgin E, Rhodes HE, Joyce C, Dean M, Santamarina-Fojo S, Brewer HB Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12150943", "url": "https://glygen.org/publication/PubMed/12150943" } ] }, { "title": "Identification of PLTP as an LXR target gene and apoE as an FXR target gene reveals overlapping targets for the two nuclear receptors.", "journal": "Journal of lipid research", "date": "2002", "authors": "Mak PA, Kast-Woelbern HR, Anisfeld AM, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12454263", "url": "https://glygen.org/publication/PubMed/12454263" } ] }, { "title": "Microsomal triglyceride transfer protein and its role in apoB-lipoprotein assembly.", "journal": "Journal of lipid research", "date": "2003", "authors": "Hussain MM, Shi J, Dreizen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12518019", "url": "https://glygen.org/publication/PubMed/12518019" } ] }, { "title": "The phospholipid transfer protein gene is a liver X receptor target expressed by macrophages in atherosclerotic lesions.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Laffitte BA, Joseph SB, Chen M, Castrillo A, Repa J, Wilpitz D, Mangelsdorf D, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "12612088", "url": "https://glygen.org/publication/PubMed/12612088" } ] }, { "title": "Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.", "journal": "Nature genetics", "date": "2003", "authors": "Jones B, Jones EL, Bonney SA, Patel HN, Mensenkamp AR, Eichenbaum-Voline S, Rudling M, Myrdal U, Annesi G, Naik S, Meadows N, Quattrone A, Islam SA, Naoumova RP, Angelin B, Infante R, Levy E, Roy CC, Freemont PS, Scott J, Shoulders CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12692552", "url": "https://glygen.org/publication/PubMed/12692552" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Human hepatic lipase mutations and polymorphisms.", "journal": "Human mutation", "date": "1992", "authors": "Hegele RA, Tu L, Connelly PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "1301939", "url": "https://glygen.org/publication/PubMed/1301939" } ] }, { "title": "Phospholipid transfer protein interacts with and stabilizes ATP-binding cassette transporter A1 and enhances cholesterol efflux from cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oram JF, Wolfbauer G, Vaughan AM, Tang C, Albers JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "14559902", "url": "https://glygen.org/publication/PubMed/14559902" } ] }, { "title": "Liver X receptors are regulators of adipocyte gene expression but not differentiation: identification of apoD as a direct target.", "journal": "Journal of lipid research", "date": "2004", "authors": "Hummasti S, Laffitte BA, Watson MA, Galardi C, Chao LC, Ramamurthy L, Moore JT, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14703507", "url": "https://glygen.org/publication/PubMed/14703507" } ] }, { "title": "Microsomal triglyceride transfer protein: a protein complex required for the assembly of lipoprotein particles.", "journal": "Trends in cell biology", "date": "1995", "authors": "Gordon DA, Wetterau JR, Gregg RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "14732096", "url": "https://glygen.org/publication/PubMed/14732096" } ] }, { "title": "Role of p160 coactivator complex in the activation of liver X receptor.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "Huuskonen J, Fielding PE, Fielding CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "14764426", "url": "https://glygen.org/publication/PubMed/14764426" } ] }, { "title": "ADP-ribosylation factor (ARF)-like 7 (ARL7) is induced by cholesterol loading and participates in apolipoprotein AI-dependent cholesterol export.", "journal": "FEBS letters", "date": "2004", "authors": "Engel T, Lueken A, Bode G, Hobohm U, Lorkowski S, Schlueter B, Rust S, Cullen P, Pech M, Assmann G, Seedorf U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "15147902", "url": "https://glygen.org/publication/PubMed/15147902" } ] }, { "title": "Hepatic lipase, lipoprotein metabolism, and atherogenesis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "Santamarina-Fojo S, Gonzalez-Navarro H, Freeman L, Wagner E, Nong Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "15284087", "url": "https://glygen.org/publication/PubMed/15284087" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Sequence specific 1H-NMR assignments and secondary structure of a carboxy-terminal functional fragment of apolipoprotein CII.", "journal": "Eur. J. Biochem.", "date": "1992", "authors": "Lycksell P O, Ohman A, Bengtsson-Olivecrona G, Johansson L B, Wijmenga S S, Wernic D, Gr\u00e4slund A", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "1555583", "url": "https://glygen.org/publication/PubMed/1555583" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "The liver-enriched transcription factor CREB-H is a growth suppressor protein underexpressed in hepatocellular carcinoma.", "journal": "Nucleic acids research", "date": "2005", "authors": "Chin KT, Zhou HJ, Wong CM, Lee JM, Chan CP, Qiang BQ, Yuan JG, Ng IO, Jin DY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "15800215", "url": "https://glygen.org/publication/PubMed/15800215" } ] }, { "title": "ABCG1 redistributes cell cholesterol to domains removable by high density lipoprotein but not by lipid-depleted apolipoproteins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Vaughan AM, Oram JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "15994327", "url": "https://glygen.org/publication/PubMed/15994327" } ] }, { "title": "Proprotein convertases [corrected] are responsible for proteolysis and inactivation of endothelial lipase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Jin W, Fuki IV, Seidah NG, Benjannet S, Glick JM, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "16109723", "url": "https://glygen.org/publication/PubMed/16109723" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "Description of the torcetrapib series of cholesteryl ester transfer protein inhibitors, including mechanism of action.", "journal": "Journal of lipid research", "date": "2006", "authors": "Clark RW, Ruggeri RB, Cunningham D, Bamberger MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "16326978", "url": "https://glygen.org/publication/PubMed/16326978" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "Functionally defective high-density lipoprotein: a new therapeutic target at the crossroads of dyslipidemia, inflammation, and atherosclerosis.", "journal": "Pharmacological reviews", "date": "2006", "authors": "Kontush A, Chapman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "16968945", "url": "https://glygen.org/publication/PubMed/16968945" } ] }, { "title": "Angiopoietin-like protein 4 converts lipoprotein lipase to inactive monomers and modulates lipase activity in adipose tissue.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Sukonina V, Lookene A, Olivecrona T, Olivecrona G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "17088546", "url": "https://glygen.org/publication/PubMed/17088546" } ] }, { "title": "Selective up-regulation of LXR-regulated genes ABCA1, ABCG1, and APOE in macrophages through increased endogenous synthesis of 24(S),25-epoxycholesterol.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Beyea MM, Heslop CL, Sawyez CG, Edwards JY, Markle JG, Hegele RA, Huff MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "17186944", "url": "https://glygen.org/publication/PubMed/17186944" } ] }, { "title": "Crystal structure of cholesteryl ester transfer protein reveals a long tunnel and four bound lipid molecules.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Qiu X, Mistry A, Ammirati MJ, Chrunyk BA, Clark RW, Cong Y, Culp JS, Danley DE, Freeman TB, Geoghegan KF, Griffor MC, Hawrylik SJ, Hayward CM, Hensley P, Hoth LR, Karam GA, Lira ME, Lloyd DB, McGrath KM, Stutzman-Engwall KJ, Subashi AK, Subashi TA, Thompson JF, Wang IK, Zhao H, Seddon AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "17237796", "url": "https://glygen.org/publication/PubMed/17237796" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "An apolipoprotein CII mutation, CII Lys-19-->Thr identified in patients with hyperlipidemia.", "journal": "Dis. Markers", "date": "1991", "authors": "Hegele RA, Connelly PW, Maguire GF, Huff MW, Leiter L, Wolfe BM, Evans AJ, Little JA", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "1782747", "url": "https://glygen.org/publication/PubMed/1782747" } ] }, { "title": "Homozygous missense mutation (G56R) in glycosylphosphatidylinositol-anchored high-density lipoprotein-binding protein 1 (GPI-HBP1) in two siblings with fasting chylomicronemia (MIM 144650).", "journal": "Lipids in health and disease", "date": "2007", "authors": "Wang J, Hegele RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "17883852", "url": "https://glygen.org/publication/PubMed/17883852" } ] }, { "title": "Mutations in LMF1 cause combined lipase deficiency and severe hypertriglyceridemia.", "journal": "Nature genetics", "date": "2007", "authors": "Peterfy M, Ben-Zeev O, Mao HZ, Weissglas-Volkov D, Aouizerat BE, Pullinger CR, Frost PH, Kane JP, Malloy MJ, Reue K, Pajukanta P, Doolittle MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "17994020", "url": "https://glygen.org/publication/PubMed/17994020" } ] }, { "title": "Normal binding of lipoprotein lipase, chylomicrons, and apo-AV to GPIHBP1 containing a G56R amino acid substitution.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Gin P, Beigneux AP, Davies B, Young MF, Ryan RO, Bensadoun A, Fong LG, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "17997385", "url": "https://glygen.org/publication/PubMed/17997385" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Oleate stimulates secretion of apolipoprotein B-containing lipoproteins from Hep G2 cells by inhibiting early intracellular degradation of apolipoprotein B.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dixon JL, Furukawa S, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "1848237", "url": "https://glygen.org/publication/PubMed/1848237" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Direct interaction of nuclear liver X receptor-beta with ABCA1 modulates cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hozoji M, Munehira Y, Ikeda Y, Makishima M, Matsuo M, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "18782758", "url": "https://glygen.org/publication/PubMed/18782758" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "Chylomicronemia with a mutant GPIHBP1 (Q115P) that cannot bind lipoprotein lipase.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2009", "authors": "Beigneux AP, Franssen R, Bensadoun A, Gin P, Melford K, Peter J, Walzem RL, Weinstein MM, Davies BS, Kuivenhoven JA, Kastelein JJ, Fong LG, Dallinga-Thie GM, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "19304573", "url": "https://glygen.org/publication/PubMed/19304573" } ] }, { "title": "IFAP syndrome is caused by deficiency in MBTPS2, an intramembrane zinc metalloprotease essential for cholesterol homeostasis and ER stress response.", "journal": "American journal of human genetics", "date": "2009", "authors": "Oeffner F, Fischer G, Happle R, Konig A, Betz RC, Bornholdt D, Neidel U, Boente Mdel C, Redler S, Romero-Gomez J, Salhi A, Vera-Casano A, Weirich C, Grzeschik KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "19361614", "url": "https://glygen.org/publication/PubMed/19361614" } ] }, { "title": "Primary structure of very low density apolipoprotein C-II of human plasma.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1977", "authors": "Jackson RL, Baker HN, Gilliam EB, Gotto AM Jr", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "194244", "url": "https://glygen.org/publication/PubMed/194244" } ] }, { "title": "GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.", "journal": "Molecular cell", "date": "2009", "authors": "Jakobsson T, Venteclef N, Toresson G, Damdimopoulos AE, Ehrlund A, Lou X, Sanyal S, Steffensen KR, Gustafsson JA, Treuter E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "19481530", "url": "https://glygen.org/publication/PubMed/19481530" } ] }, { "title": "Identification of the active form of endothelial lipase, a homodimer in a head-to-tail conformation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Griffon N, Jin W, Petty TJ, Millar J, Badellino KO, Saven JG, Marchadier DH, Kempner ES, Billheimer J, Glick JM, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "19567873", "url": "https://glygen.org/publication/PubMed/19567873" } ] }, { "title": "Lipase maturation factor LMF1, membrane topology and interaction with lipase proteins in the endoplasmic reticulum.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Doolittle MH, Neher SB, Ben-Zeev O, Ling-Liao J, Gallagher CM, Hosseini M, Yin F, Wong H, Walter P, Peterfy M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "19783858", "url": "https://glygen.org/publication/PubMed/19783858" } ] }, { "title": "N-linked glycosylation is required for optimal proteolytic activation of membrane-bound transcription factor CREB-H.", "journal": "Journal of cell science", "date": "2010", "authors": "Chan CP, Mak TY, Chin KT, Ng IO, Jin DY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "20356926", "url": "https://glygen.org/publication/PubMed/20356926" } ] }, { "title": "MicroRNA-33 and the SREBP host genes cooperate to control cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Najafi-Shoushtari SH, Kristo F, Li Y, Shioda T, Cohen DE, Gerszten RE, Naar AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466882", "url": "https://glygen.org/publication/PubMed/20466882" } ] }, { "title": "MiR-33 contributes to the regulation of cholesterol homeostasis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Rayner KJ, Suarez Y, Davalos A, Parathath S, Fitzgerald ML, Tamehiro N, Fisher EA, Moore KJ, Fernandez-Hernando C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20466885", "url": "https://glygen.org/publication/PubMed/20466885" } ] }, { "title": "LXRalpha regulates human CETP expression in vitro and in transgenic mice.", "journal": "Atherosclerosis", "date": "2010", "authors": "Honzumi S, Shima A, Hiroshima A, Koieyama T, Ubukata N, Terasaka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20494359", "url": "https://glygen.org/publication/PubMed/20494359" } ] }, { "title": "miR-33 links SREBP-2 induction to repression of sterol transporters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Marquart TJ, Allen RM, Ory DS, Baldan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20566875", "url": "https://glygen.org/publication/PubMed/20566875" } ] }, { "title": "Angiopoietin-like protein 3 inhibits lipoprotein lipase activity through enhancing its cleavage by proprotein convertases.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Liu J, Afroza H, Rader DJ, Jin W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "20581395", "url": "https://glygen.org/publication/PubMed/20581395" } ] }, { "title": "MicroRNA-33 encoded by an intron of sterol regulatory element-binding protein 2 (Srebp2) regulates HDL in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Horie T, Ono K, Horiguchi M, Nishi H, Nakamura T, Nagao K, Kinoshita M, Kuwabara Y, Marusawa H, Iwanaga Y, Hasegawa K, Yokode M, Kimura T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "20855588", "url": "https://glygen.org/publication/PubMed/20855588" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Constitutive activation of LXR in macrophages regulates metabolic and inflammatory gene expression: identification of ARL7 as a direct target.", "journal": "Journal of lipid research", "date": "2011", "authors": "Hong C, Walczak R, Dhamko H, Bradley MN, Marathe C, Boyadjian R, Salazar JV, Tontonoz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21187453", "url": "https://glygen.org/publication/PubMed/21187453" } ] }, { "title": "MicroRNA hsa-miR-613 targets the human LXRalpha gene and mediates a feedback loop of LXRalpha autoregulation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Ou Z, Wada T, Gramignoli R, Li S, Strom SC, Huang M, Xie W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21310851", "url": "https://glygen.org/publication/PubMed/21310851" } ] }, { "title": "Lipase maturation factor 1 is required for endothelial lipase activity.", "journal": "Journal of lipid research", "date": "2011", "authors": "Ben-Zeev O, Hosseini M, Lai CM, Ehrhardt N, Wong H, Cefalu AB, Noto D, Averna MR, Doolittle MH, Peterfy M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "21447484", "url": "https://glygen.org/publication/PubMed/21447484" } ] }, { "title": "Liver X receptor beta (LXRbeta) interacts directly with ATP-binding cassette A1 (ABCA1) to promote high density lipoprotein formation during acute cholesterol accumulation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Hozoji-Inada M, Munehira Y, Nagao K, Kioka N, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "21507939", "url": "https://glygen.org/publication/PubMed/21507939" } ] }, { "title": "The transcription factor cyclic AMP-responsive element-binding protein H regulates triglyceride metabolism.", "journal": "Nature medicine", "date": "2011", "authors": "Lee JH, Giannikopoulos P, Duncan SA, Wang J, Johansen CT, Brown JD, Plutzky J, Hegele RA, Glimcher LH, Lee AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "21666694", "url": "https://glygen.org/publication/PubMed/21666694" } ] }, { "title": "A key enzyme in the biogenesis of lysosomes is a protease that regulates cholesterol metabolism.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Marschner K, Kollmann K, Schweizer M, Braulke T, Pohl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "21719679", "url": "https://glygen.org/publication/PubMed/21719679" } ] }, { "title": "GPIHBP1, an endothelial cell transporter for lipoprotein lipase.", "journal": "Journal of lipid research", "date": "2011", "authors": "Young SG, Davies BS, Voss CV, Gin P, Weinstein MM, Tontonoz P, Reue K, Bensadoun A, Fong LG, Beigneux AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "21844202", "url": "https://glygen.org/publication/PubMed/21844202" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "Primary structure of the bovine analogues to human apolipoproteins CII and CIII. Studies on isoforms and evidence for proteolytic processing.", "journal": "European journal of biochemistry", "date": "1990-09-11", "authors": "Bengtsson-Olivecrona G, Sletten K", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "2209608", "url": "https://glygen.org/publication/PubMed/2209608" } ] }, { "title": "The role of CREB-H transcription factor in triglyceride metabolism.", "journal": "Current opinion in lipidology", "date": "2012", "authors": "Lee AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "22262056", "url": "https://glygen.org/publication/PubMed/22262056" } ] }, { "title": "A review of the role of apolipoprotein C-II in lipoprotein metabolism and cardiovascular disease.", "journal": "Metabolism: clinical and experimental", "date": "2012-07", "authors": "Kei Anastazia A, Filippatos Theodosios D, Tsimihodimos Vasilios, Elisaf Moses S", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "22304839", "url": "https://glygen.org/publication/PubMed/22304839" } ] }, { "title": "Liver X receptor biology and pharmacology: new pathways, challenges and opportunities.", "journal": "Trends in pharmacological sciences", "date": "2012", "authors": "Jakobsson T, Treuter E, Gustafsson JA, Steffensen KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "22541735", "url": "https://glygen.org/publication/PubMed/22541735" } ] }, { "title": "Identification of RIFL, a novel adipocyte-enriched insulin target gene with a role in lipid metabolism.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2012", "authors": "Ren G, Kim JY, Smas CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "22569073", "url": "https://glygen.org/publication/PubMed/22569073" } ] }, { "title": "MiR-26 controls LXR-dependent cholesterol efflux by targeting ABCA1 and ARL7.", "journal": "FEBS letters", "date": "2012", "authors": "Sun D, Zhang J, Xie J, Wei W, Chen M, Zhao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "22673513", "url": "https://glygen.org/publication/PubMed/22673513" } ] }, { "title": "Cleavage of endometrial alpha-integrins into their functional forms is mediated by proprotein convertase 5/6.", "journal": "Human reproduction (Oxford, England)", "date": "2012", "authors": "Paule S, Aljofan M, Simon C, Rombauts LJ, Nie G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "22740495", "url": "https://glygen.org/publication/PubMed/22740495" } ] }, { "title": "Glycosylphosphatidylinositol-anchored high-density lipoprotein-binding protein 1 and the intravascular processing of triglyceride-rich lipoproteins.", "journal": "Journal of internal medicine", "date": "2012", "authors": "Adeyo O, Goulbourne CN, Bensadoun A, Beigneux AP, Fong LG, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "23020258", "url": "https://glygen.org/publication/PubMed/23020258" } ] }, { "title": "Atypical angiopoietin-like protein that regulates ANGPTL3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Quagliarini F, Wang Y, Kozlitina J, Grishin NV, Hyde R, Boerwinkle E, Valenzuela DM, Murphy AJ, Cohen JC, Hobbs HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "23150577", "url": "https://glygen.org/publication/PubMed/23150577" } ] }, { "title": "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.", "journal": "J. Proteome Res.", "date": "2013", "authors": "Halim A, Ruetschi U, Larson G, Nilsson J", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "23234360", "url": "https://glygen.org/publication/PubMed/23234360" } ] }, { "title": "MicroRNA-613 represses lipogenesis in HepG2 cells by downregulating LXRalpha.", "journal": "Lipids in health and disease", "date": "2013", "authors": "Zhong D, Zhang Y, Zeng YJ, Gao M, Wu GZ, Hu CJ, Huang G, He FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23496987", "url": "https://glygen.org/publication/PubMed/23496987" } ] }, { "title": "MicroRNA-144 regulates hepatic ATP binding cassette transporter A1 and plasma high-density lipoprotein after activation of the nuclear receptor farnesoid X receptor.", "journal": "Circulation research", "date": "2013", "authors": "de Aguiar Vallim TQ, Tarling EJ, Kim T, Civelek M, Baldan A, Esau C, Edwards PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23519696", "url": "https://glygen.org/publication/PubMed/23519696" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P02655", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Cooperative transcriptional activation of ATP-binding cassette sterol transporters ABCG5 and ABCG8 genes by nuclear receptors including Liver-X-Receptor.", "journal": "BMB reports", "date": "2013", "authors": "Back SS, Kim J, Choi D, Lee ES, Choi SY, Han K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "23790976", "url": "https://glygen.org/publication/PubMed/23790976" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "The structure of the human apolipoprotein C-II gene. Electron microscopic analysis of RNA:DNA hybrids, complete nucleotide sequence, and identification of 5' homologous sequences among apolipoprotein genes.", "journal": "J. Biol. Chem.", "date": "1985", "authors": "Wei C F, Tsao Y K, Robberson D L, Gotto A M, Brown K, Chan L", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "2415514", "url": "https://glygen.org/publication/PubMed/2415514" } ] }, { "title": "Regulation of lipoprotein lipase by Angptl4.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "2014", "authors": "Dijk W, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "24397894", "url": "https://glygen.org/publication/PubMed/24397894" } ] }, { "title": "Purification, cellular levels, and functional domains of lipase maturation factor 1.", "journal": "Biochemical and biophysical research communications", "date": "2014", "authors": "Babilonia-Rosa MA, Neher SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "24909692", "url": "https://glygen.org/publication/PubMed/24909692" } ] }, { "title": "Angiopoietin-like proteins 3, 4 and 8: regulating lipid metabolism and providing new hope for metabolic syndrome.", "journal": "Journal of drug targeting", "date": "2014", "authors": "Li Y, Teng C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "24960069", "url": "https://glygen.org/publication/PubMed/24960069" } ] }, { "title": "GPIHBP1 missense mutations often cause multimerization of GPIHBP1 and thereby prevent lipoprotein lipase binding.", "journal": "Circulation research", "date": "2015", "authors": "Beigneux AP, Fong LG, Bensadoun A, Davies BS, Oberer M, Gardsvoll H, Ploug M, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "25387803", "url": "https://glygen.org/publication/PubMed/25387803" } ] }, { "title": "Inactivating Variants in ANGPTL4 and Risk of Coronary Artery Disease.", "journal": "The New England journal of medicine", "date": "2016", "authors": "Dewey FE, Gusarova V, O'Dushlaine C, Gottesman O, Trejos J, Hunt C, Van Hout CV, Habegger L, Buckler D, Lai KM, Leader JB, Murray MF, Ritchie MD, Kirchner HL, Ledbetter DH, Penn J, Lopez A, Borecki IB, Overton JD, Reid JG, Carey DJ, Murphy AJ, Yancopoulos GD, Baras A, Gromada J, Shuldiner AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "26933753", "url": "https://glygen.org/publication/PubMed/26933753" } ] }, { "title": "Coding Variation in ANGPTL4, LPL, and SVEP1 and the Risk of Coronary Disease.", "journal": "The New England journal of medicine", "date": "2016", "authors": "Stitziel NO, Stirrups KE, Masca NG, Erdmann J, Ferrario PG, Konig IR, Weeke PE, Webb TR, Auer PL, Schick UM, Lu Y, Zhang H, Dube MP, Goel A, Farrall M, Peloso GM, Won HH, Do R, van Iperen E, Kanoni S, Kruppa J, Mahajan A, Scott RA, Willenberg C, Braund PS, van Capelleveen JC, Doney AS, Donnelly LA, Asselta R, Merlini PA, Duga S, Marziliano N, Denny JC, Shaffer CM, El-Mokhtari NE, Franke A, Gottesman O, Heilmann S, Hengstenberg C, Hoffman P, Holmen OL, Hveem K, Jansson JH, Jockel KH, Kessler T, Kriebel J, Laugwitz KL, Marouli E, Martinelli N, McCarthy MI, Van Zuydam NR, Meisinger C, Esko T, Mihailov E, Escher SA, Alver M, Moebus S, Morris AD, Muller-Nurasyid M, Nikpay M, Olivieri O, Lemieux Perreault LP, AlQarawi A, Robertson NR, Akinsanya KO, Reilly DF, Vogt TF, Yin W, Asselbergs FW, Kooperberg C, Jackson RD, Stahl E, Strauch K, Varga TV, Waldenberger M, Zeng L, Kraja AT, Liu C, Ehret GB, Newton-Cheh C, Chasman DI, Chowdhury R, Ferrario M, Ford I, Jukema JW, Kee F, Kuulasmaa K, Nordestgaard BG, Perola M, Saleheen D, Sattar N, Surendran P, Tregouet D, Young R, Howson JM, Butterworth AS, Danesh J, Ardissino D, Bottinger EP, Erbel R, Franks PW, Girelli D, Hall AS, Hovingh GK, Kastrati A, Lieb W, Meitinger T, Kraus WE, Shah SH, McPherson R, Orho-Melander M, Melander O, Metspalu A, Palmer CN, Peters A, Rader D, Reilly MP, Loos RJ, Reiner AP, Roden DM, Tardif JC, Thompson JR, Wareham NJ, Watkins H, Willer CJ, Kathiresan S, Deloukas P, Samani NJ, Schunkert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "26934567", "url": "https://glygen.org/publication/PubMed/26934567" } ] }, { "title": "The Genetics of Dyslipidemia--When Less Is More.", "journal": "The New England journal of medicine", "date": "2016", "authors": "Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "26934667", "url": "https://glygen.org/publication/PubMed/26934667" } ] }, { "title": "Serum CETP status is independently associated with reduction rates in LDL-C in pitavastatin-treated diabetic patients and possible involvement of LXR in its association.", "journal": "Lipids in health and disease", "date": "2016", "authors": "Shimada A, Kimura H, Oida K, Kanehara H, Bando Y, Sakamoto S, Wakasugi T, Saga T, Ito Y, Kamiyama K, Mikami D, Iwano M, Hirano T, Yoshida H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "26984517", "url": "https://glygen.org/publication/PubMed/26984517" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2017", "authors": "Nelson JK, Koenis DS, Scheij S, Cook EC, Moeton M, Santos A, Lobaccaro JA, Baron S, Zelcer N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28082258", "url": "https://glygen.org/publication/PubMed/28082258" } ] }, { "title": "Plasma cholesteryl ester transfer protein has binding sites for neutral lipids and phospholipids.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Swenson TL, Brocia RW, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "2833496", "url": "https://glygen.org/publication/PubMed/2833496" } ] }, { "title": "Activation of liver X receptor suppresses angiogenesis via induction of ApoD.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2017", "authors": "Lai CJ, Cheng HC, Lin CY, Huang SH, Chen TH, Chung CJ, Chang CH, Wang HD, Chuu CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28842423", "url": "https://glygen.org/publication/PubMed/28842423" } ] }, { "title": "Critical Role of the Human ATP-Binding Cassette G1 Transporter in Cardiometabolic Diseases.", "journal": "International journal of molecular sciences", "date": "2017", "authors": "Hardy LM, Frisdal E, Le Goff W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "28869506", "url": "https://glygen.org/publication/PubMed/28869506" } ] }, { "title": "Epigenetic regulation of genes involved in the reverse cholesterol transport through interaction with miRNAs.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2018", "authors": "Zaiou M, Rihn BH, Bakillah A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9029569", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569" } ], "reference": [ { "type": "PubMed", "id": "29772548", "url": "https://glygen.org/publication/PubMed/29772548" } ] }, { "title": "Isolation of cDNA and genomic clones for apolipoprotein C-II.", "journal": "Methods Enzymol.", "date": "1986", "authors": "Jackson C L, Bruns G A, Breslow J L", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "3014272", "url": "https://glygen.org/publication/PubMed/3014272" } ] }, { "title": "The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.", "journal": "FEBS Lett.", "date": "1987", "authors": "Fojo SS, Law SW, Brewer HB Jr", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "3030808", "url": "https://glygen.org/publication/PubMed/3030808" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02655", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02655" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02655", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Human preproapolipoprotein C-II. Analysis of major plasma isoforms.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Fojo SS, Taam L, Fairwell T, Ronan R, Bishop C, Meng MS, Hoeg JM, Sprecher DL, Brewer HB Jr", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "3525527", "url": "https://glygen.org/publication/PubMed/3525527" } ] }, { "title": "The human apolipoprotein C-II gene sequence contains a novel chromosome 19-specific minisatellite in its third intron.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Das HK, Jackson CL, Miller DA, Leff T, Breslow JL", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "3558370", "url": "https://glygen.org/publication/PubMed/3558370" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "Sequence Variant Analysis of the APOCII Locus among an Arab Cohort.", "journal": "International journal of molecular sciences", "date": "2023-11-14", "authors": "Al-Bustan Suzanne A, Alrashid Maryam H, Al-Serri Ahmad E, Annice Babitha G, Bahbahani Hussain M", "evidence": [ { "database": "RefSeq", "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" } ], "reference": [ { "type": "PubMed", "id": "38003484", "url": "https://glygen.org/publication/PubMed/38003484" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "A variant primary structure of apolipoprotein C-II in individuals of African descent.", "journal": "The Journal of clinical investigation", "date": "1986", "authors": "Menzel HJ, Kane JP, Malloy MJ, Havel RJ", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "3944271", "url": "https://glygen.org/publication/PubMed/3944271" } ] }, { "title": "A protein cofactor of lecithin:cholesterol acyltransferase.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Fielding CJ, Shore VG, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4335615", "url": "https://glygen.org/publication/PubMed/4335615" } ] }, { "title": "Lecithin: cholesterol acyltransferase: effects of substrate composition upon enzyme activity.", "journal": "Biochimica et biophysica acta", "date": "1972", "authors": "Fielding CJ, Shore VG, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4340992", "url": "https://glygen.org/publication/PubMed/4340992" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Effect of lysolecithin and albumin on lecithin-cholesterol acyltransferase activity in human plasma.", "journal": "Journal of biochemistry", "date": "1973", "authors": "Nakagawa M, Nishida T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4360812", "url": "https://glygen.org/publication/PubMed/4360812" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Transport of lysolecithin by albumin in human and rat plasma.", "journal": "Journal of lipid research", "date": "1965", "authors": "Switzer S, Eder HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "5865378", "url": "https://glygen.org/publication/PubMed/5865378" } ] }, { "title": "Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.", "journal": "Nucleic Acids Res.", "date": "1984", "authors": "Sharpe C R, Sidoli A, Shelley C S, Lucero M A, Shoulders C C, Baralle F E", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "6328445", "url": "https://glygen.org/publication/PubMed/6328445" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "The isolation and characterization of cDNA clones for human apolipoprotein CII.", "journal": "J. Biol. Chem.", "date": "1984", "authors": "Myklebost O, Williamson B, Markham AF, Myklebost SR, Rogers J, Woods DE, Humphries SE", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "6546757", "url": "https://glygen.org/publication/PubMed/6546757" } ] }, { "title": "Human apolipoprotein C-II: complete nucleic acid sequence of preapolipoprotein C-II.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1984", "authors": "Fojo S S, Law S W, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "6593704", "url": "https://glygen.org/publication/PubMed/6593704" } ] }, { "title": "Inter-relationship of lipids transferred by the lipid-transfer protein isolated from human lipoprotein-deficient plasma.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Morton RE, Zilversmit DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "6619141", "url": "https://glygen.org/publication/PubMed/6619141" } ] }, { "title": "Amino acid sequence of human plasma apolipoprotein C-II from normal and hyperlipoproteinemic subjects.", "journal": "J. Biol. Chem.", "date": "1984", "authors": "Hospattankar A V, Fairwell T, Ronan R, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "6706938", "url": "https://glygen.org/publication/PubMed/6706938" } ] }, { "title": "Phospholipid binding studies with synthetic apolipoprotein fragments.", "journal": "Ann. N. Y. Acad. Sci.", "date": "1980", "authors": "Sparrow J T, Gotto A M", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "6772077", "url": "https://glygen.org/publication/PubMed/6772077" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Heparan sulfate proteoglycans are primarily responsible for the maintenance of enzyme activity, binding, and degradation of lipoprotein lipase in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Berryman DE, Bensadoun A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "7592670", "url": "https://glygen.org/publication/PubMed/7592670" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "The apolipoprotein C-II variant apoC-II Lys-19-->Thr is not associated with dyslipidemia in an affected kindred.", "journal": "Clin. Genet.", "date": "1994", "authors": "Zysow B R, Pullinger C R, Hennessy L K, Farese R V, Ghassemzadeh M, Kane J P", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "7923858", "url": "https://glygen.org/publication/PubMed/7923858" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Homology modelling of the catalytic domain of human furin. A model for the eukaryotic subtilisin-like proprotein convertases.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Siezen RJ, Creemers JW, Van de Ven WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "8020465", "url": "https://glygen.org/publication/PubMed/8020465" } ] }, { "title": "A refined three-dimensional solution structure of a carboxy terminal fragment of apolipoprotein CII.", "journal": "Eur. Biophys. J.", "date": "1993", "authors": "Ohman A, Lycksell P O, Gr\u00e4slund A", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "8112221", "url": "https://glygen.org/publication/PubMed/8112221" } ] }, { "title": "Secretion-capture role for apolipoprotein E in remnant lipoprotein metabolism involving cell surface heparan sulfate proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ji ZS, Fazio S, Lee YL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901" } ], "reference": [ { "type": "PubMed", "id": "8300609", "url": "https://glygen.org/publication/PubMed/8300609" } ] }, { "title": "A missense mutation (Trp 26-->Arg) in exon 3 of the apolipoprotein CII gene in a patient with apolipoprotein CII deficiency (apo CII-Wakayama).", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Inadera H, Hibino A, Kobayashi J, Kanzaki T, Shirai K, Yukawa S, Saito Y, Yoshida S", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "8323539", "url": "https://glygen.org/publication/PubMed/8323539" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "Hepatic lipase deficiency. Clinical, biochemical, and molecular genetic characteristics.", "journal": "Arteriosclerosis and thrombosis : a journal of vascular biology", "date": "1993", "authors": "Hegele RA, Little JA, Vezina C, Maguire GF, Tu L, Wolever TS, Jenkins DJ, Connelly PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "8485124", "url": "https://glygen.org/publication/PubMed/8485124" } ] }, { "title": "Molecular cloning and characteristics of a new apolipoprotein C-II mutant identified in three unrelated individuals with hypercholesterolemia and hypertriglyceridemia.", "journal": "Human molecular genetics", "date": "1993", "authors": "Pullinger CR, Zysow BR, Hennessy LK, Frost PH, Malloy MJ, Kane JP", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "reference": [ { "type": "PubMed", "id": "8490626", "url": "https://glygen.org/publication/PubMed/8490626" } ] }, { "title": "Identification and characterization of a new human gene (APOC4) in the apolipoprotein E, C-I, and C-II gene locus.", "journal": "Genomics", "date": "1995", "authors": "Allan CM, Walker D, Segrest JP, Taylor JM", "evidence": [ { "database": "RefSeq", "id": "NP_000474", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000474" } ], "reference": [ { "type": "PubMed", "id": "8530039", "url": "https://glygen.org/publication/PubMed/8530039" } ] }, { "title": "Demonstration of a physical interaction between microsomal triglyceride transfer protein and apolipoprotein B during the assembly of ApoB-containing lipoproteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wu X, Zhou M, Huang LS, Wetterau J, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "8626595", "url": "https://glygen.org/publication/PubMed/8626595" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "Interaction of lipoproteins with heparan sulfate proteoglycans and with lipoprotein lipase. Studies by surface plasmon resonance technique.", "journal": "Biochemistry", "date": "1997", "authors": "Lookene A, Savonen R, Olivecrona G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "9136889", "url": "https://glygen.org/publication/PubMed/9136889" } ] }, { "title": "Hepatic lipase: high-level expression and subunit structure determination.", "journal": "Methods in enzymology", "date": "1997", "authors": "Hill JS, Davis RC, Yang D, Schotz MC, Wong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963889", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889" } ], "reference": [ { "type": "PubMed", "id": "9379936", "url": "https://glygen.org/publication/PubMed/9379936" } ] }, { "title": "Structural and functional properties of two mutants of lecithin-cholesterol acyltransferase (T123I and N228K).", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Adimoolam S, Jin L, Grabbe E, Shieh JJ, Jonas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "9829992", "url": "https://glygen.org/publication/PubMed/9829992" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] } ], "pathway": [ { "id": "hsa:344", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:344", "resource": "KEGG Pathway" }, { "id": "R-HSA-8963888", "name": "Chylomicron assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "resource": "Reactome", "description": "Chylomicron assembly" }, { "id": "R-HSA-8963889", "name": "Assembly of active LPL and LIPC lipase complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963889", "resource": "Reactome", "description": "Assembly of active LPL and LIPC lipase complexes" }, { "id": "R-HSA-8963901", "name": "Chylomicron remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "resource": "Reactome", "description": "Chylomicron remodeling" }, { "id": "R-HSA-8964058", "name": "HDL remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058", "resource": "Reactome", "description": "HDL remodeling" }, { "id": "R-HSA-9029569", "name": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9029569", "resource": "Reactome", "description": "NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux" }, { "id": "R-HSA-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" } ], "orthologs": [ { "uniprot_canonical_ac": "G3V8D4-1", "protein_name": "Apolipoprotein C-II", "gene_name": "Apoc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSRFFLALFLALLVLGNEVQGTEEDDPGSSALLDTVQEHLFSYWNSAKAAAGELYQKTYLTSVDEKLRDMYSKSSAAMTTYAGIFTDQLLTLLKGE", "length": 97 }, "evidence": [ { "id": "45920699", "url": "http://www.informatics.jax.org/homology/45920699", "database": "MGI" }, { "id": "45920698", "url": "http://www.informatics.jax.org/homology/45920698", "database": "MGI" }, { "id": "P02655", "url": "https://omabrowser.org/oma/group/P02655/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q05020-1", "protein_name": "Apolipoprotein C-II", "gene_name": "Apoc2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE", "length": 97 }, "evidence": [ { "id": "45920699", "url": "http://www.informatics.jax.org/homology/45920699", "database": "MGI" }, { "id": "45920698", "url": "http://www.informatics.jax.org/homology/45920698", "database": "MGI" }, { "id": "P02655", "url": "https://omabrowser.org/oma/group/P02655/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "intermediate-density lipoprotein particle", "id": "GO:0034363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034363", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle", "id": "GO:0034361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034361", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "spherical high-density lipoprotein particle", "id": "GO:0034366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034366", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "chylomicron", "id": "GO:0042627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042627", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "low-density lipoprotein particle", "id": "GO:0034362", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034362", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "high-density lipoprotein particle", "id": "GO:0034364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034364", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 22, "go_terms": [ { "name": "positive regulation of triglyceride catabolic process", "id": "GO:0010898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010898", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "phospholipid efflux", "id": "GO:0033700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033700", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "positive regulation of lipoprotein lipase activity", "id": "GO:0051006", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051006", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "lipid catabolic process", "id": "GO:0016042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016042", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "cholesterol efflux", "id": "GO:0033344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033344", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "reverse cholesterol transport", "id": "GO:0043691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043691", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "negative regulation of cholesterol transport", "id": "GO:0032375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032375", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "triglyceride-rich lipoprotein particle remodeling", "id": "GO:0034370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034370", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "chylomicron remodeling", "id": "GO:0034371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034371", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "high-density lipoprotein particle clearance", "id": "GO:0034384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034384", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "positive regulation of very-low-density lipoprotein particle remodeling", "id": "GO:0010902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010902", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle remodeling", "id": "GO:0034372", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034372", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "positive regulation of fatty acid biosynthetic process", "id": "GO:0045723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045723", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "triglyceride homeostasis", "id": "GO:0070328", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070328", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "negative regulation of receptor-mediated endocytosis", "id": "GO:0048261", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048261", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "positive regulation of phospholipase activity", "id": "GO:0010518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010518", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "negative regulation of very-low-density lipoprotein particle clearance", "id": "GO:0010916", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010916", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "chylomicron remnant clearance", "id": "GO:0034382", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034382", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "negative regulation of lipid metabolic process", "id": "GO:0045833", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045833", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "positive regulation of phospholipid catabolic process", "id": "GO:0060697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060697", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "lipase inhibitor activity", "id": "GO:0055102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055102", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "lipoprotein lipase activator activity", "id": "GO:0060230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060230", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "phospholipase activator activity", "id": "GO:0016004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016004", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "phospholipase binding", "id": "GO:0043274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043274", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "molecular function activator activity", "id": "GO:0140677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140677", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "apolipoprotein C-II O-glycosylated 1 (human)", "definition": "An apolipoprotein C-II (human) that has been O-glycosylated at the residue equivalent to Ser-33 of the amino acid sequence represented by UniProtKB:P02655-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02655-1, Ser-33, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052498", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052498" } ] }, { "name": "apolipoprotein C-II O-glycosylated 2 (human)", "definition": "An apolipoprotein C-II (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02655-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02655-1, Thr-23, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052499", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052499" } ] }, { "name": "apolipoprotein C-II O-glycosylated 3 (human)", "definition": "An apolipoprotein C-II (human) that has been O-glycosylated at the residue equivalent to Thr-23 of the amino acid sequence represented by UniProtKB:P02655-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02655-1, Thr-23, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052500", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052500" } ] }, { "name": "apolipoprotein C-II O-glycosylated 4 (human)", "definition": "An apolipoprotein C-II (human) that has been O-glycosylated at the residue equivalent to Thr-35 of the amino acid sequence represented by UniProtKB:P02655-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02655-1, Thr-35, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052501", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052501" } ] }, { "name": "apolipoprotein C-II O-glycosylated 5 (human)", "definition": "An apolipoprotein C-II (human) that has been O-glycosylated at the residue equivalent to Thr-35 of the amino acid sequence represented by UniProtKB:P02655-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02655-1, Thr-35, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052502", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052502" } ] } ], "site_annotation": [], "ptm_annotation": [ { "annotation": "Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" }, { "database": "PubMed", "id": "3525527", "url": "https://glygen.org/publication/PubMed/3525527" } ] }, { "annotation": "Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate apolipoprotein C-II, which occurs as the minor form in plasma.", "evidence": [ { "database": "UniProtKB", "id": "P02655", "url": "https://www.uniprot.org/uniprot/P02655" }, { "database": "PubMed", "id": "3525527", "url": "https://glygen.org/publication/PubMed/3525527" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 23, 33, 35, 42 ], "snv_sites": [ 23, 33, 35 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }