{ "uniprot_canonical_ac": "P02652-1", "uniprot_ac": "P02652", "uniprot_id": "APOA2_HUMAN", "mass": { "chemical_mass": 11175.0, "monoisotopic_mass": 11175.0 }, "refseq": { "ac": "NP_001634", "name": "apolipoprotein A-II preproprotein", "summary": "This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, "gene_names": [ { "name": "APOA2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02652", "id": "P02652" }, { "name": "APOA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634", "id": "NP_001634" }, { "name": "Apo-AII; ApoA-II; apoAII", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634", "id": "NP_001634" }, { "name": "hCG_1766509", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02652", "id": "P02652" } ], "protein_names": [ { "name": "Apolipoprotein A-II", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02652" }, { "name": "Apo-AII", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02652" }, { "name": "ApoA-II", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02652" }, { "name": "Apolipoprotein A-II(1-76)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02652" }, { "name": "Apolipoprotein A2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02652" }, { "name": "apolipoprotein A-II preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634", "id": "NP_001634" }, { "name": "apolipoprotein A-II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634", "id": "NP_001634" } ], "function": [ { "annotation": "Apolipoprotein A2 isoforms associated with exocrine pancreatic insufficiency in early chronic pancreatitis.", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, { "database": "PubMed", "id": "37501507", "url": "https://glygen.org/publication/PubMed/37501507" } ] }, { "annotation": "CETP and APOA2 polymorphisms are associated with weight loss and healthy eating behavior changes in response to digital lifestyle modifications. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, { "database": "PubMed", "id": "38062157", "url": "https://glygen.org/publication/PubMed/38062157" } ] }, { "annotation": "Dietary acid load modifies the effects of ApoA2-265 T > C polymorphism on lipid profile and serum leptin and ghrelin levels among type 2 diabetic patients. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, { "database": "PubMed", "id": "35883173", "url": "https://glygen.org/publication/PubMed/35883173" } ] }, { "annotation": "May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652#function" } ] }, { "annotation": "Resolution of apolipoprotein A1 and A2 proteoforms: their cardiometabolic correlates and implications for future research. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, { "database": "PubMed", "id": "36082946", "url": "https://glygen.org/publication/PubMed/36082946" } ] }, { "annotation": "Spectrum of Apolipoprotein AI and Apolipoprotein AII Proteoforms and Their Associations With Indices of Cardiometabolic Health: The CARDIA Study.", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" }, { "database": "PubMed", "id": "34472376", "url": "https://glygen.org/publication/PubMed/34472376" } ] }, { "annotation": "This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1283206658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1283206658" }, { "id": "rs1283206658", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1283206658" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "1", "chr_pos": "161223009", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766440167", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766440167" }, { "id": "rs766440167", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766440167" }, { "id": "rs766440167", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766440167" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "1", "chr_pos": "161223008", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766440167", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766440167" }, { "id": "rs766440167", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766440167" }, { "id": "rs766440167", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766440167" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "1", "chr_pos": "161223008", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S32", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1803091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1803091#frequency_tab" }, { "id": "rs1803091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1803091" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "1", "chr_pos": "161222490", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1803091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1803091#frequency_tab" }, { "id": "rs1803091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1803091" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "1", "chr_pos": "161222490", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1803091", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1803091" }, { "id": "rs1803091", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1803091#frequency_tab" }, { "id": "rs1803091", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1803091" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "1", "chr_pos": "161222490", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs12824", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs12824" }, { "id": "rs12824", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs12824" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "1", "chr_pos": "161222467", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T81", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1195424854", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1195424854" }, { "id": "rs1195424854", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1195424854" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "1", "chr_pos": "161222412", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T81", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200538010", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200538010" }, { "id": "rs200538010", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200538010" }, { "id": "rs200538010", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200538010#frequency_tab" }, { "id": "rs200538010", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200538010" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "1", "chr_pos": "161222466", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T81", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "69.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "56.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "70.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "52.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "57.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "55.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "59.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "60.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02652", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02652" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "common_name": "Human" } ], "gene": [ { "name": "APOA2", "url": "https://www.uniprot.org/uniprot/P02652", "locus": { "chromosome": "1", "start_pos": 161222292, "end_pos": 161223631, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000158874", "url": "https://www.ensembl.org/id/ENSG00000158874" } ] } } ], "crossref": [ { "id": "ENSG00000158874", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000158874", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "APOA2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APOA2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "336", "url": "https://www.ncbi.nlm.nih.gov/gene/336", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "601", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=601", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02652", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02652*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "V9GYM3", "url": "https://www.ebi.ac.uk/intact/interactors/id:V9GYM3*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006801", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006801", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:336", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:336", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107670", "url": "http://www.omim.org/entry/107670", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02652", "url": "https://www.nextprot.org/entry/NX_P02652", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P02652", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02652", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "SQYFQTM", "url": "https://omabrowser.org/oma/group/SQYFQTM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4610750at2759", "url": "http://www.orthodb.org/?query=4610750at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11027", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11027", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11027:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11027:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04711", "url": "http://pfam.xfam.org/family/PF04711", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02652", "url": "https://pharos.nih.gov/targets/P02652", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052494", "url": "https://proconsortium.org/app/entry/PR:000052494", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052495", "url": "https://proconsortium.org/app/entry/PR:000052495", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052496", "url": "https://proconsortium.org/app/entry/PR:000052496", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052497", "url": "https://proconsortium.org/app/entry/PR:000052497", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P02652", "url": "http://purl.obolibrary.org/obo/PR_P02652", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02652", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02652-1", "url": "https://www.uniprot.org/uniprot/P02652-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q76EI7", "url": "https://www.uniprot.org/uniprot/Q76EI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q76EI7-1", "url": "https://www.uniprot.org/uniprot/Q76EI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYC1", "url": "https://www.uniprot.org/uniprot/V9GYC1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYC1-1", "url": "https://www.uniprot.org/uniprot/V9GYC1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYE3", "url": "https://www.uniprot.org/uniprot/V9GYE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYE3-1", "url": "https://www.uniprot.org/uniprot/V9GYE3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYG9", "url": "https://www.uniprot.org/uniprot/V9GYG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYG9-1", "url": "https://www.uniprot.org/uniprot/V9GYG9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYM3", "url": "https://www.uniprot.org/uniprot/V9GYM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYM3-1", "url": "https://www.uniprot.org/uniprot/V9GYM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYS1", "url": "https://www.uniprot.org/uniprot/V9GYS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYS1-1", "url": "https://www.uniprot.org/uniprot/V9GYS1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYT0", "url": "https://www.uniprot.org/uniprot/V9GYT0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYT0-1", "url": "https://www.uniprot.org/uniprot/V9GYT0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ", "length": 100, "header": "sp|P02652-1|APOA2_HUMAN Isoform 1 of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "isoforms": [ { "isoform_ac": "P02652-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ", "length": 100, "header": "sp|P02652-1|APOA2_HUMAN Isoform 1 of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161222408, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367990.7", "url": "https://www.ensembl.org/id/ENST00000367990.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000356969.3", "url": "https://www.ensembl.org/id/ENSP00000356969.3" } ] } }, { "isoform_ac": "Q76EI7-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGLTLKSQRSS", "length": 27, "header": "tr|Q76EI7-1|Q76EI7_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=2 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161222494, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000491350.1", "url": "https://www.ensembl.org/id/ENST00000491350.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000477353.1", "url": "https://www.ensembl.org/id/ENSP00000477353.1" } ] } }, { "isoform_ac": "V9GYC1-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFE", "length": 66, "header": "tr|V9GYC1-1|V9GYC1_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161222510, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000469730.2", "url": "https://www.ensembl.org/id/ENST00000469730.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000476605.1", "url": "https://www.ensembl.org/id/ENSP00000476605.1" } ] } }, { "isoform_ac": "V9GYE3-1", "url": "", "sequence": { "sequence": "MEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ", "length": 52, "header": "tr|V9GYE3-1|APOA2_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161222958, "end_pos": 161222408, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000463812.1", "url": "https://www.ensembl.org/id/ENST00000463812.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000476890.1", "url": "https://www.ensembl.org/id/ENSP00000476890.1" } ] } }, { "isoform_ac": "V9GYG9-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGT", "length": 95, "header": "tr|V9GYG9-1|APOA2_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161222423, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000463273.5", "url": "https://www.ensembl.org/id/ENST00000463273.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000476740.1", "url": "https://www.ensembl.org/id/ENSP00000476740.1" } ] } }, { "isoform_ac": "V9GYM3-1", "url": "", "sequence": { "sequence": "MCEQHPKRPGLQLWRGREPGWNGQQAALPTVTNMKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ", "length": 133, "header": "tr|V9GYM3-1|APOA2_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223576, "end_pos": 161222408, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000464492.5", "url": "https://www.ensembl.org/id/ENST00000464492.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000476911.1", "url": "https://www.ensembl.org/id/ENSP00000476911.1" } ] } }, { "isoform_ac": "V9GYS1-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFENFLSYFVELGTQPATQ", "length": 82, "header": "tr|V9GYS1-1|V9GYS1_HUMAN Computationally mapped isoform of Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161222408, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000470459.6", "url": "https://www.ensembl.org/id/ENST00000470459.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000477031.1", "url": "https://www.ensembl.org/id/ENSP00000477031.1" } ] } }, { "isoform_ac": "V9GYT0-1", "url": "", "sequence": { "sequence": "MKLLAATVLLLTICSLEGLATKGLKRKIIPSLKPRKPIQRSGWIPFWGGGRELGWVLAEVWQEARIHCCGPS", "length": 72, "header": "tr|V9GYT0-1|V9GYT0_HUMAN Computationally mapped isoform of Apolipoprotein A-II, isoform CRA_a OS=Homo sapiens OX=9606 GN=APOA2 PE=4 SV=1 CANONICAL=P02652-1" }, "locus": { "chromosome": "1", "start_pos": 161223401, "end_pos": 161223103, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000481511.5", "url": "https://www.ensembl.org/id/ENST00000481511.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000477054.1", "url": "https://www.ensembl.org/id/ENSP00000477054.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EPCVESLVSQYFQTVTDYGK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 27, "start_aa": "Glu", "end_pos": 46, "end_aa": "Lys", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 32, "start_aa": "Ser", "end_pos": 32, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser32", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 35, "start_aa": "Ser", "end_pos": 35, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser35", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 35, "start_aa": "Ser", "end_pos": 35, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser35", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 73, "start_aa": "Thr", "end_pos": 73, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr73", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 81, "start_aa": "Thr", "end_pos": 81, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr81", "evidence": [ { "id": "P02652", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P02652", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02652" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] } ], "phosphorylation": [ { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Ser32" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Ser35" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" }, { "database": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ], "site_lbl": "Tyr37" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser54" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ], "site_lbl": "Ser68" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P02652", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P02652", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Hepatitis C virus core protein binds to apolipoprotein AII and its secretion is modulated by fibrates.", "journal": "Hepatology", "date": "1999", "authors": "Sabile A, Perlemuter G, Bono F, Kohara K, Demaugre F, Kohara M, Matsuura Y, Miyamura T, Br\u00e9chot C, Barba G", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "10498661", "url": "https://glygen.org/publication/PubMed/10498661" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Cloning and characterization of a novel apolipoprotein A-I-binding protein, AI-BP, secreted by cells of the kidney proximal tubules in response to HDL or ApoA-I.", "journal": "Genomics", "date": "2002", "authors": "Ritter M, Buechler C, Boettcher A, Barlage S, Schmitz-Madry A, Orso E, Bared SM, Schmiedeknecht G, Baehr CH, Fricker G, Schmitz G", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "11991719", "url": "https://glygen.org/publication/PubMed/11991719" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "Sequence polymorphism at the human apolipoprotein AII gene (APOA2): unexpected deficit of variation in an African-American sample.", "journal": "Hum. Genet.", "date": "2002", "authors": "Fullerton Stephanie M, Clark Andrew G, Weiss Kenneth M, Taylor Scott L, Steng\u00e5rd Jari H, Salomaa Veikko, Boerwinkle Eric, Nickerson Deborah A", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "12136239", "url": "https://glygen.org/publication/PubMed/12136239" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "Structures of apolipoprotein A-II and a lipid-surrogate complex provide insights into apolipoprotein-lipid interactions.", "journal": "Biochemistry", "date": "2002", "authors": "Kumar M Suresh, Carson M, Hussain M Mahmood, Murthy H M Krishna", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "12269810", "url": "https://glygen.org/publication/PubMed/12269810" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "Microsomal triglyceride transfer protein and its role in apoB-lipoprotein assembly.", "journal": "Journal of lipid research", "date": "2003", "authors": "Hussain MM, Shi J, Dreizen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12518019", "url": "https://glygen.org/publication/PubMed/12518019" } ] }, { "title": "Novel mass spectrometric immunoassays for the rapid structural characterization of plasma apolipoproteins.", "journal": "J. Lipid Res.", "date": "2003", "authors": "Niederkofler Eric E, Tubbs Kemmons A, Kiernan Urban A, Nedelkov Dobrin, Nelson Randall W", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "12562854", "url": "https://glygen.org/publication/PubMed/12562854" } ] }, { "title": "Characterization of specifically oxidized apolipoproteins in mildly oxidized high density lipoprotein.", "journal": "Journal of lipid research", "date": "2003", "authors": "Pankhurst G, Wang XL, Wilcken DE, Baernthaler G, Panzenbock U, Raftery M, Stocker R", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "12576517", "url": "https://glygen.org/publication/PubMed/12576517" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.", "journal": "Nature genetics", "date": "2003", "authors": "Jones B, Jones EL, Bonney SA, Patel HN, Mensenkamp AR, Eichenbaum-Voline S, Rudling M, Myrdal U, Annesi G, Naik S, Meadows N, Quattrone A, Islam SA, Naoumova RP, Angelin B, Infante R, Levy E, Roy CC, Freemont PS, Scott J, Shoulders CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12692552", "url": "https://glygen.org/publication/PubMed/12692552" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Microsomal triglyceride transfer protein: a protein complex required for the assembly of lipoprotein particles.", "journal": "Trends in cell biology", "date": "1995", "authors": "Gordon DA, Wetterau JR, Gregg RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "14732096", "url": "https://glygen.org/publication/PubMed/14732096" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Hunter Michael, Angelicheva Dora, Tournev Ivailo, Ingley Evan, Chan Dick C, Watts Gerald F, Kremensky Ivo, Kalaydjieva Luba", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "15922294", "url": "https://glygen.org/publication/PubMed/15922294" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Oleate stimulates secretion of apolipoprotein B-containing lipoproteins from Hep G2 cells by inhibiting early intracellular degradation of apolipoprotein B.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dixon JL, Furukawa S, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "1848237", "url": "https://glygen.org/publication/PubMed/1848237" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "Quantitative analysis of phosphopeptides in search of the disease biomarker from the hepatocellular carcinoma specimen.", "journal": "Proteomics", "date": "2009", "authors": "Lee HJ, Na K, Kwon MS, Kim H, Kim KS, Paik YK", "evidence": [ { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" } ], "reference": [ { "type": "PubMed", "id": "19562805", "url": "https://glygen.org/publication/PubMed/19562805" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "An initial characterization of the serum phosphoproteome.", "journal": "Journal of proteome research", "date": "2009", "authors": "Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" } ], "reference": [ { "type": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "A splice-junction mutation responsible for familial apolipoprotein A-II deficiency.", "journal": "Am. J. Hum. Genet.", "date": "1990", "authors": "Deeb SS, Takata K, Peng RL, Kajiyama G, Albers JJ", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "2107739", "url": "https://glygen.org/publication/PubMed/2107739" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.", "journal": "Journal of proteome research", "date": "2013", "authors": "Halim A, Ruetschi U, Larson G, Nilsson J", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "23234360", "url": "https://glygen.org/publication/PubMed/23234360" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P02652", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "Expression and purification of recombinant human apolipoprotein A-II in Pichia pastoris.", "journal": "Assay and drug development technologies", "date": "2013", "authors": "Su M, Qi Y, Wang M, Chang W, Peng S, Xu T, Wang D", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "24116940", "url": "https://glygen.org/publication/PubMed/24116940" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P02652", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P02652", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02652" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "The human apolipoprotein A-II gene: complete nucleic acid sequence and genomic organization.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Lackner K J, Law S W, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "2989800", "url": "https://glygen.org/publication/PubMed/2989800" } ] }, { "title": "The human apolipoprotein AII gene: structural organization and sites of expression.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Knott T J, Wallis S C, Robertson M E, Priestley L M, Urdea M, Rall L B, Scott J", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "2995928", "url": "https://glygen.org/publication/PubMed/2995928" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P02652", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Molecular cloning and sequence analysis of human apolipoprotein A-II cDNA.", "journal": "Methods Enzymol.", "date": "1986", "authors": "Chan L, Moore M N, Tsao Y K", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "3088392", "url": "https://glygen.org/publication/PubMed/3088392" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P02652", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P02652" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Spectrum of Apolipoprotein AI and Apolipoprotein AII Proteoforms and Their Associations With Indices of Cardiometabolic Health: The CARDIA Study.", "journal": "Journal of the American Heart Association", "date": "2021", "authors": "Wilkins JT, Seckler HS, Rink J, Compton PD, Fornelli L, Thaxton CS, LeDuc R, Jacobs D, Doubleday PF, Sniderman A, Lloyd-Jones DM, Kelleher NL", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ], "reference": [ { "type": "PubMed", "id": "34472376", "url": "https://glygen.org/publication/PubMed/34472376" } ] }, { "title": "Dietary acid load modifies the effects of ApoA2-265 T > C polymorphism on lipid profile and serum leptin and ghrelin levels among type 2 diabetic patients.", "journal": "BMC endocrine disorders", "date": "2022", "authors": "Abaj F, Esmaeily Z, Naeini Z, Rafiee M, Koohdani F", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ], "reference": [ { "type": "PubMed", "id": "35883173", "url": "https://glygen.org/publication/PubMed/35883173" } ] }, { "title": "Resolution of apolipoprotein A1 and A2 proteoforms: their cardiometabolic correlates and implications for future research.", "journal": "Current opinion in lipidology", "date": "2022", "authors": "Wilkins JT, Rohatgi A", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ], "reference": [ { "type": "PubMed", "id": "36082946", "url": "https://glygen.org/publication/PubMed/36082946" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "Apolipoprotein A2 isoforms associated with exocrine pancreatic insufficiency in early chronic pancreatitis.", "journal": "Journal of gastroenterology and hepatology", "date": "2023-07-27", "authors": "Futagami Seiji, Agawa Shuhei, Nakamura Ken, Watanabe Yoshiyuki, Habiro Mayu, Kawawa Rie, Yamawaki Hiroshi, Tsushima Rina, Kirita Kumiko, Akimoto Teppei, Ueki Nobue, Tomohide Tanabe, Itokawa Norio, Suzuki Nami, Naito Yutaka, Takeuchi Keiko, Kashiro Ayumi, Ohta Ryu, Mizutani Satoshi, Taniai Nobuhiko, Yoshida Hiroshi, Iwakiri Katsuhiko, Honda Kazufumi", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ], "reference": [ { "type": "PubMed", "id": "37501507", "url": "https://glygen.org/publication/PubMed/37501507" } ] }, { "title": "CETP and APOA2 polymorphisms are associated with weight loss and healthy eating behavior changes in response to digital lifestyle modifications.", "journal": "Scientific reports", "date": "2023-12-07", "authors": "Kim Meelim, Lee Seolha, Cho Eun, Hong Kyung-Won, You So-Jin, Choi Hyung Jin", "evidence": [ { "database": "RefSeq", "id": "NP_001634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001634" } ], "reference": [ { "type": "PubMed", "id": "38062157", "url": "https://glygen.org/publication/PubMed/38062157" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "Isolation and characterization of the tryptic and cyanogen bromide peptides of apoLp-Gln-II (apoA-II), plasma high density apolipoprotein.", "journal": "The Journal of biological chemistry", "date": "1972", "authors": "Lux SE, John KM, Ronan R, Brewer HB Jr", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "4344225", "url": "https://glygen.org/publication/PubMed/4344225" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Human apolipoprotein A-II: nucleotide sequence of a cloned cDNA, and localization of its structural gene on human chromosome 1.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1984", "authors": "Moore M N, Kao F T, Tsao Y K, Chan L", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "6089788", "url": "https://glygen.org/publication/PubMed/6089788" } ] }, { "title": "Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.", "journal": "Nucleic Acids Res.", "date": "1984", "authors": "Sharpe C R, Sidoli A, Shelley C S, Lucero M A, Shoulders C C, Baralle F E", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "6328445", "url": "https://glygen.org/publication/PubMed/6328445" } ] }, { "title": "Cell-free translation of human liver apolipoprotein AI and AII mRNA. Processing of primary translation products.", "journal": "Hoppe-Seyler's Z. Physiol. Chem.", "date": "1983", "authors": "Stoffel W, Kr\u00fcger E, Deutzmann R", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "6407957", "url": "https://glygen.org/publication/PubMed/6407957" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "Isolation and characterisation of a cDNA encoding the precursor for human apolipoprotein AII.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1984", "authors": "Knott T J, Priestley L M, Urdea M, Scott J", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "6428397", "url": "https://glygen.org/publication/PubMed/6428397" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "Structure of human apolipoprotein D: locations of the intermolecular and intramolecular disulfide links.", "journal": "Biochemistry", "date": "1994", "authors": "Yang CY, Gu ZW, Blanco-Vaca F, Gaskell SJ, Yang M, Massey JB, Gotto AM Jr, Pownall HJ", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "reference": [ { "type": "PubMed", "id": "7918467", "url": "https://glygen.org/publication/PubMed/7918467" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Secretion-capture role for apolipoprotein E in remnant lipoprotein metabolism involving cell surface heparan sulfate proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ji ZS, Fazio S, Lee YL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901" } ], "reference": [ { "type": "PubMed", "id": "8300609", "url": "https://glygen.org/publication/PubMed/8300609" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "Demonstration of a physical interaction between microsomal triglyceride transfer protein and apolipoprotein B during the assembly of ApoB-containing lipoproteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wu X, Zhou M, Huang LS, Wetterau J, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "8626595", "url": "https://glygen.org/publication/PubMed/8626595" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] } ], "pathway": [ { "id": "hsa:336", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:336", "resource": "KEGG Pathway" }, { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-8963888", "name": "Chylomicron assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "resource": "Reactome", "description": "Chylomicron assembly" }, { "id": "R-HSA-8963901", "name": "Chylomicron remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "resource": "Reactome", "description": "Chylomicron remodeling" }, { "id": "R-HSA-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" } ], "orthologs": [ { "uniprot_canonical_ac": "P04638-1", "protein_name": "Apolipoprotein A-II", "gene_name": "Apoa2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK", "length": 102 }, "evidence": [ { "id": "45923416", "url": "http://www.informatics.jax.org/homology/45923416", "database": "MGI" }, { "id": "P02652", "url": "https://omabrowser.org/oma/group/P02652/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P09813-1", "protein_name": "Apolipoprotein A-II", "gene_name": "Apoa2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK", "length": 102 }, "evidence": [ { "id": "45923416", "url": "http://www.informatics.jax.org/homology/45923416", "database": "MGI" }, { "id": "P02652", "url": "https://omabrowser.org/oma/group/P02652/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle", "id": "GO:0034364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034364", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle", "id": "GO:0034361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034361", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "spherical high-density lipoprotein particle", "id": "GO:0034366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034366", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "chylomicron", "id": "GO:0042627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042627", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 38, "go_terms": [ { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "lipoprotein metabolic process", "id": "GO:0042157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042157", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "triglyceride metabolic process", "id": "GO:0006641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006641", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phospholipid efflux", "id": "GO:0033700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033700", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phospholipid catabolic process", "id": "GO:0009395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009395", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of lipid catabolic process", "id": "GO:0050995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050995", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "positive regulation of CoA-transferase activity", "id": "GO:1905920", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905920", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "response to glucocorticoid", "id": "GO:0051384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051384", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phosphatidylcholine biosynthetic process", "id": "GO:0006656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006656", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol efflux", "id": "GO:0033344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033344", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "low-density lipoprotein particle remodeling", "id": "GO:0034374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034374", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle remodeling", "id": "GO:0034375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034375", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "reverse cholesterol transport", "id": "GO:0043691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043691", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "regulation of protein stability", "id": "GO:0031647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031647", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "positive regulation of phagocytosis", "id": "GO:0050766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050766", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle assembly", "id": "GO:0034380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034380", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "response to glucose", "id": "GO:0009749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009749", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of very-low-density lipoprotein particle remodeling", "id": "GO:0010903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010903", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "protein oxidation", "id": "GO:0018158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018158", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "peptidyl-methionine modification", "id": "GO:0018206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018206", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "regulation of intestinal cholesterol absorption", "id": "GO:0030300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030300", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "animal organ regeneration", "id": "GO:0031100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031100", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of cholesterol transport", "id": "GO:0032375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032375", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "triglyceride-rich lipoprotein particle remodeling", "id": "GO:0034370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034370", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle clearance", "id": "GO:0034384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034384", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "response to estrogen", "id": "GO:0043627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043627", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "diacylglycerol catabolic process", "id": "GO:0046340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046340", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "positive regulation of lipid catabolic process", "id": "GO:0050996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050996", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of lipase activity", "id": "GO:0060192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060192", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of cholesterol import", "id": "GO:0060621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060621", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of cholesterol transporter activity", "id": "GO:0060695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060695", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol transport", "id": "GO:0030301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030301", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "negative regulation of cytokine production involved in immune response", "id": "GO:0002719", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002719", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "lipid transporter activity", "id": "GO:0005319", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005319", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phospholipid binding", "id": "GO:0005543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "heat shock protein binding", "id": "GO:0031072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031072", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol binding", "id": "GO:0015485", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015485", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle binding", "id": "GO:0008035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008035", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phosphatidylcholine binding", "id": "GO:0031210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031210", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "apolipoprotein receptor binding", "id": "GO:0034190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034190", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "lipase inhibitor activity", "id": "GO:0055102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055102", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "phosphatidylcholine-sterol O-acyltransferase activator activity", "id": "GO:0060228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060228", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "high-density lipoprotein particle receptor binding", "id": "GO:0070653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070653", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" }, { "name": "cholesterol transfer activity", "id": "GO:0120020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120020", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "apolipoprotein A-II O-glycosylated 1 (human)", "definition": "An apolipoprotein A-II (human) that has been O-glycosylated at the residue equivalent to Ser-32 of the amino acid sequence represented by UniProtKB:P02652-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02652-1, Ser-32, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052494", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052494" } ] }, { "name": "apolipoprotein A-II O-glycosylated 2 (human)", "definition": "An apolipoprotein A-II (human) that has been O-glycosylated at the residue equivalent to Ser-35 of the amino acid sequence represented by UniProtKB:P02652-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P02652-1, Ser-35, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052495", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052495" } ] }, { "name": "apolipoprotein A-II O-glycosylated 3 (human)", "definition": "An apolipoprotein A-II (human) that has been O-glycosylated at the residue equivalent to Ser-35 of the amino acid sequence represented by UniProtKB:P02652-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P02652-1, Ser-35, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052496", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052496" } ] }, { "name": "apolipoprotein A-II O-glycosylated 4 (human)", "definition": "An apolipoprotein A-II (human) that has been O-glycosylated at the residue equivalent to Thr-42 of the amino acid sequence represented by UniProtKB:P02652-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P02652-1, Thr-42, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052497", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052497" } ] } ], "site_annotation": [], "ptm_annotation": [ { "annotation": "Apolipoprotein A-II is O-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "PubMed", "id": "23234360", "url": "https://glygen.org/publication/PubMed/23234360" } ] }, { "annotation": "Phosphorylation sites are present in the extracellular medium.", "evidence": [ { "database": "UniProtKB", "id": "P02652", "url": "https://www.uniprot.org/uniprot/P02652" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 27, 32, 35, 42, 73, 81 ], "snv_sites": [ 32, 73, 81 ], "glycation_sites": [], "phosphorylation_sites": [ 32, 35, 37, 54, 68 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 160 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }