{ "uniprot_canonical_ac": "P02647-1", "uniprot_ac": "P02647", "uniprot_id": "APOA1_HUMAN", "mass": { "chemical_mass": 30778.0, "monoisotopic_mass": 30778.0 }, "refseq": { "ac": "NP_000030", "name": "apolipoprotein A-I isoform 1 preproprotein", "summary": "This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" }, "gene_names": [ { "name": "APOA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02647", "id": "P02647" }, { "name": "APOA1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030", "id": "NP_000030" }, { "name": "apo(a); HPALP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030", "id": "NP_000030" } ], "protein_names": [ { "name": "Apolipoprotein A-I", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02647" }, { "name": "Apo-AI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02647" }, { "name": "ApoA-I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02647" }, { "name": "Apolipoprotein A-I(1-242)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02647" }, { "name": "Apolipoprotein A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02647" }, { "name": "apo-AI; epididymis secretory sperm binding protein; apolipoprotein A-I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030", "id": "NP_000030" }, { "name": "apolipoprotein A-I isoform 1 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030", "id": "NP_000030" } ], "function": [ { "annotation": "FOXM1 Participates in Scleral Remodeling in Myopia by Upregulating APOA1 Expression Through METTL3/YTHDF2.", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" }, { "database": "PubMed", "id": "38190128", "url": "https://glygen.org/publication/PubMed/38190128" } ] }, { "annotation": "Follicular Fluid Proteomic Analysis of Women Undergoing Assisted Reproduction Suggests That Apolipoprotein A1 Is a Potential Fertility Marker. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" }, { "database": "PubMed", "id": "38203658", "url": "https://glygen.org/publication/PubMed/38203658" } ] }, { "annotation": "Interactions of variants of human apolipoprotein A-I with biopolymeric model matrices. Effect of collagen and heparin.", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" }, { "database": "PubMed", "id": "37913855", "url": "https://glygen.org/publication/PubMed/37913855" } ] }, { "annotation": "Low serum apolipoprotein A1 level predicts poor prognosis of patients with diffuse large B-cell lymphoma in the real world: a retrospective study. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" }, { "database": "PubMed", "id": "38212711", "url": "https://glygen.org/publication/PubMed/38212711" } ] }, { "annotation": "Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.", "evidence": [ { "database": "UniProtKB", "id": "F8W696", "url": "https://www.uniprot.org/uniprot/F8W696#function" }, { "database": "UniProtKB", "id": "ARBA00037354", "url": "https://www.uniprot.org/uniprot/ARBA00037354#function" }, { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647#function" }, { "database": "PubMed", "id": "1909888", "url": "https://glygen.org/publication/PubMed/1909888" } ] }, { "annotation": "This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" } ] } ], "disease": [ { "disease_id": "DOID:0050636", "recommended_name": { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "familial visceral amyloidosis", "description": "An amyloidosis that is characterized by the abnormal deposition of amyloid proteins that is located_in the visceral organs, primarily the kidneys." }, "synonyms": [ { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "AMYLOIDOSIS, FAMILIAL RENAL", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "German type amyloidosis", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "OSTERTAG TYPE AMYLOIDOSIS", "description": "" }, { "id": "DOID:0050636", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050636", "name": "systemic nonneuropathic amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial visceral amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "German type amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "Ostertag type amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, 3 or more types", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, Ostertag type", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, familial renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial amyloid nephropathy", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "familial renal amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary amyloid nephropathy", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary renal amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "systemic nonneuropathic amyloidosis", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis 8", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis VIII", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis familial renal", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis familial visceral", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis systemic nonneuropathic", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, familial visceral", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "amyloidosis, systemic Nonneuropathic", "description": "" }, { "id": "MONDO:0007099", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007099", "name": "hereditary amyloidosis with primary renal involement", "description": "" }, { "id": "MIM:105200", "resource": "MIM", "url": "https://www.omim.org/entry/105200", "name": "Amyloidosis 8", "description": "Amyloidosis 8" } ], "evidence": [ { "id": "105200", "database": "MIM", "url": "https://www.omim.org/entry/105200" } ] }, { "disease_id": "DOID:0080958", "recommended_name": { "id": "DOID:0080958", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080958", "name": "primary hypoalphalipoproteinemia 2", "description": "A hypolipoproteinemia that is characterized by dysfunctional apoA-I production, resulting in undetectable levels of apoA-I in serum and in markedly low levels of serum high density lipoprotein cholesterol, is generally an autosomal recessive disorder associated with extensive atherosclerosis, xanthomas, and corneal opacities, and that has_material_basis_in homozygous, compound heterozygous, or heterozygous mutation in the APOA1 gene on chromosome 11q23." }, "synonyms": [ { "id": "DOID:0080958", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080958", "name": "Apolipoprotein A-I deficiency", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "hypoalphalipoproteinemia, primary, 2", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "ApoA-I and apoC-III deficiency, combined", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "HYPOALPHALIPOPROTEINEMIA, PRIMARY, 2", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "hypoalphalipoproteinemia, primary, 2, with or without corneal clouding", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "Apolipoprotein A-I Deficiency", "description": "" }, { "id": "MONDO:0032766", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032766", "name": "High Density Lipoprotein Deficiency", "description": "" }, { "id": "MIM:618463", "resource": "MIM", "url": "https://www.omim.org/entry/618463", "name": "Hypoalphalipoproteinemia, primary, 2", "description": "Hypoalphalipoproteinemia, primary, 2" } ], "evidence": [ { "id": "618463", "database": "MIM", "url": "https://www.omim.org/entry/618463" } ] }, { "disease_id": "MONDO:0859238", "recommended_name": { "id": "MONDO:0859238", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859238", "name": "hypoalphalipoproteinemia, primary, 2, intermediate", "description": "" }, "synonyms": [ { "id": "MIM:619836", "resource": "MIM", "url": "https://www.omim.org/entry/619836", "name": "Hypoalphalipoproteinemia, primary, 2, intermediate", "description": "Hypoalphalipoproteinemia, primary, 2, intermediate" } ], "evidence": [ { "id": "619836", "database": "MIM", "url": "https://www.omim.org/entry/619836" } ] }, { "disease_id": "MONDO:0859290", "recommended_name": { "id": "MONDO:0859290", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859290", "name": "familial apolipoprotein gene cluster deletion syndrome", "description": "" }, "synonyms": [ { "id": "MIM:620058", "resource": "MIM", "url": "https://www.omim.org/entry/620058", "name": "Familial apolipoprotein gene cluster deletion syndrome", "description": "Familial apolipoprotein gene cluster deletion syndrome" } ], "evidence": [ { "id": "620058", "database": "MIM", "url": "https://www.omim.org/entry/620058" } ] } ], "snv": [ { "evidence": [ { "id": "rs141429250", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141429250" }, { "id": "rs141429250", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141429250" }, { "id": "rs141429250", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141429250#frequency_tab" }, { "id": "rs141429250", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141429250" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 164, "end_pos": 164, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KLS->NLS).", "chr_id": "11", "chr_pos": "116836120", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K164", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781667498", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781667498" }, { "id": "rs781667498", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781667498" }, { "id": "rs781667498", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781667498" }, { "id": "rs1366071713", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1366071713" }, { "id": "rs1366071713", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1366071713#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 228, "end_pos": 228, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "11", "chr_pos": "116835928", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S228", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1226109269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1226109269" }, { "id": "rs1226109269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1226109269#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT).", "chr_id": "11", "chr_pos": "116836385", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S76", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "68.68", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "57.81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "65.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "64.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "68.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "52.59", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "63.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "70.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "63.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "59.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P02647", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P02647" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "common_name": "Human" } ], "gene": [ { "name": "APOA1", "url": "https://www.uniprot.org/uniprot/P02647", "locus": { "chromosome": "11", "start_pos": 6870, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_767", "url": "https://www.ensembl.org/id/LRG_767" } ] } } ], "crossref": [ { "id": "ENSG00000118137", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118137", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5984", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5984", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "APOA1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=APOA1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "335", "url": "https://www.ncbi.nlm.nih.gov/gene/335", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "600", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=600", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P02647", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02647*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000074", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000074", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:335", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:335", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "105200", "url": "http://www.omim.org/entry/105200", "database": "MIM", "categories": [ "Other" ] }, { "id": "107680", "url": "http://www.omim.org/entry/107680", "database": "MIM", "categories": [ "Other" ] }, { "id": "618463", "url": "http://www.omim.org/entry/618463", "database": "MIM", "categories": [ "Other" ] }, { "id": "619836", "url": "http://www.omim.org/entry/619836", "database": "MIM", "categories": [ "Other" ] }, { "id": "620058", "url": "http://www.omim.org/entry/620058", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P02647", "url": "https://www.nextprot.org/entry/NX_P02647", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "TQARSFW", "url": "https://omabrowser.org/oma/group/TQARSFW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5310876at2759", "url": "http://www.orthodb.org/?query=5310876at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18976", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18976", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18976:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18976:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1AV1", "url": "https://www.rcsb.org/structure/1AV1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GW3", "url": "https://www.rcsb.org/structure/1GW3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GW4", "url": "https://www.rcsb.org/structure/1GW4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ODP", "url": "https://www.rcsb.org/structure/1ODP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ODQ", "url": "https://www.rcsb.org/structure/1ODQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ODR", "url": "https://www.rcsb.org/structure/1ODR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MSC", "url": "https://www.rcsb.org/structure/2MSC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MSD", "url": "https://www.rcsb.org/structure/2MSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MSE", "url": "https://www.rcsb.org/structure/2MSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N5E", "url": "https://www.rcsb.org/structure/2N5E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3K2S", "url": "https://www.rcsb.org/structure/3K2S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3R2P", "url": "https://www.rcsb.org/structure/3R2P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4V6M", "url": "https://www.rcsb.org/structure/4V6M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CC9", "url": "https://www.rcsb.org/structure/6CC9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CCH", "url": "https://www.rcsb.org/structure/6CCH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CCX", "url": "https://www.rcsb.org/structure/6CCX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CLZ", "url": "https://www.rcsb.org/structure/6CLZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CM1", "url": "https://www.rcsb.org/structure/6CM1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PTS", "url": "https://www.rcsb.org/structure/6PTS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PTW", "url": "https://www.rcsb.org/structure/6PTW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6W4E", "url": "https://www.rcsb.org/structure/6W4E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6W4F", "url": "https://www.rcsb.org/structure/6W4F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KJR", "url": "https://www.rcsb.org/structure/7KJR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RSC", "url": "https://www.rcsb.org/structure/7RSC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RSE", "url": "https://www.rcsb.org/structure/7RSE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8EQS", "url": "https://www.rcsb.org/structure/8EQS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01442", "url": "http://pfam.xfam.org/family/PF01442", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P02647", "url": "https://pharos.nih.gov/targets/P02647", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P02647", "url": "http://purl.obolibrary.org/obo/PR_P02647", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5682113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02647", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "F8W696", "url": "https://www.uniprot.org/uniprot/F8W696", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W696-1", "url": "https://www.uniprot.org/uniprot/F8W696-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02647-1", "url": "https://www.uniprot.org/uniprot/P02647-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ", "length": 267, "header": "sp|P02647-1|APOA1_HUMAN Isoform 1 of Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1 CANONICAL=P02647-1" }, "isoforms": [ { "isoform_ac": "F8W696-1", "url": "", "sequence": { "sequence": "MSGGARGFCMLKAPHSARPFFSSRSPTALQDESCGADLGRALPDGLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ", "length": 245, "header": "tr|F8W696-1|APOA1_HUMAN Computationally mapped isoform of Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1 CANONICAL=P02647-1" }, "locus": { "chromosome": "11", "start_pos": 116837478, "end_pos": 116835811, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000375329.6", "url": "https://www.ensembl.org/id/ENST00000375329.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000364478.2", "url": "https://www.ensembl.org/id/ENSP00000364478.2" } ] } }, { "isoform_ac": "P02647-1", "url": "", "sequence": { "sequence": "MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ", "length": 267, "header": "sp|P02647-1|APOA1_HUMAN Isoform 1 of Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1 CANONICAL=P02647-1" }, "locus": { "chromosome": "11", "start_pos": 116837387, "end_pos": 116835811, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000375323.5", "url": "https://www.ensembl.org/id/ENST00000375323.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000364472.1", "url": "https://www.ensembl.org/id/ENSP00000364472.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ATEHLSTLSEK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 220, "start_aa": "Ala", "end_pos": 230, "end_aa": "Lys", "evidence": [ { "id": "P02647", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 221, "start_aa": "Thr", "end_pos": 221, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr221", "evidence": [ { "id": "P02647", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 228, "start_aa": "Ser", "end_pos": 228, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser228", "evidence": [ { "id": "P02647", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] } ], "phosphorylation": [ { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ], "site_lbl": "Ser166" }, { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ], "site_lbl": "Thr185" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Ser191" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ], "site_lbl": "Thr221" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ], "site_lbl": "Ser252" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" }, { "database": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ], "site_lbl": "Ser55" } ], "glycation": [ { "start_pos": 263, "end_pos": 263, "glytoucan_ac": "", "type": "N-linked", "residue": "Lys", "comment": "N-linked (Glc) (glycation) lysine", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647#ptm_processing" }, { "database": "PubMed", "id": "8261628", "url": "https://glygen.org/publication/PubMed/8261628" } ], "relation": "attached" } ], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycatedprotein", "glycatedprotein_reported" ], "publication": [ { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "evidence": [ { "database": "UniCarbKB", "id": "P02647", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://glygen.org/publication/DOI/10.1021/acs.analchem.6b02887" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P02647", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "The binding and transport of heme by hemopexin.", "journal": "Annals of clinical research", "date": "1976", "authors": "Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1008494", "url": "https://glygen.org/publication/PubMed/1008494" } ] }, { "title": "Constitutive and regulated alpha-secretase cleavage of Alzheimer's amyloid precursor protein by a disintegrin metalloprotease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lammich S, Kojro E, Postina R, Gilbert S, Pfeiffer R, Jasionowski M, Haass C, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10097139", "url": "https://glygen.org/publication/PubMed/10097139" } ] }, { "title": "Uptake and fate of class B scavenger receptor ligands in HepG2 cells.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Rhainds D, Falstrault L, Tremblay C, Brissette L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10103054", "url": "https://glygen.org/publication/PubMed/10103054" } ] }, { "title": "A novel apolipoprotein A-1 variant, Arg173Pro, associated with cardiac and cutaneous amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Hamidi Asl K, Liepnieks JJ, Nakamura M, Parker F, Benson MD", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "10198255", "url": "https://glygen.org/publication/PubMed/10198255" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Role of the scavenger receptor MARCO in alveolar macrophage binding of unopsonized environmental particles.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Palecanda A, Paulauskis J, Al-Mutairi E, Imrich A, Qin G, Suzuki H, Kodama T, Tryggvason K, Koziel H, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10224290", "url": "https://glygen.org/publication/PubMed/10224290" } ] }, { "title": "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions.", "journal": "Nature genetics", "date": "1999", "authors": "Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, Margolis RL, Troncoso JC, Lanahan AA, Worley PF, Dawson VL, Dawson TM, Ross CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10319874", "url": "https://glygen.org/publication/PubMed/10319874" } ] }, { "title": "The intrinsic factor-vitamin B12 receptor, cubilin, is a high-affinity apolipoprotein A-I receptor facilitating endocytosis of high-density lipoprotein.", "journal": "Nature medicine", "date": "1999", "authors": "Kozyraki R, Fyfe J, Kristiansen M, Gerdes C, Jacobsen C, Cui S, Christensen EI, Aminoff M, de la Chapelle A, Krahe R, Verroust PJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011" } ], "reference": [ { "type": "PubMed", "id": "10371504", "url": "https://glygen.org/publication/PubMed/10371504" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "A stop-codon mutation in the BRI gene associated with familial British dementia.", "journal": "Nature", "date": "1999", "authors": "Vidal R, Frangione B, Rostagno A, Mead S, Revesz T, Plant G, Ghiso J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10391242", "url": "https://glygen.org/publication/PubMed/10391242" } ] }, { "title": "Medin: an integral fragment of aortic smooth muscle cell-produced lactadherin forms the most common human amyloid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Haggqvist B, Naslund J, Sletten K, Westermark GT, Mucchiano G, Tjernberg LO, Nordstedt C, Engstrom U, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10411933", "url": "https://glygen.org/publication/PubMed/10411933" } ] }, { "title": "Mutations in ABC1 in Tangier disease and familial high-density lipoprotein deficiency.", "journal": "Nature genetics", "date": "1999", "authors": "Brooks-Wilson A, Marcil M, Clee SM, Zhang LH, Roomp K, van Dam M, Yu L, Brewer C, Collins JA, Molhuizen HO, Loubser O, Ouelette BF, Fichter K, Ashbourne-Excoffon KJ, Sensen CW, Scherer S, Mott S, Denis M, Martindale D, Frohlich J, Morgan K, Koop B, Pimstone S, Kastelein JJ, Genest J Jr, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5682113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113" } ], "reference": [ { "type": "PubMed", "id": "10431236", "url": "https://glygen.org/publication/PubMed/10431236" } ] }, { "title": "The new apolipoprotein A-I variant leu(174) --> Ser causes hereditary cardiac amyloidosis, and the amyloid fibrils are constituted by the 93-residue N-terminal polypeptide.", "journal": "The American journal of pathology", "date": "1999", "authors": "Obici L, Bellotti V, Mangione P, Stoppini M, Arbustini E, Verga L, Zorzoli I, Anesi E, Zanotti G, Campana C, Vigano M, Merlini G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "10487826", "url": "https://glygen.org/publication/PubMed/10487826" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "Homo- and heterodimerization of peroxisomal ATP-binding cassette half-transporters.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Liu LX, Janvier K, Berteaux-Lecellier V, Cartier N, Benarous R, Aubourg P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "10551832", "url": "https://glygen.org/publication/PubMed/10551832" } ] }, { "title": "Interactions of Alzheimer amyloid-beta peptides with glycosaminoglycans effects on fibril nucleation and growth.", "journal": "European journal of biochemistry", "date": "1999", "authors": "McLaurin J, Franklin T, Zhang X, Deng J, Fraser PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10583407", "url": "https://glygen.org/publication/PubMed/10583407" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Molecular characterization of a human scavenger receptor, human MARCO.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Elshourbagy NA, Li X, Terrett J, Vanhorn S, Gross MS, Adamou JE, Anderson KM, Webb CL, Lysko PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10651831", "url": "https://glygen.org/publication/PubMed/10651831" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Selective adhesion of macrophages to denatured forms of type I collagen is mediated by scavenger receptors.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2000", "authors": "Gowen BB, Borg TK, Ghaffar A, Mayer EP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10686426", "url": "https://glygen.org/publication/PubMed/10686426" } ] }, { "title": "PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Sacksteder KA, Jones JM, South ST, Li X, Liu Y, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "10704444", "url": "https://glygen.org/publication/PubMed/10704444" } ] }, { "title": "Macrophage class A scavenger receptor-mediated phagocytosis of Escherichia coli: role of cell heterogeneity, microbial strain, and culture conditions in vitro.", "journal": "Infection and immunity", "date": "2000", "authors": "Peiser L, Gough PJ, Kodama T, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "10722588", "url": "https://glygen.org/publication/PubMed/10722588" } ] }, { "title": "The binding of oxidized low density lipoprotein to mouse CD36 is mediated in part by oxidized phospholipids that are associated with both the lipid and protein moieties of the lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boullier A, Gillotte KL, Horkko S, Green SR, Friedman P, Dennis EA, Witztum JL, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10734051", "url": "https://glygen.org/publication/PubMed/10734051" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "Macrophage scavenger receptor CD36 is the major receptor for LDL modified by monocyte-generated reactive nitrogen species.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Podrez EA, Febbraio M, Sheibani N, Schmitt D, Silverstein RL, Hajjar DP, Cohen PA, Frazier WA, Hoff HF, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10772654", "url": "https://glygen.org/publication/PubMed/10772654" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Human adrenoleukodystrophy protein and related peroxisomal ABC transporters interact with the peroxisomal assembly protein PEX19p.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Gloeckner CJ, Mayerhofer PU, Landgraf P, Muntau AC, Holzinger A, Gerber JK, Kammerer S, Adamski J, Roscher AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "10777694", "url": "https://glygen.org/publication/PubMed/10777694" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Identification of a novel human sterol-sensitive ATP-binding cassette transporter (ABCA7).", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Kaminski WE, Orso E, Diederich W, Klucken J, Drobnik W, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "10873640", "url": "https://glygen.org/publication/PubMed/10873640" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "Oxidized LDL-induced NF-kappa B activation and subsequent expression of proinflammatory genes are defective in monocyte-derived macrophages from CD36-deficient patients.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2000", "authors": "Janabi M, Yamashita S, Hirano K, Sakai N, Hiraoka H, Matsumoto K, Zhang Z, Nozaki S, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "10938017", "url": "https://glygen.org/publication/PubMed/10938017" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "A furin-like convertase mediates propeptide cleavage of BACE, the Alzheimer's beta -secretase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bennett BD, Denis P, Haniu M, Teplow DB, Kahn S, Louis JC, Citron M, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "10956649", "url": "https://glygen.org/publication/PubMed/10956649" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "Genomic organization of the human cholesterol-responsive ABC transporter ABCA7: tandem linkage with the minor histocompatibility antigen HA-1 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Kaminski WE, Piehler A, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11095984", "url": "https://glygen.org/publication/PubMed/11095984" } ] }, { "title": "Accumulation of dietary cholesterol in sitosterolemia caused by mutations in adjacent ABC transporters.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Berge KE, Tian H, Graf GA, Yu L, Grishin NV, Schultz J, Kwiterovich P, Shan B, Barnes R, Hobbs HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11099417", "url": "https://glygen.org/publication/PubMed/11099417" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Complete coding sequence, promoter region, and genomic structure of the human ABCA2 gene and evidence for sterol-dependent regulation in macrophages.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Kaminski WE, Piehler A, Pullmann K, Porsch-Ozcurumez M, Duong C, Bared GM, Buchler C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11178988", "url": "https://glygen.org/publication/PubMed/11178988" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Identification of the haemoglobin scavenger receptor.", "journal": "Nature", "date": "2001", "authors": "Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11196644", "url": "https://glygen.org/publication/PubMed/11196644" } ] }, { "title": "Characterization and functional analysis of the nucleotide binding fold in human peroxisomal ATP binding cassette transporters.", "journal": "FEBS letters", "date": "2001", "authors": "Roerig P, Mayerhofer P, Holzinger A, Gartner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11248239", "url": "https://glygen.org/publication/PubMed/11248239" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Phosphorylation regulates intracellular trafficking of beta-secretase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Walter J, Fluhrer R, Hartung B, Willem M, Kaether C, Capell A, Lammich S, Multhaup G, Haass C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11278841", "url": "https://glygen.org/publication/PubMed/11278841" } ] }, { "title": "Characterization of a 95 kDa high affinity human high density lipoprotein-binding protein.", "journal": "Biochemistry", "date": "2001", "authors": "Bocharov AV, Vishnyakova TG, Baranova IN, Patterson AP, Eggerman TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011" } ], "reference": [ { "type": "PubMed", "id": "11284697", "url": "https://glygen.org/publication/PubMed/11284697" } ] }, { "title": "Cloning and characterization of human adenosine 5'-triphosphate-binding cassette, sub-family A, transporter 2 (ABCA2).", "journal": "Cancer research", "date": "2001", "authors": "Vulevic B, Chen Z, Boyd JT, Davis W Jr, Walsh ES, Belinsky MG, Tew KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11309290", "url": "https://glygen.org/publication/PubMed/11309290" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "Heme mediates derepression of Maf recognition element through direct binding to transcription repressor Bach1.", "journal": "The EMBO journal", "date": "2001", "authors": "Ogawa K, Sun J, Taketani S, Nakajima O, Nishitani C, Sassa S, Hayashi N, Yamamoto M, Shibahara S, Fujita H, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "11387216", "url": "https://glygen.org/publication/PubMed/11387216" } ] }, { "title": "A new human hereditary amyloidosis: the result of a stop-codon mutation in the apolipoprotein AII gene.", "journal": "Genomics", "date": "2001", "authors": "Benson MD, Liepnieks JJ, Yazaki M, Yamashita T, Hamidi Asl K, Guenther B, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11401442", "url": "https://glygen.org/publication/PubMed/11401442" } ] }, { "title": "Codeposition of apolipoprotein A-IV and transthyretin in senile systemic (ATTR) amyloidosis.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bergstrom J, Murphy C, Eulitz M, Weiss DT, Westermark GT, Solomon A, Westermark P", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11467836", "url": "https://glygen.org/publication/PubMed/11467836" } ] }, { "title": "Homogeneous assay based on 52 primer sets to scan for mutations of the ABCA1 gene and its application in genetic analysis of a new patient with familial high-density lipoprotein deficiency syndrome.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Lapicka-Bodzioch K, Bodzioch M, Krull M, Kielar D, Probst M, Kiec B, Andrikovics H, Bottcher A, Hubacek J, Aslanidis C, Suttorp N, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5682113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113" } ], "reference": [ { "type": "PubMed", "id": "11476961", "url": "https://glygen.org/publication/PubMed/11476961" } ] }, { "title": "ABCA6, a novel a subclass ABC transporter.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Kaminski WE, Wenzel JJ, Piehler A, Langmann T, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11478798", "url": "https://glygen.org/publication/PubMed/11478798" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "The cellular biology of scavenger receptor class B type I.", "journal": "Current opinion in lipidology", "date": "2001", "authors": "Silver DL, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011" } ], "reference": [ { "type": "PubMed", "id": "11561168", "url": "https://glygen.org/publication/PubMed/11561168" } ] }, { "title": "The membrane-type collectin CL-P1 is a scavenger receptor on vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ohtani K, Suzuki Y, Eda S, Kawai T, Kase T, Keshi H, Sakai Y, Fukuoh A, Sakamoto T, Itabe H, Suzutani T, Ogasawara M, Yoshida I, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "11564734", "url": "https://glygen.org/publication/PubMed/11564734" } ] }, { "title": "Parkin ubiquitinates the alpha-synuclein-interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease.", "journal": "Nature medicine", "date": "2001", "authors": "Chung KK, Zhang Y, Lim KL, Tanaka Y, Huang H, Gao J, Ross CA, Dawson VL, Dawson TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "11590439", "url": "https://glygen.org/publication/PubMed/11590439" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "The human ABCG4 gene is regulated by oxysterols and retinoids in monocyte-derived macrophages.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Engel T, Lorkowski S, Lueken A, Rust S, Schluter B, Berger G, Cullen P, Assmann G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11606068", "url": "https://glygen.org/publication/PubMed/11606068" } ] }, { "title": "ABCA3 is a lamellar body membrane protein in human lung alveolar type II cells.", "journal": "FEBS letters", "date": "2001", "authors": "Yamano G, Funahashi H, Kawanami O, Zhao LX, Ban N, Uchida Y, Morohoshi T, Ogawa J, Shioda S, Inagaki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "11718719", "url": "https://glygen.org/publication/PubMed/11718719" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Arginine residues in domain V have a central role for bacteria-binding activity of macrophage scavenger receptor MARCO.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Brannstrom A, Sankala M, Tryggvason K, Pikkarainen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "11820786", "url": "https://glygen.org/publication/PubMed/11820786" } ] }, { "title": "Reconstituted discoidal ApoE-phospholipid particles are ligands for the scavenger receptor BI. The amino-terminal 1-165 domain of ApoE suffices for receptor binding.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Kan HY, Lavrentiadou S, Krieger M, Zannis V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11861652", "url": "https://glygen.org/publication/PubMed/11861652" } ] }, { "title": "Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties.", "journal": "Blood", "date": "2002", "authors": "Allhorn M, Berggard T, Nordberg J, Olsson ML, Akerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11877257", "url": "https://glygen.org/publication/PubMed/11877257" } ] }, { "title": "Binding of serum amyloid P-component (SAP) by amyloid fibrils.", "journal": "Clinical and experimental immunology", "date": "1979", "authors": "Pepys MB, Dyck RF, de Beer FC, Skinner M, Cohen AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "118839", "url": "https://glygen.org/publication/PubMed/118839" } ] }, { "title": "CD36 mediates the cardiovascular action of growth hormone-releasing peptides in the heart.", "journal": "Circulation research", "date": "2002", "authors": "Bodart V, Febbraio M, Demers A, McNicoll N, Pohankova P, Perreault A, Sejlitz T, Escher E, Silverstein RL, Lamontagne D, Ong H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "11988484", "url": "https://glygen.org/publication/PubMed/11988484" } ] }, { "title": "Cloning and characterization of a novel apolipoprotein A-I-binding protein, AI-BP, secreted by cells of the kidney proximal tubules in response to HDL or ApoA-I.", "journal": "Genomics", "date": "2002", "authors": "Ritter M, Buechler C, Boettcher A, Barlage S, Schmitz-Madry A, Orso E, Bared SM, Schmiedeknecht G, Baehr CH, Fricker G, Schmitz G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "11991719", "url": "https://glygen.org/publication/PubMed/11991719" } ] }, { "title": "Misdiagnosis of hereditary amyloidosis as AL (primary) amyloidosis.", "journal": "The New England journal of medicine", "date": "2002", "authors": "Lachmann HJ, Booth DR, Booth SE, Bybee A, Gilbertson JA, Gillmore JD, Pepys MB, Hawkins PN", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "12050338", "url": "https://glygen.org/publication/PubMed/12050338" } ] }, { "title": "Identification of a novel family of oxidized phospholipids that serve as ligands for the macrophage scavenger receptor CD36.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Podrez EA, Poliakov E, Shen Z, Zhang R, Deng Y, Sun M, Finton PJ, Shan L, Gugiu B, Fox PL, Hoff HF, Salomon RG, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12105195", "url": "https://glygen.org/publication/PubMed/12105195" } ] }, { "title": "Double deletions and missense mutations in the first nucleotide-binding fold of the ATP-binding cassette transporter A1 ( ABCA1) gene in Japanese patients with Tangier disease.", "journal": "Journal of human genetics", "date": "2002", "authors": "Guo Z, Inazu A, Yu W, Suzumura T, Okamoto M, Nohara A, Higashikata T, Sano R, Wakasugi K, Hayakawa T, Yoshida K, Suehiro T, Schmitz G, Mabuchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5682113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113" } ], "reference": [ { "type": "PubMed", "id": "12111381", "url": "https://glygen.org/publication/PubMed/12111381" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "Pro-oxidant and cytotoxic effects of circulating heme.", "journal": "Blood", "date": "2002", "authors": "Jeney V, Balla J, Yachie A, Varga Z, Vercellotti GM, Eaton JW, Balla G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12130498", "url": "https://glygen.org/publication/PubMed/12130498" } ] }, { "title": "Lipid free apolipoprotein E binds to the class B Type I scavenger receptor I (SR-BI) and enhances cholesteryl ester uptake from lipoproteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Bultel-Brienne S, Lestavel S, Pilon A, Laffont I, Tailleux A, Fruchart JC, Siest G, Clavey V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12138091", "url": "https://glygen.org/publication/PubMed/12138091" } ] }, { "title": "Molecular structure of a novel cholesterol-responsive A subclass ABC transporter, ABCA9.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Piehler A, Kaminski WE, Wenzel JJ, Langmann T, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12150964", "url": "https://glygen.org/publication/PubMed/12150964" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "ABCG4: a novel human white family ABC-transporter expressed in the brain and eye.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Oldfield S, Lowry C, Ruddick J, Lightman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12183068", "url": "https://glygen.org/publication/PubMed/12183068" } ] }, { "title": "Protein kinase A site-specific phosphorylation regulates ATP-binding cassette A1 (ABCA1)-mediated phospholipid efflux.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "See RH, Caday-Malcolm RA, Singaraja RR, Zhou S, Silverston A, Huber MT, Moran J, James ER, Janoo R, Savill JM, Rigot V, Zhang LH, Wang M, Chimini G, Wellington CL, Tafuri SR, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "12196520", "url": "https://glygen.org/publication/PubMed/12196520" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "Hemoprotein Bach1 regulates enhancer availability of heme oxygenase-1 gene.", "journal": "The EMBO journal", "date": "2002", "authors": "Sun J, Hoshino H, Takaku K, Nakajima O, Muto A, Suzuki H, Tashiro S, Takahashi S, Shibahara S, Alam J, Taketo MM, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12356737", "url": "https://glygen.org/publication/PubMed/12356737" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Loss of calbindin-D28k from aging human cholinergic basal forebrain: relation to neuronal loss.", "journal": "The Journal of comparative neurology", "date": "2003", "authors": "Geula C, Bu J, Nagykery N, Scinto LF, Chan J, Joseph J, Parker R, Wu CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "12454989", "url": "https://glygen.org/publication/PubMed/12454989" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "The class A scavenger receptor binds to proteoglycans and mediates adhesion of macrophages to the extracellular matrix.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Santiago-Garcia J, Kodama T, Pitas RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12488451", "url": "https://glygen.org/publication/PubMed/12488451" } ] }, { "title": "Cloning of human and rat ABCA5/Abca5 and detection of a human splice variant.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Petry F, Kotthaus A, Hirsch-Ernst KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12504089", "url": "https://glygen.org/publication/PubMed/12504089" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "Effects of mutations of ABCA1 in the first extracellular domain on subcellular trafficking and ATP binding/hydrolysis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tanaka AR, Abe-Dohmae S, Ohnishi T, Aoki R, Morinaga G, Okuhira K, Ikeda Y, Kano F, Matsuo M, Kioka N, Amachi T, Murata M, Yokoyama S, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5682113", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113" } ], "reference": [ { "type": "PubMed", "id": "12509412", "url": "https://glygen.org/publication/PubMed/12509412" } ] }, { "title": "Role of ABC transporters in secretion of cholesterol from liver into bile.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Small DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12509503", "url": "https://glygen.org/publication/PubMed/12509503" } ] }, { "title": "Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kitamuro T, Takahashi K, Ogawa K, Udono-Fujimori R, Takeda K, Furuyama K, Nakayama M, Sun J, Fujita H, Hida W, Hattori T, Shirato K, Igarashi K, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12511571", "url": "https://glygen.org/publication/PubMed/12511571" } ] }, { "title": "Microsomal triglyceride transfer protein and its role in apoB-lipoprotein assembly.", "journal": "Journal of lipid research", "date": "2003", "authors": "Hussain MM, Shi J, Dreizen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12518019", "url": "https://glygen.org/publication/PubMed/12518019" } ] }, { "title": "Kinetics of deoxyhemoglobin subunit dissociation determined by haptoglobin binding: estimation of the equilibrium constant from forward and reverse rates.", "journal": "Biochemistry", "date": "1976", "authors": "Ip SH, Johnson ML, Ackers GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1252417", "url": "https://glygen.org/publication/PubMed/1252417" } ] }, { "title": "Novel mass spectrometric immunoassays for the rapid structural characterization of plasma apolipoproteins.", "journal": "J. Lipid Res.", "date": "2003", "authors": "Niederkofler Eric E, Tubbs Kemmons A, Kiernan Urban A, Nedelkov Dobrin, Nelson Randall W", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "12562854", "url": "https://glygen.org/publication/PubMed/12562854" } ] }, { "title": "Characterization of specifically oxidized apolipoproteins in mildly oxidized high density lipoprotein.", "journal": "Journal of lipid research", "date": "2003", "authors": "Pankhurst G, Wang XL, Wilcken DE, Baernthaler G, Panzenbock U, Raftery M, Stocker R", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "12576517", "url": "https://glygen.org/publication/PubMed/12576517" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "Binding and internalization of lipopolysaccharide by Cla-1, a human orthologue of rodent scavenger receptor B1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Vishnyakova TG, Bocharov AV, Baranova IN, Chen Z, Remaley AT, Csako G, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12651854", "url": "https://glygen.org/publication/PubMed/12651854" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.", "journal": "Nature genetics", "date": "2003", "authors": "Jones B, Jones EL, Bonney SA, Patel HN, Mensenkamp AR, Eichenbaum-Voline S, Rudling M, Myrdal U, Annesi G, Naik S, Meadows N, Quattrone A, Islam SA, Naoumova RP, Angelin B, Infante R, Levy E, Roy CC, Freemont PS, Scott J, Shoulders CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "12692552", "url": "https://glygen.org/publication/PubMed/12692552" } ] }, { "title": "Isolation and partial characterization of SAA-an amyloid-related protein from human serum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Rosenthal CJ, Franklin EC, Frangione B, Greenspan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1270801", "url": "https://glygen.org/publication/PubMed/1270801" } ] }, { "title": "SRCL/CL-P1 recognizes GalNAc and a carcinoma-associated antigen, Tn antigen.", "journal": "Journal of biochemistry", "date": "2003", "authors": "Yoshida T, Tsuruta Y, Iwasaki M, Yamane S, Ochi T, Suzuki R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12761161", "url": "https://glygen.org/publication/PubMed/12761161" } ] }, { "title": "Oxidative stress impairs endocytosis of the scavenger receptor class A.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Aguilar-Gaytan R, Mas-Oliva J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12763022", "url": "https://glygen.org/publication/PubMed/12763022" } ] }, { "title": "The role of the high-density lipoprotein receptor SR-BI in the lipid metabolism of endocrine and other tissues.", "journal": "Endocrine reviews", "date": "2003", "authors": "Rigotti A, Miettinen HE, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011" } ], "reference": [ { "type": "PubMed", "id": "12788804", "url": "https://glygen.org/publication/PubMed/12788804" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "ABCA10, a novel cholesterol-regulated ABCA6-like ABC transporter.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Wenzel JJ, Kaminski WE, Piehler A, Heimerl S, Langmann T, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12821155", "url": "https://glygen.org/publication/PubMed/12821155" } ] }, { "title": "Identification of uteroglobin-related protein 1 and macrophage scavenger receptor with collagenous structure as a lung-specific ligand-receptor pair.", "journal": "J. Immunol.", "date": "2003", "authors": "Bin LH, Nielson LD, Liu X, Mason RJ, Shu HB", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" }, { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "12847263", "url": "https://glygen.org/publication/PubMed/12847263" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "ATP-binding cassette transporter A7 (ABCA7) binds apolipoprotein A-I and mediates cellular phospholipid but not cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wang N, Lan D, Gerbod-Giannone M, Linsel-Nitschke P, Jehle AW, Chen W, Martinez LO, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "12917409", "url": "https://glygen.org/publication/PubMed/12917409" } ] }, { "title": "Endocytosis of oxidized low density lipoprotein through scavenger receptor CD36 utilizes a lipid raft pathway that does not require caveolin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zeng Y, Tao N, Chung KN, Heuser JE, Lublin DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "12947091", "url": "https://glygen.org/publication/PubMed/12947091" } ] }, { "title": "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors.", "journal": "Human molecular genetics", "date": "2003", "authors": "Morabia A, Cayanis E, Costanza MC, Ross BM, Flaherty MS, Alvin GB, Das K, Gilliam TC", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "12966036", "url": "https://glygen.org/publication/PubMed/12966036" } ] }, { "title": "[Isolation of the haptoglobin-hemoglobin complex in human blood in homogenous state. II].", "journal": "Bulletin de la Societe de chimie biologique", "date": "1956", "authors": "JAYLE MF, BOUSSIER G, TONNELAT J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13342742", "url": "https://glygen.org/publication/PubMed/13342742" } ] }, { "title": "Molecular flypaper, atherosclerosis, and host defense: structure and function of the macrophage scavenger receptor.", "journal": "Cold Spring Harbor symposia on quantitative biology", "date": "1992", "authors": "Krieger M, Abrams JM, Lux A, Steller H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "1339697", "url": "https://glygen.org/publication/PubMed/1339697" } ] }, { "title": "The binding of haemoglobin by plasma proteins (haptoglobins); its bearing on the renal threshold for haemoglobin and the aetiology of haemoglobinuria.", "journal": "British medical journal", "date": "1957", "authors": "ALLISON AC, REES WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13472068", "url": "https://glygen.org/publication/PubMed/13472068" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Siah-1 facilitates ubiquitination and degradation of synphilin-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nagano Y, Yamashita H, Takahashi T, Kishida S, Nakamura T, Iseki E, Hattori N, Mizuno Y, Kikuchi A, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14506261", "url": "https://glygen.org/publication/PubMed/14506261" } ] }, { "title": "Phospholipid transfer protein interacts with and stabilizes ATP-binding cassette transporter A1 and enhances cholesterol efflux from cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oram JF, Wolfbauer G, Vaughan AM, Tang C, Albers JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "14559902", "url": "https://glygen.org/publication/PubMed/14559902" } ] }, { "title": "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins.", "journal": "Biochemistry", "date": "2003", "authors": "He X, Zhu G, Koelsch G, Rodgers KK, Zhang XC, Tang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "14567678", "url": "https://glygen.org/publication/PubMed/14567678" } ] }, { "title": "Human ABCA7 supports apolipoprotein-mediated release of cellular cholesterol and phospholipid to generate high density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Abe-Dohmae S, Ikeda Y, Matsuo M, Hayashi M, Okuhira K, Ueda K, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "14570867", "url": "https://glygen.org/publication/PubMed/14570867" } ] }, { "title": "Posttranscriptional regulation of human ABCA7 and its function for the apoA-I-dependent lipid release.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Ikeda Y, Abe-Dohmae S, Munehira Y, Aoki R, Kawamoto S, Furuya A, Shitara K, Amachi T, Kioka N, Matsuo M, Yokoyama S, Ueda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "14592415", "url": "https://glygen.org/publication/PubMed/14592415" } ] }, { "title": "Scavenger receptor-A mediates gp96/GRP94 and calreticulin internalization by antigen-presenting cells.", "journal": "The EMBO journal", "date": "2003", "authors": "Berwin B, Hart JP, Rice S, Gass C, Pizzo SV, Post SR, Nicchitta CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "14609958", "url": "https://glygen.org/publication/PubMed/14609958" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "High density lipoprotein uptake by scavenger receptor SR-BII.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Eckhardt ER, Cai L, Sun B, Webb NR, van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "14726519", "url": "https://glygen.org/publication/PubMed/14726519" } ] }, { "title": "Microsomal triglyceride transfer protein: a protein complex required for the assembly of lipoprotein particles.", "journal": "Trends in cell biology", "date": "1995", "authors": "Gordon DA, Wetterau JR, Gregg RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "14732096", "url": "https://glygen.org/publication/PubMed/14732096" } ] }, { "title": "PEX3 functions as a PEX19 docking factor in the import of class I peroxisomal membrane proteins.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Fang Y, Morrell JC, Jones JM, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "15007061", "url": "https://glygen.org/publication/PubMed/15007061" } ] }, { "title": "Apolipoprotein AI mutation Arg-60 causes autosomal dominant amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Soutar AK, Hawkins PN, Vigushin DM, Tennent GA, Booth SE, Hutton T, Nguyen O, Totty NF, Feest TG, Hsuan JJ, et al.", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "1502149", "url": "https://glygen.org/publication/PubMed/1502149" } ] }, { "title": "ABCA3 gene mutations in newborns with fatal surfactant deficiency.", "journal": "The New England journal of medicine", "date": "2004", "authors": "Shulenin S, Nogee LM, Annilo T, Wert SE, Whitsett JA, Dean M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "15044640", "url": "https://glygen.org/publication/PubMed/15044640" } ] }, { "title": "Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Liani E, Eyal A, Avraham E, Shemer R, Szargel R, Berg D, Bornemann A, Riess O, Ross CA, Rott R, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15064394", "url": "https://glygen.org/publication/PubMed/15064394" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "The effects of scale: variation in the APOA1/C3/A4/A5 gene cluster.", "journal": "Hum. Genet.", "date": "2004", "authors": "Fullerton SM, Buchanan AV, Sonpar VA, Taylor SL, Smith JD, Carlson CS, Salomaa V, Stengard JH, Boerwinkle E, Clark AG, Nickerson DA, Weiss KM", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "15108119", "url": "https://glygen.org/publication/PubMed/15108119" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.", "journal": "The EMBO journal", "date": "2004", "authors": "Suzuki H, Tashiro S, Hira S, Sun J, Yamazaki C, Zenke Y, Ikeda-Saito M, Yoshida M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "15175654", "url": "https://glygen.org/publication/PubMed/15175654" } ] }, { "title": "ATP-binding cassette (ABC) transporters in human metabolism and diseases.", "journal": "Physiological research", "date": "2004", "authors": "Stefkova J, Poledne R, Hubacek JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "15209530", "url": "https://glygen.org/publication/PubMed/15209530" } ] }, { "title": "Characterization of oligomeric human ATP binding cassette transporter A1. Potential implications for determining the structure of nascent high density lipoprotein particles.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Denis M, Haidar B, Marcil M, Bouvier M, Krimbou L, Genest J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "15280376", "url": "https://glygen.org/publication/PubMed/15280376" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Madsen M, Moller HJ, Nielsen MJ, Jacobsen C, Graversen JH, van den Berg T, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15448162", "url": "https://glygen.org/publication/PubMed/15448162" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "The lipocalin alpha(1)-microglobulin binds heme in different species.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "Larsson J, Allhorn M, Kerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15542058", "url": "https://glygen.org/publication/PubMed/15542058" } ] }, { "title": "Serum amyloid A binding to CLA-1 (CD36 and LIMPII analogous-1) mediates serum amyloid A protein-induced activation of ERK1/2 and p38 mitogen-activated protein kinases.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Baranova IN, Vishnyakova TG, Bocharov AV, Kurlander R, Chen Z, Kimelman ML, Remaley AT, Csako G, Thomas F, Eggerman TL, Patterson AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15576377", "url": "https://glygen.org/publication/PubMed/15576377" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "CD36 is a sensor of diacylglycerides.", "journal": "Nature", "date": "2005", "authors": "Hoebe K, Georgel P, Rutschmann S, Du X, Mudd S, Crozat K, Sovath S, Shamel L, Hartung T, Zahringer U, Beutler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15690042", "url": "https://glygen.org/publication/PubMed/15690042" } ] }, { "title": "pH- and metal ion-linked stability of the hemopexin-heme complex.", "journal": "Biochemistry", "date": "2005", "authors": "Rosell FI, Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15697213", "url": "https://glygen.org/publication/PubMed/15697213" } ] }, { "title": "Endocytosis is not required for the selective lipid uptake mediated by murine SR-BI.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Nieland TJ, Ehrlich M, Krieger M, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "15866482", "url": "https://glygen.org/publication/PubMed/15866482" } ] }, { "title": "NDRG1 interacts with APO A-I and A-II and is a functional candidate for the HDL-C QTL on 8q24.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Hunter Michael, Angelicheva Dora, Tournev Ivailo, Ingley Evan, Chan Dick C, Watts Gerald F, Kremensky Ivo, Kalaydjieva Luba", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "15922294", "url": "https://glygen.org/publication/PubMed/15922294" } ] }, { "title": "Identification of the receptor scavenging hemopexin-heme complexes.", "journal": "Blood", "date": "2005", "authors": "Hvidberg V, Maniecki MB, Jacobsen C, Hojrup P, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15947085", "url": "https://glygen.org/publication/PubMed/15947085" } ] }, { "title": "Senile seminal vesicle amyloid is derived from semenogelin I.", "journal": "The Journal of laboratory and clinical medicine", "date": "2005", "authors": "Linke RP, Joswig R, Murphy CL, Wang S, Zhou H, Gross U, Rocken C, Westermark P, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "15962837", "url": "https://glygen.org/publication/PubMed/15962837" } ] }, { "title": "ABCG1 redistributes cell cholesterol to domains removable by high density lipoprotein but not by lipid-depleted apolipoproteins.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Vaughan AM, Oram JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "15994327", "url": "https://glygen.org/publication/PubMed/15994327" } ] }, { "title": "Mutations in lipid transporter ABCA12 in harlequin ichthyosis and functional recovery by corrective gene transfer.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Akiyama M, Sugiyama-Nakagiri Y, Sakai K, McMillan JR, Goto M, Arita K, Tsuji-Abe Y, Tabata N, Matsuoka K, Sasaki R, Sawamura D, Shimizu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "16007253", "url": "https://glygen.org/publication/PubMed/16007253" } ] }, { "title": "Human high density lipoproteins are platforms for the assembly of multi-component innate immune complexes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shiflett AM, Bishop JR, Pahwa A, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16046400", "url": "https://glygen.org/publication/PubMed/16046400" } ] }, { "title": "Neuronal sorting protein-related receptor sorLA/LR11 regulates processing of the amyloid precursor protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Andersen OM, Reiche J, Schmidt V, Gotthardt M, Spoelgen R, Behlke J, von Arnim CA, Breiderhoff T, Jansen P, Wu X, Bales KR, Cappai R, Masters CL, Gliemann J, Mufson EJ, Hyman BT, Paul SM, Nykjaer A, Willnow TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16174740", "url": "https://glygen.org/publication/PubMed/16174740" } ] }, { "title": "CD163 is the macrophage scavenger receptor for native and chemically modified hemoglobins in the absence of haptoglobin.", "journal": "Blood", "date": "2006", "authors": "Schaer DJ, Schaer CA, Buehler PW, Boykins RA, Schoedon G, Alayash AI, Schaffner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16189277", "url": "https://glygen.org/publication/PubMed/16189277" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "MARCO is the major binding receptor for unopsonized particles and bacteria on human alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Arredouani MS, Palecanda A, Koziel H, Huang YC, Imrich A, Sulahian TH, Ning YY, Yang Z, Pikkarainen T, Sankala M, Vargas SO, Takeya M, Tryggvason K, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16237101", "url": "https://glygen.org/publication/PubMed/16237101" } ] }, { "title": "CD36 involvement in orosensory detection of dietary lipids, spontaneous fat preference, and digestive secretions.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Laugerette F, Passilly-Degrace P, Patris B, Niot I, Febbraio M, Montmayeur JP, Besnard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16276419", "url": "https://glygen.org/publication/PubMed/16276419" } ] }, { "title": "Description of the torcetrapib series of cholesteryl ester transfer protein inhibitors, including mechanism of action.", "journal": "Journal of lipid research", "date": "2006", "authors": "Clark RW, Ruggeri RB, Cunningham D, Bamberger MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "16326978", "url": "https://glygen.org/publication/PubMed/16326978" } ] }, { "title": "High density lipoprotein endocytosis by scavenger receptor SR-BII is clathrin-dependent and requires a carboxyl-terminal dileucine motif.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Eckhardt ER, Cai L, Shetty S, Zhao Z, Szanto A, Webb NR, Van der Westhuyzen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16368683", "url": "https://glygen.org/publication/PubMed/16368683" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "The primary structure of human plasma high density apolipoprotein glutamine I (ApoA-I). II. The amino acid sequence and alignment of cyanogen bromide fragments IV, III, and I.", "journal": "J. Biol. Chem.", "date": "1975", "authors": "Baker HN, Gotto AM Jr, Jackson RL", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "164450", "url": "https://glygen.org/publication/PubMed/164450" } ] }, { "title": "The murine haemopexin receptor. Evidence that the haemopexin-binding site resides on a 20 kDa subunit and that receptor recycling is regulated by protein kinase C.", "journal": "The Biochemical journal", "date": "1991", "authors": "Smith A, Farooqui SM, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1646599", "url": "https://glygen.org/publication/PubMed/1646599" } ] }, { "title": "SR-BI-mediated high density lipoprotein (HDL) endocytosis leads to HDL resecretion facilitating cholesterol efflux.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pagler TA, Rhode S, Neuhofer A, Laggner H, Strobl W, Hinterndorfer C, Volf I, Pavelka M, Eckhardt ER, van der Westhuyzen DR, Schutz GJ, Stangl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "16488891", "url": "https://glygen.org/publication/PubMed/16488891" } ] }, { "title": "MARCO, an innate activation marker of macrophages, is a class A scavenger receptor for Neisseria meningitidis.", "journal": "European journal of immunology", "date": "2006", "authors": "Mukhopadhyay S, Chen Y, Sankala M, Peiser L, Pikkarainen T, Kraal G, Tryggvason K, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16525990", "url": "https://glygen.org/publication/PubMed/16525990" } ] }, { "title": "Mechanism of prebeta-HDL formation and activation.", "journal": "Biochemistry", "date": "2006", "authors": "Chau P, Nakamura Y, Fielding CJ, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "16548525", "url": "https://glygen.org/publication/PubMed/16548525" } ] }, { "title": "Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein.", "journal": "Blood", "date": "2006", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Oxvig C, Rees D, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16778136", "url": "https://glygen.org/publication/PubMed/16778136" } ] }, { "title": "Structure, binding interface and hydrophobic transitions of Ca2+-loaded calbindin-D(28K).", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kojetin DJ, Venters RA, Kordys DR, Thompson RJ, Kumar R, Cavanagh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "16799559", "url": "https://glygen.org/publication/PubMed/16799559" } ] }, { "title": "Role of scavenger receptor MARCO in macrophage responses to CpG oligodeoxynucleotides.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Jozefowski S, Sulahian TH, Arredouani M, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16882874", "url": "https://glygen.org/publication/PubMed/16882874" } ] }, { "title": "Identification of Neisseria meningitidis nonlipopolysaccharide ligands for class A macrophage scavenger receptor by using a novel assay.", "journal": "Infection and immunity", "date": "2006", "authors": "Peiser L, Makepeace K, Pluddemann A, Savino S, Wright JC, Pizza M, Rappuoli R, Moxon ER, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16926412", "url": "https://glygen.org/publication/PubMed/16926412" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "Functionally defective high-density lipoprotein: a new therapeutic target at the crossroads of dyslipidemia, inflammation, and atherosclerosis.", "journal": "Pharmacological reviews", "date": "2006", "authors": "Kontush A, Chapman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "16968945", "url": "https://glygen.org/publication/PubMed/16968945" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "MARCO mediates silica uptake and toxicity in alveolar macrophages from C57BL/6 mice.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Hamilton RF Jr, Thakur SA, Mayfair JK, Holian A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "16984918", "url": "https://glygen.org/publication/PubMed/16984918" } ] }, { "title": "Constitutive endocytosis of CD163 mediates hemoglobin-heme uptake and determines the noninflammatory and protective transcriptional response of macrophages to hemoglobin.", "journal": "Circulation research", "date": "2006", "authors": "Schaer CA, Schoedon G, Imhof A, Kurrer MO, Schaer DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17008602", "url": "https://glygen.org/publication/PubMed/17008602" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "Inhibition of bone morphogenetic protein 1 by native and altered forms of alpha2-macroglobulin.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zhang Y, Ge G, Greenspan DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17071617", "url": "https://glygen.org/publication/PubMed/17071617" } ] }, { "title": "Oxidized phosphatidylserine-CD36 interactions play an essential role in macrophage-dependent phagocytosis of apoptotic cells.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Greenberg ME, Sun M, Zhang R, Febbraio M, Silverstein R, Hazen SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17101731", "url": "https://glygen.org/publication/PubMed/17101731" } ] }, { "title": "A unique loop extension in the serine protease domain of haptoglobin is essential for CD163 recognition of the haptoglobin-hemoglobin complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Thirup S, Enghild JJ, Graversen JH, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17102136", "url": "https://glygen.org/publication/PubMed/17102136" } ] }, { "title": "Identification and characterization of a novel human collectin CL-K1.", "journal": "Microbiology and immunology", "date": "2006", "authors": "Keshi H, Sakamoto T, Kawai T, Ohtani K, Katoh T, Jang SJ, Motomura W, Yoshizaki T, Fukuda M, Koyama S, Fukuzawa J, Fukuoh A, Yoshida I, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17179669", "url": "https://glygen.org/publication/PubMed/17179669" } ] }, { "title": "Crystal structure of cholesteryl ester transfer protein reveals a long tunnel and four bound lipid molecules.", "journal": "Nature structural & molecular biology", "date": "2007", "authors": "Qiu X, Mistry A, Ammirati MJ, Chrunyk BA, Clark RW, Cong Y, Culp JS, Danley DE, Freeman TB, Geoghegan KF, Griffor MC, Hawrylik SJ, Hayward CM, Hensley P, Hoth LR, Karam GA, Lira ME, Lloyd DB, McGrath KM, Stutzman-Engwall KJ, Subashi AK, Subashi TA, Thompson JF, Wang IK, Zhao H, Seddon AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "17237796", "url": "https://glygen.org/publication/PubMed/17237796" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Protection against inhaled oxidants through scavenging of oxidized lipids by macrophage receptors MARCO and SR-AI/II.", "journal": "The Journal of clinical investigation", "date": "2007", "authors": "Dahl M, Bauer AK, Arredouani M, Soininen R, Tryggvason K, Kleeberger SR, Kobzik L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17332894", "url": "https://glygen.org/publication/PubMed/17332894" } ] }, { "title": "The apolipoprotein A-I binding protein of placenta and the SP-40,40 protein of human blood are different proteins which both bind to apolipoprotein A-I.", "journal": "Biochim. Biophys. Acta", "date": "1991", "authors": "Ehnholm C, Bozas S E, Tenkanen H, Kirszbaum L, Metso J, Murphy B, Walker I D", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "1742316", "url": "https://glygen.org/publication/PubMed/1742316" } ] }, { "title": "A reversible form of lysine acetylation in the ER and Golgi lumen controls the molecular stabilization of BACE1.", "journal": "The Biochemical journal", "date": "2007", "authors": "Costantini C, Ko MH, Jonas MC, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "17425515", "url": "https://glygen.org/publication/PubMed/17425515" } ] }, { "title": "ABCA1-induced cell surface binding sites for ApoA-I.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Vedhachalam C, Ghering AB, Davidson WS, Lund-Katz S, Rothblat GH, Phillips MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17478755", "url": "https://glygen.org/publication/PubMed/17478755" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "Bone morphogenetic protein-1 (BMP-1) cleaves human proapolipoprotein A1 and regulates its activation for lipid binding.", "journal": "Biochemistry", "date": "2007", "authors": "Chau P, Fielding PE, Fielding CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17580958", "url": "https://glygen.org/publication/PubMed/17580958" } ] }, { "title": "Mechanism of ATP-binding cassette transporter A1-mediated cellular lipid efflux to apolipoprotein A-I and formation of high density lipoprotein particles.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Vedhachalam C, Duong PT, Nickel M, Nguyen D, Dhanasekaran P, Saito H, Rothblat GH, Lund-Katz S, Phillips MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "17604270", "url": "https://glygen.org/publication/PubMed/17604270" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "Apolipoprotein A-II is catabolized in the kidney as a function of its plasma concentration.", "journal": "Journal of lipid research", "date": "2007", "authors": "Dugue-Pujol S, Rousset X, Chateau D, Pastier D, Klein C, Demeurie J, Cywiner-Golenzer C, Chabert M, Verroust P, Chambaz J, Chatelet FP, Kalopissis AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964011", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011" } ], "reference": [ { "type": "PubMed", "id": "17652309", "url": "https://glygen.org/publication/PubMed/17652309" } ] }, { "title": "Scavenger receptor class-A is a novel cell surface receptor for double-stranded RNA.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2008", "authors": "Limmon GV, Arredouani M, McCann KL, Corn Minor RA, Kobzik L, Imani F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "17709607", "url": "https://glygen.org/publication/PubMed/17709607" } ] }, { "title": "The inhibition of endocytosis affects HDL-lipid uptake mediated by the human scavenger receptor class B type I.", "journal": "Molecular membrane biology", "date": "2007", "authors": "Zhang Y, Ahmed AM, Tran TL, Lin J, McFarlane N, Boreham DR, Igdoura SA, Truant R, Trigatti BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17710648", "url": "https://glygen.org/publication/PubMed/17710648" } ] }, { "title": "Hemoglobin is a co-factor of human trypanosome lytic factor.", "journal": "PLoS pathogens", "date": "2007", "authors": "Widener J, Nielsen MJ, Shiflett A, Moestrup SK, Hajduk S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17845074", "url": "https://glygen.org/publication/PubMed/17845074" } ] }, { "title": "Distinct mechanisms for OxLDL uptake and cellular trafficking by class B scavenger receptors CD36 and SR-BI.", "journal": "Journal of lipid research", "date": "2007", "authors": "Sun B, Boyanovsky BB, Connelly MA, Shridas P, van der Westhuyzen DR, Webb NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "17876058", "url": "https://glygen.org/publication/PubMed/17876058" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.", "journal": "Human molecular genetics", "date": "2008", "authors": "Lee JT, Wheeler TC, Li L, Chin LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18065497", "url": "https://glygen.org/publication/PubMed/18065497" } ] }, { "title": "Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Rott R, Szargel R, Haskin J, Shani V, Shainskaya A, Manov I, Liani E, Avraham E, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18070888", "url": "https://glygen.org/publication/PubMed/18070888" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "Atrial amyloid deposits in the failing human heart display both atrial and brain natriuretic peptide-like immunoreactivity.", "journal": "The Journal of pathology", "date": "1991", "authors": "Pucci A, Wharton J, Arbustini E, Grasso M, Diegoli M, Needleman P, Vigano M, Polak JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1837051", "url": "https://glygen.org/publication/PubMed/1837051" } ] }, { "title": "Leukocyte chemotactic factor 2: A novel renal amyloid protein.", "journal": "Kidney international", "date": "2008", "authors": "Benson MD, James S, Scott K, Liepnieks JJ, Kluve-Beckerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18449172", "url": "https://glygen.org/publication/PubMed/18449172" } ] }, { "title": "Cellular trafficking of lipoteichoic acid and Toll-like receptor 2 in relation to signaling: role of CD14 and CD36.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Nilsen NJ, Deininger S, Nonstad U, Skjeldal F, Husebye H, Rodionov D, von Aulock S, Hartung T, Lien E, Bakke O, Espevik T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18458151", "url": "https://glygen.org/publication/PubMed/18458151" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Oleate stimulates secretion of apolipoprotein B-containing lipoproteins from Hep G2 cells by inhibiting early intracellular degradation of apolipoprotein B.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dixon JL, Furukawa S, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "1848237", "url": "https://glygen.org/publication/PubMed/1848237" } ] }, { "title": "Odontogenic ameloblast-associated protein nature of the amyloid found in calcifying epithelial odontogenic tumors and unerupted tooth follicles.", "journal": "Amyloid : the international journal of experimental and clinical investigation : the official journal of the International Society of Amyloidosis", "date": "2008", "authors": "Murphy CL, Kestler DP, Foster JS, Wang S, Macy SD, Kennel SJ, Carlson ER, Hudson J, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "18484335", "url": "https://glygen.org/publication/PubMed/18484335" } ] }, { "title": "Gelsolin-related amyloidosis. Identification of the amyloid protein in Finnish hereditary amyloidosis as a fragment of variant gelsolin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Maury CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "1849145", "url": "https://glygen.org/publication/PubMed/1849145" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "Recognition and plasma clearance of endotoxin by scavenger receptors.", "journal": "Nature", "date": "1991", "authors": "Hampton RY, Golenbock DT, Penman M, Krieger M, Raetz CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "1852209", "url": "https://glygen.org/publication/PubMed/1852209" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "Hemopexin prevents endothelial damage and liver congestion in a mouse model of heme overload.", "journal": "The American journal of pathology", "date": "2008", "authors": "Vinchi F, Gastaldi S, Silengo L, Altruda F, Tolosano E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "18556779", "url": "https://glygen.org/publication/PubMed/18556779" } ] }, { "title": "CD36 N-terminal cytoplasmic domain is not required for the internalization of oxidized low-density lipoprotein.", "journal": "Bioscience reports", "date": "2008", "authors": "McDermott-Roe C, Martin J, Collot-Teixeira S, McGregor JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "18558917", "url": "https://glygen.org/publication/PubMed/18558917" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "A frameshift mutation in the human apolipoprotein A-I gene causes high density lipoprotein deficiency, partial lecithin: cholesterol-acyltransferase deficiency, and corneal opacities.", "journal": "J. Clin. Invest.", "date": "1991", "authors": "Funke H, von Eckardstein A, Pritchard P H, Karas M, Albers J J, Assmann G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "1898657", "url": "https://glygen.org/publication/PubMed/1898657" } ] }, { "title": "Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Ko MH, Puglielli L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19011241", "url": "https://glygen.org/publication/PubMed/19011241" } ] }, { "title": "Apolipoprotein A-I deficiency due to a codon 84 nonsense mutation of the apolipoprotein A-I gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Matsunaga T, Hiasa Y, Yanagi H, Maeda T, Hattori N, Yamakawa K, Yamanouchi Y, Tanaka I, Obara T, Hamaguchi H", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "1901417", "url": "https://glygen.org/publication/PubMed/1901417" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Scavenger receptor collectin placenta 1 (CL-P1) predominantly mediates zymosan phagocytosis by human vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Jang S, Ohtani K, Fukuoh A, Yoshizaki T, Fukuda M, Motomura W, Mori K, Fukuzawa J, Kitamoto N, Yoshida I, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19073604", "url": "https://glygen.org/publication/PubMed/19073604" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "Identification of apolipoprotein A1 and immunoglobulin as components of a serum complex that mediates activation of human sperm motility.", "journal": "Biochemistry", "date": "1991-09-17", "authors": "Akerl\u00f6f E, J\u00f6rnvall H, Slotte H, Pousette A", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "1909888", "url": "https://glygen.org/publication/PubMed/1909888" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "Scavenger receptor A: a new route for adenovirus 5.", "journal": "Molecular pharmaceutics", "date": "2009", "authors": "Haisma HJ, Boesjes M, Beerens AM, van der Strate BW, Curiel DT, Pluddemann A, Gordon S, Bellu AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19227971", "url": "https://glygen.org/publication/PubMed/19227971" } ] }, { "title": "Evolutionarily conserved recognition and innate immunity to fungal pathogens by the scavenger receptors SCARF1 and CD36.", "journal": "The Journal of experimental medicine", "date": "2009", "authors": "Means TK, Mylonakis E, Tampakakis E, Colvin RA, Seung E, Puckett L, Tai MF, Stewart CR, Pukkila-Worley R, Hickman SE, Moore KJ, Calderwood SB, Hacohen N, Luster AD, El Khoury J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19237602", "url": "https://glygen.org/publication/PubMed/19237602" } ] }, { "title": "Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Harrington JM, Howell S, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19324878", "url": "https://glygen.org/publication/PubMed/19324878" } ] }, { "title": "Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.", "journal": "Circulation research", "date": "2009", "authors": "Singaraja RR, Kang MH, Vaid K, Sanders SS, Vilas GL, Arstikaitis P, Coutinho J, Drisdel RC, El-Husseini Ael D, Green WN, Berthiaume L, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963896", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896" } ], "reference": [ { "type": "PubMed", "id": "19556522", "url": "https://glygen.org/publication/PubMed/19556522" } ] }, { "title": "Identification of the active form of endothelial lipase, a homodimer in a head-to-tail conformation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Griffon N, Jin W, Petty TJ, Millar J, Badellino KO, Saven JG, Marchadier DH, Kempner ES, Billheimer J, Glick JM, Rader DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "19567873", "url": "https://glygen.org/publication/PubMed/19567873" } ] }, { "title": "Heme scavenging and the other facets of hemopexin.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Tolosano E, Fagoonee S, Morello N, Vinchi F, Fiorito V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19650691", "url": "https://glygen.org/publication/PubMed/19650691" } ] }, { "title": "Structural characterization of the conformational change in calbindin-D28k upon calcium binding using differential surface modification analyzed by mass spectrometry.", "journal": "Biochemistry", "date": "2009", "authors": "Hobbs CA, Deterding LJ, Perera L, Bobay BG, Thompson RJ, Darden TA, Cavanagh J, Tomer KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19658395", "url": "https://glygen.org/publication/PubMed/19658395" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "Uptake of oxidized low density lipoprotein by CD36 occurs by an actin-dependent pathway distinct from macropinocytosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Collins RF, Touret N, Kuwata H, Tandon NN, Grinstein S, Trimble WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "19740737", "url": "https://glygen.org/publication/PubMed/19740737" } ] }, { "title": "An initial characterization of the serum phosphoproteome.", "journal": "Journal of proteome research", "date": "2009", "authors": "Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" } ], "reference": [ { "type": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ] }, { "title": "gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of beta-carboxyl terminal fragment.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Takami M, Nagashima Y, Sano Y, Ishihara S, Morishima-Kawashima M, Funamoto S, Ihara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "19828817", "url": "https://glygen.org/publication/PubMed/19828817" } ] }, { "title": "Macrophage scavenger receptor A mediates adhesion to apolipoproteins A-I and E.", "journal": "Biochemistry", "date": "2009", "authors": "Neyen C, Pluddemann A, Roversi P, Thomas B, Cai L, van der Westhuyzen DR, Sim RB, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "19911804", "url": "https://glygen.org/publication/PubMed/19911804" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "2010", "authors": "Sun HY, Chen SF, Lai MD, Chang TT, Chen TL, Li PY, Shieh DB, Young KC", "evidence": [ { "database": "iPTMnet", "id": "P02647", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02647" } ], "reference": [ { "type": "PubMed", "id": "19945452", "url": "https://glygen.org/publication/PubMed/19945452" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "An accessory to the 'Trinity': SR-As are essential pathogen sensors of extracellular dsRNA, mediating entry and leading to subsequent type I IFN responses.", "journal": "PLoS pathogens", "date": "2010", "authors": "DeWitte-Orr SJ, Collins SE, Bauer CM, Bowdish DM, Mossman KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20360967", "url": "https://glygen.org/publication/PubMed/20360967" } ] }, { "title": "The amino acid sequence of human APOA-I, an apolipoprotein isolated from high density lipoproteins.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1978", "authors": "Brewer HB Jr, Fairwell T, LaRue A, Ronan R, Houser A, Bronzert TJ", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "204308", "url": "https://glygen.org/publication/PubMed/204308" } ] }, { "title": "Metal ions and electrolytes regulate the dissociation of heme from human hemopexin at physiological pH.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20430887", "url": "https://glygen.org/publication/PubMed/20430887" } ] }, { "title": "ADAM10 is the physiologically relevant, constitutive alpha-secretase of the amyloid precursor protein in primary neurons.", "journal": "The EMBO journal", "date": "2010", "authors": "Kuhn PH, Wang H, Dislich B, Colombo A, Zeitschel U, Ellwart JW, Kremmer E, Rossner S, Lichtenthaler SF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20676056", "url": "https://glygen.org/publication/PubMed/20676056" } ] }, { "title": "Heparan sulfate proteoglycans in amyloidosis.", "journal": "Progress in molecular biology and translational science", "date": "2010", "authors": "Zhang X, Li JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "20807650", "url": "https://glygen.org/publication/PubMed/20807650" } ] }, { "title": "The class A scavenger receptor, macrophage receptor with collagenous structure, is the major phagocytic receptor for Clostridium sordellii expressed by human decidual macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Thelen T, Hao Y, Medeiros AI, Curtis JL, Serezani CH, Kobzik L, Harris LH, Aronoff DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20810988", "url": "https://glygen.org/publication/PubMed/20810988" } ] }, { "title": "Cellular recognition and trafficking of amorphous silica nanoparticles by macrophage scavenger receptor A.", "journal": "Nanotoxicology", "date": "2011", "authors": "Orr GA, Chrisler WB, Cassens KJ, Tan R, Tarasevich BJ, Markillie LM, Zangar RC, Thrall BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20849212", "url": "https://glygen.org/publication/PubMed/20849212" } ] }, { "title": "Phagocytosis of fungal agents and yeast via macrophage cell surface scavenger receptors.", "journal": "The Journal of surgical research", "date": "2010", "authors": "Wang R, Chandawarkar RY", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20888598", "url": "https://glygen.org/publication/PubMed/20888598" } ] }, { "title": "Signaling through LRP1: Protection from atherosclerosis and beyond.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Boucher P, Herz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20920479", "url": "https://glygen.org/publication/PubMed/20920479" } ] }, { "title": "Collectin 11 (CL-11, CL-K1) is a MASP-1/3-associated plasma collectin with microbial-binding activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Hansen S, Selman L, Palaniyar N, Ziegler K, Brandt J, Kliem A, Jonasson M, Skjoedt MO, Nielsen O, Hartshorn K, Jorgensen TJ, Skjodt K, Holmskov U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "20956340", "url": "https://glygen.org/publication/PubMed/20956340" } ] }, { "title": "Isolation and characterization of human apolipoprotein A-I Fukuoka (110 Glu----Lys). A novel apolipoprotein variant.", "journal": "Biochimica et biophysica acta", "date": "1990", "authors": "Takada Y, Sasaki J, Ogata S, Nakanishi T, Ikehara Y, Arakawa K", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2107878", "url": "https://glygen.org/publication/PubMed/2107878" } ] }, { "title": "Apolipoprotein A1 Baltimore (Arg10----Leu), a new ApoA1 variant.", "journal": "Human genetics", "date": "1990", "authors": "Ladias JA, Kwiterovich PO Jr, Smith HH, Karathanasis SK, Antonarakis SE", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2108924", "url": "https://glygen.org/publication/PubMed/2108924" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Structural analysis of human apolipoprotein A-I variants. Amino acid substitutions are nonrandomly distributed throughout the apolipoprotein A-I primary structure.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "von Eckardstein A, Funke H, Walter M, Altland K, Benninghoven A, Assmann G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2111322", "url": "https://glygen.org/publication/PubMed/2111322" } ] }, { "title": "Immunoglobulin heavy-chain-associated amyloidosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Eulitz M, Weiss DT, Solomon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2118650", "url": "https://glygen.org/publication/PubMed/2118650" } ] }, { "title": "A mutation in apolipoprotein A-I in the Iowa type of familial amyloidotic polyneuropathy.", "journal": "Genomics", "date": "1990", "authors": "Nichols WC, Gregg RE, Brewer HB Jr, Benson MD", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2123470", "url": "https://glygen.org/publication/PubMed/2123470" } ] }, { "title": "Effect of overexpression of human SR-AI on oxLDL uptake and apoptosis in 293T cells.", "journal": "International immunopharmacology", "date": "2011", "authors": "Yang H, Chen SC, Tang YQ, Dai YL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "21782039", "url": "https://glygen.org/publication/PubMed/21782039" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "Islet amyloid polypeptide: pinpointing amino acid residues linked to amyloid fibril formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Westermark P, Engstrom U, Johnson KH, Westermark GT, Betsholtz C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2195544", "url": "https://glygen.org/publication/PubMed/2195544" } ] }, { "title": "Quantitative detection of single amino acid polymorphisms by targeted proteomics.", "journal": "Journal of molecular cell biology", "date": "2011", "authors": "Su ZD, Sun L, Yu DX, Li RX, Li HX, Yu ZJ, Sheng QH, Lin X, Zeng R, Wu JR", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "22028381", "url": "https://glygen.org/publication/PubMed/22028381" } ] }, { "title": "alpha-Synuclein fate is determined by USP9X-regulated monoubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rott R, Szargel R, Haskin J, Bandopadhyay R, Lees AJ, Shani V, Engelender S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22065755", "url": "https://glygen.org/publication/PubMed/22065755" } ] }, { "title": "Protein monoubiquitination and polyubiquitination generate structural diversity to control distinct biological processes.", "journal": "IUBMB life", "date": "2012", "authors": "Sadowski M, Suryadinata R, Tan AR, Roesley SN, Sarcevic B", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "22131221", "url": "https://glygen.org/publication/PubMed/22131221" } ] }, { "title": "Insertion of heme b into the structure of the Cys34-carbamidomethylated human lipocalin alpha(1)-microglobulin: formation of a [(heme)(2) (alpha(1)-Microglobulin)](3) complex.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2012", "authors": "Siebel JF, Kosinsky RL, Akerstrom B, Knipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22492620", "url": "https://glygen.org/publication/PubMed/22492620" } ] }, { "title": "Human macrophage scavenger receptors: primary structure, expression, and localization in atherosclerotic lesions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Matsumoto A, Naito M, Itakura H, Ikemoto S, Asaoka H, Hayakawa I, Kanamori H, Aburatani H, Takaku F, Suzuki H, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "2251254", "url": "https://glygen.org/publication/PubMed/2251254" } ] }, { "title": "Biological functions of the novel collectins CL-L1, CL-K1, and CL-P1.", "journal": "Journal of biomedicine & biotechnology", "date": "2012", "authors": "Ohtani K, Suzuki Y, Wakamiya N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "22570530", "url": "https://glygen.org/publication/PubMed/22570530" } ] }, { "title": "Structure of the haptoglobin-haemoglobin complex.", "journal": "Nature", "date": "2012", "authors": "Andersen CB, Torvund-Jensen M, Nielsen MJ, de Oliveira CL, Hersleth HP, Andersen NH, Pedersen JS, Andersen GR, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22922649", "url": "https://glygen.org/publication/PubMed/22922649" } ] }, { "title": "Scavenger receptor-mediated uptake and metabolism of lipid vesicles containing acidic phospholipids by mouse peritoneal macrophages.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Nishikawa K, Arai H, Inoue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "2318890", "url": "https://glygen.org/publication/PubMed/2318890" } ] }, { "title": "MARCO is required for TLR2- and Nod2-mediated responses to Streptococcus pneumoniae and clearance of pneumococcal colonization in the murine nasopharynx.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013", "authors": "Dorrington MG, Roche AM, Chauvin SE, Tu Z, Mossman KL, Weiser JN, Bowdish DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "23197261", "url": "https://glygen.org/publication/PubMed/23197261" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P02647", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Control of angiogenesis by AIBP-mediated cholesterol efflux.", "journal": "Nature", "date": "2013", "authors": "Fang Longhou, Choi Soo-Ho, Baek Ji Sun, Liu Chao, Almazan Felicidad, Ulrich Florian, Wiesner Philipp, Taleb Adam, Deer Elena, Pattison Jennifer, Torres-V\u00e1zquez Jes\u00fas, Li Andrew C, Miller Yury I", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "23719382", "url": "https://glygen.org/publication/PubMed/23719382" } ] }, { "title": "Sorting receptor SORLA--a trafficking path to avoid Alzheimer disease.", "journal": "Journal of cell science", "date": "2013", "authors": "Willnow TE, Andersen OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "23813966", "url": "https://glygen.org/publication/PubMed/23813966" } ] }, { "title": "Temporal relationship between glycosaminoglycan accumulation and amyloid deposition during experimental amyloidosis. A histochemical study.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "1985", "authors": "Snow AD, Kisilevsky R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2409350", "url": "https://glygen.org/publication/PubMed/2409350" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "Secondary structure changes in ApoA-I Milano (R173C) are not accompanied by a decrease in protein stability or solubility.", "journal": "PloS one", "date": "2014", "authors": "Petrlova J, Dalla-Riva J, Morgelin M, Lindahl M, Krupinska E, Stenkula KG, Voss JC, Lagerstedt JO", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "24755625", "url": "https://glygen.org/publication/PubMed/24755625" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Mutations in the cholesterol transporter gene ABCA5 are associated with excessive hair overgrowth.", "journal": "PLoS genetics", "date": "2014", "authors": "DeStefano GM, Kurban M, Anyane-Yeboa K, Dall'Armi C, Di Paolo G, Feenstra H, Silverberg N, Rohena L, Lopez-Cepeda LD, Jobanputra V, Fantauzzo KA, Kiuru M, Tadin-Strapps M, Sobrino A, Vitebsky A, Warburton D, Levy B, Salas-Alanis JC, Christiano AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "24831815", "url": "https://glygen.org/publication/PubMed/24831815" } ] }, { "title": "The Role of SORL1 in Alzheimer's Disease.", "journal": "Molecular neurobiology", "date": "2015", "authors": "Yin RH, Yu JT, Tan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24833601", "url": "https://glygen.org/publication/PubMed/24833601" } ] }, { "title": "The normal and pathologic roles of the Alzheimer's beta-secretase, BACE1.", "journal": "Current Alzheimer research", "date": "2014", "authors": "Kandalepas PC, Vassar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "24893886", "url": "https://glygen.org/publication/PubMed/24893886" } ] }, { "title": "Apolipoprotein A-I binds to a family of bovine seminal plasma proteins.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Manjunath P, Marcel Y L, Uma J, Seidah N G, Chr\u00e9tien M, Chapdelaine A", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2506184", "url": "https://glygen.org/publication/PubMed/2506184" } ] }, { "title": "Apolipoprotein A-I variants. Naturally occurring substitutions of proline residues affect plasma concentration of apolipoprotein A-I.", "journal": "The Journal of clinical investigation", "date": "1989", "authors": "von Eckardstein A, Funke H, Henke A, Altland K, Benninghoven A, Assmann G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2512329", "url": "https://glygen.org/publication/PubMed/2512329" } ] }, { "title": "Amyloid-beta protein clearance and degradation (ABCD) pathways and their role in Alzheimer's disease.", "journal": "Current Alzheimer research", "date": "2015", "authors": "Baranello RJ, Bharani KL, Padmaraju V, Chopra N, Lahiri DK, Greig NH, Pappolla MA, Sambamurti K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "25523424", "url": "https://glygen.org/publication/PubMed/25523424" } ] }, { "title": "Abeta42 and Abeta40: similarities and differences.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2015", "authors": "Qiu T, Liu Q, Chen YX, Zhao YF, Li YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26018760", "url": "https://glygen.org/publication/PubMed/26018760" } ] }, { "title": "Case report: A novel apolipoprotein A-I missense mutation apoA-I (Arg149Ser)Boston associated with decreased lecithin-cholesterol acyltransferase activation and cellular cholesterol efflux.", "journal": "Journal of clinical lipidology", "date": "2015", "authors": "Anthanont P, Asztalos BF, Polisecki E, Zachariah B, Schaefer EJ", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "26073399", "url": "https://glygen.org/publication/PubMed/26073399" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "Loss of calbindin-D28K is associated with the full range of tangle pathology within basal forebrain cholinergic neurons in Alzheimer's disease.", "journal": "Neurobiology of aging", "date": "2015", "authors": "Ahmadian SS, Rezvanian A, Peterson M, Weintraub S, Bigio EH, Mesulam MM, Geula C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26417681", "url": "https://glygen.org/publication/PubMed/26417681" } ] }, { "title": "TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Noy PJ, Yang J, Reyat JS, Matthews AL, Charlton AE, Furmston J, Rogers DA, Rainger GE, Tomlinson MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26668317", "url": "https://glygen.org/publication/PubMed/26668317" } ] }, { "title": "TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2016", "authors": "Jouannet S, Saint-Pol J, Fernandez L, Nguyen V, Charrin S, Boucheix C, Brou C, Milhiet PE, Rubinstein E", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26686862", "url": "https://glygen.org/publication/PubMed/26686862" } ] }, { "title": "Production of human recombinant proapolipoprotein A-I in Escherichia coli: purification and biochemical characterization.", "journal": "DNA", "date": "1989", "authors": "Moguilevsky N, Roobol C, Loriau R, Guillaume J P, Jacobs P, Cravador A, Herzog A, Brouwers L, Scarso A, Gilles P", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2673706", "url": "https://glygen.org/publication/PubMed/2673706" } ] }, { "title": "Intracellular sorting pathways of the amyloid precursor protein provide novel neuroprotective strategies.", "journal": "Neural regeneration research", "date": "2015", "authors": "Hermey G", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "26807092", "url": "https://glygen.org/publication/PubMed/26807092" } ] }, { "title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.", "journal": "Biology open", "date": "2016", "authors": "Juhlen R, Landgraf D, Huebner A, Koehler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "27754849", "url": "https://glygen.org/publication/PubMed/27754849" } ] }, { "title": "The Scavenger Receptor SSc5D Physically Interacts with Bacteria through the SRCR-Containing N-Terminal Domain.", "journal": "Frontiers in immunology", "date": "2016", "authors": "Bessa Pereira C, Bockova M, Santos RF, Santos AM, Martins de Araujo M, Oliveira L, Homola J, Carmo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "27790215", "url": "https://glygen.org/publication/PubMed/27790215" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "Amyloid fibril protein related to prealbumin in familial amyloidotic polyneuropathy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1978", "authors": "Costa PP, Figueira AS, Bravo FR", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "279930", "url": "https://glygen.org/publication/PubMed/279930" } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "evidence": [ { "database": "UniCarbKB", "id": "P02647", "url": "" } ], "reference": [ { "type": "PubMed", "id": "28035807", "url": "https://glygen.org/publication/PubMed/28035807" } ] }, { "title": "Serum proteins as mediators of hemin efflux from red cell membranes: specificity of hemopexin.", "journal": "FEBS letters", "date": "1989", "authors": "Solar I, Muller-Eberhard U, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2806549", "url": "https://glygen.org/publication/PubMed/2806549" } ] }, { "title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.", "journal": "Cell", "date": "2017", "authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "28111073", "url": "https://glygen.org/publication/PubMed/28111073" } ] }, { "title": "Plasma cholesteryl ester transfer protein has binding sites for neutral lipids and phospholipids.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Swenson TL, Brocia RW, Tall AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "2833496", "url": "https://glygen.org/publication/PubMed/2833496" } ] }, { "title": "Importance of ligand-induced conformational changes in hemopexin for receptor-mediated heme transport.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Smith A, Tatum FM, Muster P, Burch MK, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2833500", "url": "https://glygen.org/publication/PubMed/2833500" } ] }, { "title": "Mutation in cystatin C gene causes hereditary brain haemorrhage.", "journal": "Lancet (London, England)", "date": "1988", "authors": "Palsdottir A, Abrahamson M, Thorsteinsson L, Arnason A, Olafsson I, Grubb A, Jensson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "2900981", "url": "https://glygen.org/publication/PubMed/2900981" } ] }, { "title": "Tangier disease. The complete mRNA sequence encoding for preproapo-A-I.", "journal": "J. Biol. Chem.", "date": "1985", "authors": "Law S W, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "2995392", "url": "https://glygen.org/publication/PubMed/2995392" } ] }, { "title": "Human apolipoprotein A-I. Post-translational modification by fatty acid acylation.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Hoeg JM, Meng MS, Ronan R, Fairwell T, Brewer HB Jr", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "3005308", "url": "https://glygen.org/publication/PubMed/3005308" } ] }, { "title": "Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Westermark P, Wernstedt C, Wilander E, Hayden DW, O'Brien TD, Johnson KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3035556", "url": "https://glygen.org/publication/PubMed/3035556" } ] }, { "title": "Serum prostacyclin stabilizing factor is identical to apolipoprotein A-I (Apo A-I). A novel function of Apo A-I.", "journal": "J. Clin. Invest.", "date": "1988", "authors": "Yui Y, Aoyama T, Morishita H, Takahashi M, Takatsu Y, Kawai C", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "3047170", "url": "https://glygen.org/publication/PubMed/3047170" } ] }, { "title": "An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Sanke T, Bell GI, Sample C, Rubenstein AH, Steiner DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3053705", "url": "https://glygen.org/publication/PubMed/3053705" } ] }, { "title": "Serum levels of beta 2-microglobulin as a new form of amyloid protein in patients undergoing long-term hemodialysis.", "journal": "The New England journal of medicine", "date": "1986", "authors": "Gejyo F, Homma N, Suzuki Y, Arakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3080684", "url": "https://glygen.org/publication/PubMed/3080684" } ] }, { "title": "Assignment of the human and mouse prion protein genes to homologous chromosomes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Sparkes RS, Simon M, Cohn VH, Fournier RE, Lem J, Klisak I, Heinzmann C, Blatt C, Lucero M, Mohandas T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3094007", "url": "https://glygen.org/publication/PubMed/3094007" } ] }, { "title": "Similarity of cruzin, an inhibitor of Trypanosoma cruzi neuraminidase, to high-density lipoprotein.", "journal": "Science", "date": "1987", "authors": "Prioli R P, Ordovas J M, Rosenberg I, Schaefer E J, Pereira M E", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "3120314", "url": "https://glygen.org/publication/PubMed/3120314" } ] }, { "title": "Sequence and expression of Tangier apoA-I gene.", "journal": "Eur. J. Biochem.", "date": "1988", "authors": "Makrides S C, Ruiz-Opazo N, Hayden M, Nussbaum A L, Breslow J L, Zannis V I", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "3129297", "url": "https://glygen.org/publication/PubMed/3129297" } ] }, { "title": "Variant apolipoprotein AI as a major constituent of a human hereditary amyloid.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Nichols WC, Dwulet FE, Liepnieks J, Benson MD", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" }, { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3142462", "url": "https://glygen.org/publication/PubMed/3142462" } ] }, { "title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.", "journal": "Nature", "date": "2019", "authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "31748741", "url": "https://glygen.org/publication/PubMed/31748741" } ] }, { "title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.", "journal": "Haematologica", "date": "2021", "authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32354867", "url": "https://glygen.org/publication/PubMed/32354867" } ] }, { "title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32695117", "url": "https://glygen.org/publication/PubMed/32695117" } ] }, { "title": "Human heme oxygenase cDNA and induction of its mRNA by hemin.", "journal": "European journal of biochemistry", "date": "1988", "authors": "Yoshida T, Biro P, Cohen T, Muller RM, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "3345742", "url": "https://glygen.org/publication/PubMed/3345742" } ] }, { "title": "Recognition of solubilized apoproteins from delipidated, oxidized low density lipoprotein (LDL) by the acetyl-LDL receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1987", "authors": "Parthasarathy S, Fong LG, Otero D, Steinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "3467373", "url": "https://glygen.org/publication/PubMed/3467373" } ] }, { "title": "Serum amyloid P component is the major calcium-dependent specific DNA binding protein of the serum.", "journal": "Biochemical and biophysical research communications", "date": "1987", "authors": "Pepys MB, Butler PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "3675579", "url": "https://glygen.org/publication/PubMed/3675579" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "Interactions of variants of human apolipoprotein A-I with biopolymeric model matrices. Effect of collagen and heparin.", "journal": "Archives of biochemistry and biophysics", "date": "2023-12", "authors": "Ros\u00fa Silvana A, Aguilar Joao, Urbano Bruno F, Tarraga Wilson A, Ramella Nahuel A, Longo Gabriel S, Finarelli Gabriela S, Sanchez Donoso Susana A, Tricerri M Alejandra", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" } ], "reference": [ { "type": "PubMed", "id": "37913855", "url": "https://glygen.org/publication/PubMed/37913855" } ] }, { "title": "FOXM1 Participates in Scleral Remodeling in Myopia by Upregulating APOA1 Expression Through METTL3/YTHDF2.", "journal": "Investigative ophthalmology & visual science", "date": "2024-01-02", "authors": "Xue Min, Li Boai, Lu Yao, Zhang Luyuan, Yang Bing, Shi Lei", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" } ], "reference": [ { "type": "PubMed", "id": "38190128", "url": "https://glygen.org/publication/PubMed/38190128" } ] }, { "title": "Follicular Fluid Proteomic Analysis of Women Undergoing Assisted Reproduction Suggests That Apolipoprotein A1 Is a Potential Fertility Marker.", "journal": "International journal of molecular sciences", "date": "2023-12-29", "authors": "Kurdi Csilla, Schmidt J\u00e1nos, Horv\u00e1th-Szalai Zolt\u00e1n, Mauchart P\u00e9ter, G\u00f6d\u00f6ny Krisztina, V\u00e1rnagy \u00c1kos, Kov\u00e1cs G\u00e1bor L, K\u0151szegi Tam\u00e1s", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" } ], "reference": [ { "type": "PubMed", "id": "38203658", "url": "https://glygen.org/publication/PubMed/38203658" } ] }, { "title": "Low serum apolipoprotein A1 level predicts poor prognosis of patients with diffuse large B-cell lymphoma in the real world: a retrospective study.", "journal": "BMC cancer", "date": "2024-01-12", "authors": "Huang Xiaoling, Wang Ying, Huang Zhenyu, Chen Xuzheng, Lin Qiuyan, Huang Haobo, Fan Liping", "evidence": [ { "database": "RefSeq", "id": "NP_000030", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000030" } ], "reference": [ { "type": "PubMed", "id": "38212711", "url": "https://glygen.org/publication/PubMed/38212711" } ] }, { "title": "Hemopexin-mediated heme transport to the liver. Evidence for a heme-binding protein in liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "3891754", "url": "https://glygen.org/publication/PubMed/3891754" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "Kinetics of hemoprotein reduction and interprotein heme transfer.", "journal": "Biochemistry", "date": "1985", "authors": "Pasternack RF, Gibbs EJ, Mauk AG, Reid LS, Wong NM, Kurokawa K, Hashim M, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4074707", "url": "https://glygen.org/publication/PubMed/4074707" } ] }, { "title": "Some spectral properties of the human hemoglobin-haptoglobin complex.", "journal": "Biochemistry", "date": "1971", "authors": "Hamaguchi H, Isomoto A, Miyake Y, Nakajima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4327491", "url": "https://glygen.org/publication/PubMed/4327491" } ] }, { "title": "A protein cofactor of lecithin:cholesterol acyltransferase.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Fielding CJ, Shore VG, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4335615", "url": "https://glygen.org/publication/PubMed/4335615" } ] }, { "title": "Lecithin: cholesterol acyltransferase: effects of substrate composition upon enzyme activity.", "journal": "Biochimica et biophysica acta", "date": "1972", "authors": "Fielding CJ, Shore VG, Fielding PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4340992", "url": "https://glygen.org/publication/PubMed/4340992" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Effect of lysolecithin and albumin on lecithin-cholesterol acyltransferase activity in human plasma.", "journal": "Journal of biochemistry", "date": "1973", "authors": "Nakagawa M, Nishida T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "4360812", "url": "https://glygen.org/publication/PubMed/4360812" } ] }, { "title": "Haem transport to the liver by haemopexin. Receptor-mediated uptake with recycling of the protein.", "journal": "The Biochemical journal", "date": "1979", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "496916", "url": "https://glygen.org/publication/PubMed/496916" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Studies on the structures of haptoglobin 1-1 and hemoglobin in the haptoglobin-hemoglobin complex.", "journal": "Biochemical and biophysical research communications", "date": "1971", "authors": "Waks M, Kahn PC, Beychok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "5135507", "url": "https://glygen.org/publication/PubMed/5135507" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Transport of lysolecithin by albumin in human and rat plasma.", "journal": "Journal of lipid research", "date": "1965", "authors": "Switzer S, Eder HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "5865378", "url": "https://glygen.org/publication/PubMed/5865378" } ] }, { "title": "Role of lysines in mediating interaction of modified low density lipoproteins with the scavenger receptor of human monocyte macrophages.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Haberland ME, Olch CL, Folgelman AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "6088540", "url": "https://glygen.org/publication/PubMed/6088540" } ] }, { "title": "Nucleotide sequence and the encoded amino acids of human apolipoprotein A-I mRNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1984", "authors": "Law S W, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6198645", "url": "https://glygen.org/publication/PubMed/6198645" } ] }, { "title": "Isolation and DNA sequence of full-length cDNA and of the entire gene for human apolipoprotein AI -- discovery of a new genetic polymorphism in the apo AI gene.", "journal": "DNA", "date": "1984", "authors": "Seilhamer J J, Protter A A, Frossard P, Levy-Wilson B", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6207999", "url": "https://glygen.org/publication/PubMed/6207999" } ] }, { "title": "The scavenger cell pathway for lipoprotein degradation: specificity of the binding site that mediates the uptake of negatively-charged LDL by macrophages.", "journal": "Journal of supramolecular structure", "date": "1980", "authors": "Brown MS, Basu SK, Falck JR, Ho YK, Goldstein JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "6255257", "url": "https://glygen.org/publication/PubMed/6255257" } ] }, { "title": "Isolation and characterization of cDNA clones for human apolipoprotein A-I.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1982", "authors": "Breslow JL, Ross D, McPherson J, Williams H, Kurnit D, Nussbaum AL, Karathanasis SK, Zannis VI", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6294659", "url": "https://glygen.org/publication/PubMed/6294659" } ] }, { "title": "Nucleotide sequence of cloned cDNA of human apolipoprotein A-I.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Cheung P, Chan L", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6304641", "url": "https://glygen.org/publication/PubMed/6304641" } ] }, { "title": "Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.", "journal": "Nucleic Acids Res.", "date": "1984", "authors": "Sharpe C R, Sidoli A, Shelley C S, Lucero M A, Shoulders C C, Baralle F E", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6328445", "url": "https://glygen.org/publication/PubMed/6328445" } ] }, { "title": "Apolipoprotein A-IMilano. Detection of normal A-I in affected subjects and evidence for a cysteine for arginine substitution in the variant A-I.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Weisgraber KH, Rall SC Jr, Bersot TP, Mahley RW, Franceschini G, Sirtori CR", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6401735", "url": "https://glygen.org/publication/PubMed/6401735" } ] }, { "title": "Intracellular and extracellular processing of human apolipoprotein A-I: secreted apolipoprotein A-I isoprotein 2 is a propeptide.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Zannis V I, Karathanasis S K, Keutmann H T, Goldberger G, Breslow J L", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6405383", "url": "https://glygen.org/publication/PubMed/6405383" } ] }, { "title": "Gene structure of human apolipoprotein A1.", "journal": "Nucleic Acids Res.", "date": "1983", "authors": "Shoulders C C, Kornblihtt A R, Munro B S, Baralle F E", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6406984", "url": "https://glygen.org/publication/PubMed/6406984" } ] }, { "title": "Human plasma proapoA-I: isolation and amino-terminal sequence.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1983", "authors": "Brewer H B, Fairwell T, Kay L, Meng M, Ronan R, Law S, Light J A", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6409108", "url": "https://glygen.org/publication/PubMed/6409108" } ] }, { "title": "Tangier disease: defective recombination of a specific Tangier apolipoprotein A-I isoform (pro-apo A-I) with high density lipoproteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Schmitz G, Assmann G, Rall S C, Mahley R W", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6412234", "url": "https://glygen.org/publication/PubMed/6412234" } ] }, { "title": "Isolation and characterization of the human apolipoprotein A-I gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1983", "authors": "Karathanasis S K, Zannis V I, Breslow J L", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6413973", "url": "https://glygen.org/publication/PubMed/6413973" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "Abnormal lecithin:cholesterol acyltransferase activation by a human apolipoprotein A-I variant in which a single lysine residue is deleted.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Rall SC Jr, Weisgraber KH, Mahley RW, Ogawa Y, Fielding CJ, Utermann G, Haas J, Steinmetz A, Menzel HJ, Assmann G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6432779", "url": "https://glygen.org/publication/PubMed/6432779" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Hemopexin-mediated heme uptake by liver. Characterization of the interaction of heme-hemopexin with isolated rabbit liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6480598", "url": "https://glygen.org/publication/PubMed/6480598" } ] }, { "title": "Apolipoprotein A-IGiessen (Pro143----Arg). A mutant that is defective in activating lecithin:cholesterol acyltransferase.", "journal": "European journal of biochemistry", "date": "1984", "authors": "Utermann G, Haas J, Steinmetz A, Paetzold R, Rall SC Jr, Weisgraber KH, Mahley RW", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6489332", "url": "https://glygen.org/publication/PubMed/6489332" } ] }, { "title": "Inter-relationship of lipids transferred by the lipid-transfer protein isolated from human lipoprotein-deficient plasma.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Morton RE, Zilversmit DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "6619141", "url": "https://glygen.org/publication/PubMed/6619141" } ] }, { "title": "Plasma apolipoprotein A-1 absence associated with a marked reduction of high density lipoproteins and premature coronary artery disease.", "journal": "Arteriosclerosis", "date": "1982", "authors": "Schaefer E J, Heaton W H, Wetzel M G, Brewer H B", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "6800349", "url": "https://glygen.org/publication/PubMed/6800349" } ] }, { "title": "Hemin binding to serum proteins and the catalysis of interprotein transfer.", "journal": "Biochemistry", "date": "1983", "authors": "Pasternack RF, Gibbs EJ, Hoeflin E, Kosar WP, Kubera G, Skowronek CA, Wong NM, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6849882", "url": "https://glygen.org/publication/PubMed/6849882" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Haptoglobin-hemoglobin complex. Subunit interaction probed by cross-linking.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Greer J, Liao WD, Brown WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7263686", "url": "https://glygen.org/publication/PubMed/7263686" } ] }, { "title": "Hemopexin-mediated transport of heme into isolated rat hepatocytes.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7287740", "url": "https://glygen.org/publication/PubMed/7287740" } ] }, { "title": "Haemoglobin binding with haptoglobin. Unequivocal demonstration that the beta-chains of human haemoglobin bind to haptoglobin.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kazim AL, Atassi MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7378053", "url": "https://glygen.org/publication/PubMed/7378053" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "CD36 gene transfer confers capacity for phagocytosis of cells undergoing apoptosis.", "journal": "The Journal of experimental medicine", "date": "1995", "authors": "Ren Y, Silverstein RL, Allen J, Savill J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7536797", "url": "https://glygen.org/publication/PubMed/7536797" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "Macrophage scavenger receptor mediates the endocytic uptake and degradation of advanced glycation end products of the Maillard reaction.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Araki N, Higashi T, Mori T, Shibayama R, Kawabe Y, Kodama T, Takahashi K, Shichiri M, Horiuchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "7607209", "url": "https://glygen.org/publication/PubMed/7607209" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "CD36 is a receptor for oxidized low density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Endemann G, Stanton LW, Madden KS, Bryant CM, White RT, Protter AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7685021", "url": "https://glygen.org/publication/PubMed/7685021" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "Cloning of a rat adipocyte membrane protein implicated in binding or transport of long-chain fatty acids that is induced during preadipocyte differentiation. Homology with human CD36.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Abumrad NA, el-Maghrabi MR, Amri EZ, Lopez E, Grimaldi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "7688729", "url": "https://glygen.org/publication/PubMed/7688729" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "The human myocardial two-dimensional gel protein database: update 1994.", "journal": "Electrophoresis", "date": "1994", "authors": "Corbett J M, Wheeler C H, Baker C S, Yacoub M H, Dunn M J", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "7895732", "url": "https://glygen.org/publication/PubMed/7895732" } ] }, { "title": "Characterization of two new human apolipoprotein A-I variants: apolipoprotein A-I Tsushima (Trp-108-->Arg) and A-I Hita (Ala-95-->Asp).", "journal": "Biochim. Biophys. Acta", "date": "1994", "authors": "Araki K, Sasaki J, Matsunaga A, Takada Y, Moriyama K, Hidaka K, Arakawa K", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "7918609", "url": "https://glygen.org/publication/PubMed/7918609" } ] }, { "title": "A nonsense mutation in the apolipoprotein A-I gene is associated with high-density lipoprotein deficiency and periorbital xanthelasmas.", "journal": "Arteriosclerosis and thrombosis : a journal of vascular biology", "date": "1994", "authors": "Romling R, von Eckardstein A, Funke H, Motti C, Fragiacomo GC, Noseda G, Assmann G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "7981179", "url": "https://glygen.org/publication/PubMed/7981179" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Binding of pentraxins to different nuclear structures: C-reactive protein binds to small nuclear ribonucleoprotein particles, serum amyloid P component binds to chromatin and nucleoli.", "journal": "Clinical and experimental immunology", "date": "1994", "authors": "Pepys MB, Booth SE, Tennent GA, Butler PJ, Williams DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8033412", "url": "https://glygen.org/publication/PubMed/8033412" } ] }, { "title": "Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.", "journal": "Nature genetics", "date": "1993", "authors": "Benson MD, Liepnieks J, Uemichi T, Wheeler G, Correa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8097946", "url": "https://glygen.org/publication/PubMed/8097946" } ] }, { "title": "Structure of pentameric human serum amyloid P component.", "journal": "Nature", "date": "1994", "authors": "Emsley J, White HE, O'Hara BP, Oliva G, Srinivasan N, Tickle IJ, Blundell TL, Pepys MB, Wood SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8114934", "url": "https://glygen.org/publication/PubMed/8114934" } ] }, { "title": "The type I macrophage scavenger receptor binds to gram-positive bacteria and recognizes lipoteichoic acid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Dunne DW, Resnick D, Greenberg J, Krieger M, Joiner KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8127896", "url": "https://glygen.org/publication/PubMed/8127896" } ] }, { "title": "Pathogenic potential of human monoclonal immunoglobulin light chains: relationship of in vitro aggregation to in vivo organ deposition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Myatt EA, Westholm FA, Weiss DT, Solomon A, Schiffer M, Stevens FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8159701", "url": "https://glygen.org/publication/PubMed/8159701" } ] }, { "title": "Familial nephropathic systemic amyloidosis caused by apolipoprotein AI variant Arg26.", "journal": "The Quarterly journal of medicine", "date": "1994", "authors": "Vigushin DM, Gough J, Allan D, Alguacil A, Penner B, Pettigrew NM, Quinonez G, Bernstein K, Booth SE, Booth DR, et al.", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "8208902", "url": "https://glygen.org/publication/PubMed/8208902" } ] }, { "title": "Autosomal dominant hypoalphalipoproteinemia due to a completely defective apolipoprotein A-I gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1993", "authors": "Nakata K, Kobayashi K, Yanagi H, Shimakura Y, Tsuchiya S, Arinami T, Hamaguchi H", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "8240372", "url": "https://glygen.org/publication/PubMed/8240372" } ] }, { "title": "The preferential site of non-enzymatic glycation of human apolipoprotein A-I in vivo.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1993", "authors": "Calvo C, Ulloa N, Campos M, Verdugo C, Ayrault-Jarrier M", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647#ptm_processing" }, { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "8261628", "url": "https://glygen.org/publication/PubMed/8261628" } ] }, { "title": "Apolipoprotein A-I Q[-2]X causing isolated apolipoprotein A-I deficiency in a family with analphalipoproteinemia.", "journal": "The Journal of clinical investigation", "date": "1994", "authors": "Ng DS, Leiter LA, Vezina C, Connelly PW, Hegele RA", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "8282791", "url": "https://glygen.org/publication/PubMed/8282791" } ] }, { "title": "Secretion-capture role for apolipoprotein E in remnant lipoprotein metabolism involving cell surface heparan sulfate proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ji ZS, Fazio S, Lee YL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963901", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901" } ], "reference": [ { "type": "PubMed", "id": "8300609", "url": "https://glygen.org/publication/PubMed/8300609" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "[PMP70, the 70-kDa peroxisomal membrane protein: a member of the ATP-binding cassette transporters].", "journal": "Nihon rinsho. Japanese journal of clinical medicine", "date": "1993", "authors": "Kamijo K, Osumi T, Hashimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "8411712", "url": "https://glygen.org/publication/PubMed/8411712" } ] }, { "title": "Endothelial-cell heme uptake from heme proteins: induction of sensitization and desensitization to oxidant damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Balla J, Jacob HS, Balla G, Nath K, Eaton JW, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8415693", "url": "https://glygen.org/publication/PubMed/8415693" } ] }, { "title": "In vivo fate of hemopexin and heme-hemopexin complexes in the rat.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Potter D, Chroneos ZC, Baynes JW, Sinclair PR, Gorman N, Liem HH, Muller-Eberhard U, Thorpe SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8424694", "url": "https://glygen.org/publication/PubMed/8424694" } ] }, { "title": "Polynucleotide binding to macrophage scavenger receptors depends on the formation of base-quartet-stabilized four-stranded helices.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Pearson AM, Rich A, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8429030", "url": "https://glygen.org/publication/PubMed/8429030" } ] }, { "title": "Human lysozyme gene mutations cause hereditary systemic amyloidosis.", "journal": "Nature", "date": "1993", "authors": "Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8464497", "url": "https://glygen.org/publication/PubMed/8464497" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "The carboxy terminus of the beta amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease.", "journal": "Biochemistry", "date": "1993", "authors": "Jarrett JT, Berger EP, Lansbury PT Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8490014", "url": "https://glygen.org/publication/PubMed/8490014" } ] }, { "title": "Adrenoleukodystrophy gene: unexpected homology to a protein involved in peroxisome biogenesis.", "journal": "Biochimie", "date": "1993", "authors": "Aubourg P, Mosser J, Douar AM, Sarde CO, Lopez J, Mandel JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "8507690", "url": "https://glygen.org/publication/PubMed/8507690" } ] }, { "title": "Demonstration of a physical interaction between microsomal triglyceride transfer protein and apolipoprotein B during the assembly of ApoB-containing lipoproteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wu X, Zhou M, Huang LS, Wetterau J, Ginsberg HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-8963888", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888" } ], "reference": [ { "type": "PubMed", "id": "8626595", "url": "https://glygen.org/publication/PubMed/8626595" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "Conformation of human serum apolipoprotein A-I(166-185) in the presence of sodium dodecyl sulfate or dodecylphosphocholine by 1H-NMR and CD. Evidence for specific peptide-SDS interactions.", "journal": "Biochim. Biophys. Acta", "date": "1996", "authors": "Wang G, Treleaven W D, Cushley R J", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "8664326", "url": "https://glygen.org/publication/PubMed/8664326" } ] }, { "title": "Primary structure of a novel ABC transporter with a chromosomal localization on the band encoding the multidrug resistance-associated protein.", "journal": "FEBS letters", "date": "1996", "authors": "Klugbauer N, Hofmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "8706931", "url": "https://glygen.org/publication/PubMed/8706931" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "Scavenger receptor-mediated adhesion of microglia to beta-amyloid fibrils.", "journal": "Nature", "date": "1996", "authors": "El Khoury J, Hickman SE, Thomas CA, Cao L, Silverstein SC, Loike JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8751442", "url": "https://glygen.org/publication/PubMed/8751442" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Binding studies of a triple-helical peptide model of macrophage scavenger receptor to tetraplex nucleic acids.", "journal": "Biochemistry", "date": "1996", "authors": "Mielewczyk SS, Breslauer KJ, Anachi RB, Brodsky B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "8784195", "url": "https://glygen.org/publication/PubMed/8784195" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Role of hemopexin in protection of low-density lipoprotein against hemoglobin-induced oxidation.", "journal": "Biochemistry", "date": "1996", "authors": "Miller YI, Smith A, Morgan WT, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8855948", "url": "https://glygen.org/publication/PubMed/8855948" } ] }, { "title": "Localized amyloidosis of the seminal vesicle: identification of lactoferrin immunoreactivity in the amyloid material.", "journal": "Pathology international", "date": "1996", "authors": "Tsutsumi Y, Serizawa A, Hori S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "8870004", "url": "https://glygen.org/publication/PubMed/8870004" } ] }, { "title": "Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Oyake T, Itoh K, Motohashi H, Hayashi N, Hoshino H, Nishizawa M, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8887638", "url": "https://glygen.org/publication/PubMed/8887638" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Prolactin-derived amyloid in the aging pituitary gland.", "journal": "The American journal of pathology", "date": "1997", "authors": "Westermark P, Eriksson L, Engstrom U, Enestrom S, Sletten K", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9006323", "url": "https://glygen.org/publication/PubMed/9006323" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.", "journal": "Nature genetics", "date": "1997", "authors": "Munier FL, Korvatska E, Djemai A, Le Paslier D, Zografos L, Pescia G, Schorderet DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9054935", "url": "https://glygen.org/publication/PubMed/9054935" } ] }, { "title": "Murine SR-BI, a high density lipoprotein receptor that mediates selective lipid uptake, is N-glycosylated and fatty acylated and colocalizes with plasma membrane caveolae.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Babitt J, Trigatti B, Rigotti A, Smart EJ, Anderson RG, Xu S, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9148942", "url": "https://glygen.org/publication/PubMed/9148942" } ] }, { "title": "Characterization of CLA-1, a human homologue of rodent scavenger receptor BI, as a receptor for high density lipoprotein and apoptotic thymocytes.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Murao K, Terpstra V, Green SR, Kondratenko N, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9211901", "url": "https://glygen.org/publication/PubMed/9211901" } ] }, { "title": "Endocytic uptake of lysophosphatidylcholine mediated by macrophage scavenger receptor plays a major role in oxidized low density lipoprotein-induced macrophage growth.", "journal": "Journal of atherosclerosis and thrombosis", "date": "1996", "authors": "Sakai M, Miyazaki A, Hakamata H, Kobori S, Shichiri M, Horiuchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9225214", "url": "https://glygen.org/publication/PubMed/9225214" } ] }, { "title": "Apolipoproteins of HDL can directly mediate binding to the scavenger receptor SR-BI, an HDL receptor that mediates selective lipid uptake.", "journal": "Journal of lipid research", "date": "1997", "authors": "Xu S, Laccotripe M, Huang X, Rigotti A, Zannis VI, Krieger M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9254056", "url": "https://glygen.org/publication/PubMed/9254056" } ] }, { "title": "cDNA cloning and mRNA expression of the human adrenoleukodystrophy related protein (ALDRP), a peroxisomal ABC transporter.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Holzinger A, Kammerer S, Berger J, Roscher AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1369062", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062" } ], "reference": [ { "type": "PubMed", "id": "9345306", "url": "https://glygen.org/publication/PubMed/9345306" } ] }, { "title": "Crystal structure of truncated human apolipoprotein A-I suggests a lipid-bound conformation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Borhani D W, Rogers D P, Engler J A, Brouillette C G", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "9356442", "url": "https://glygen.org/publication/PubMed/9356442" } ] }, { "title": "CLA-1 is an 85-kD plasma membrane glycoprotein that acts as a high-affinity receptor for both native (HDL, LDL, and VLDL) and modified (OxLDL and AcLDL) lipoproteins.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1997", "authors": "Calvo D, Gomez-Coronado D, Lasuncion MA, Vega MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9409200", "url": "https://glygen.org/publication/PubMed/9409200" } ] }, { "title": "Evidence that the lipid moiety of oxidized low density lipoprotein plays a role in its interaction with macrophage receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Terpstra V, Bird DA, Steinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9465098", "url": "https://glygen.org/publication/PubMed/9465098" } ] }, { "title": "Structure of the human macrophage MARCO receptor and characterization of its bacteria-binding region.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Elomaa O, Sankala M, Pikkarainen T, Bergmann U, Tuuttila A, Raatikainen-Ahokas A, Sariola H, Tryggvason K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9468508", "url": "https://glygen.org/publication/PubMed/9468508" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Scavenger receptors mediate adhesion of activated B lymphocytes.", "journal": "Experimental cell research", "date": "1998", "authors": "Yokota T, Ehlin-Henriksson B, Hansson GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9511720", "url": "https://glygen.org/publication/PubMed/9511720" } ] }, { "title": "A novel homozygous missense mutation in the apo A-I gene with apo A-I deficiency.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Huang W, Sasaki J, Matsunaga A, Nanimatsu H, Moriyama K, Han H, Kugi M, Koga T, Yamaguchi K, Arakawa K", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "reference": [ { "type": "PubMed", "id": "9514407", "url": "https://glygen.org/publication/PubMed/9514407" } ] }, { "title": "A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake.", "journal": "Journal of lipid research", "date": "1998", "authors": "Gough PJ, Greaves DR, Gordon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000480", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480" } ], "reference": [ { "type": "PubMed", "id": "9548586", "url": "https://glygen.org/publication/PubMed/9548586" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "Transfer of heme from heme-albumin to hemopexin.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Morgan WT, Liem HH, Sutor RP, Muller-Ebergard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "971416", "url": "https://glygen.org/publication/PubMed/971416" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "Structural and functional properties of two mutants of lecithin-cholesterol acyltransferase (T123I and N228K).", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Adimoolam S, Jin L, Grabbe E, Shieh JJ, Jonas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964058", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058" } ], "reference": [ { "type": "PubMed", "id": "9829992", "url": "https://glygen.org/publication/PubMed/9829992" } ] }, { "title": "CD36 is required for phagocytosis of apoptotic cells by human macrophages that use either a phosphatidylserine receptor or the vitronectin receptor (alpha v beta 3).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Fadok VA, Warner ML, Bratton DL, Henson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000471", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471" } ], "reference": [ { "type": "PubMed", "id": "9834113", "url": "https://glygen.org/publication/PubMed/9834113" } ] }, { "title": "Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha-synuclein protein implicated in Parkinson's disease.", "journal": "FEBS letters", "date": "1998", "authors": "El-Agnaf OM, Jakes R, Curran MD, Wallace A", "evidence": [ { "database": "Reactome", "id": "R-HSA-977225", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225" } ], "reference": [ { "type": "PubMed", "id": "9862427", "url": "https://glygen.org/publication/PubMed/9862427" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] } ], "pathway": [ { "id": "hsa:335", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:335", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-1369062", "name": "ABC transporters in lipid homeostasis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1369062", "resource": "Reactome", "description": "ABC transporters in lipid homeostasis" }, { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-2168880", "name": "Scavenging of heme from plasma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "resource": "Reactome", "description": "Scavenging of heme from plasma" }, { "id": "R-HSA-3000471", "name": "Scavenging by Class B Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000471", "resource": "Reactome", "description": "Scavenging by Class B Receptors" }, { "id": "R-HSA-3000480", "name": "Scavenging by Class A Receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000480", "resource": "Reactome", "description": "Scavenging by Class A Receptors" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-5682113", "name": "Defective ABCA1 causes TGD", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5682113", "resource": "Reactome", "description": "Defective ABCA1 causes TGD" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" }, { "id": "R-HSA-8963888", "name": "Chylomicron assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963888", "resource": "Reactome", "description": "Chylomicron assembly" }, { "id": "R-HSA-8963896", "name": "HDL assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963896", "resource": "Reactome", "description": "HDL assembly" }, { "id": "R-HSA-8963901", "name": "Chylomicron remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8963901", "resource": "Reactome", "description": "Chylomicron remodeling" }, { "id": "R-HSA-8964011", "name": "HDL clearance", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964011", "resource": "Reactome", "description": "HDL clearance" }, { "id": "R-HSA-8964058", "name": "HDL remodeling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964058", "resource": "Reactome", "description": "HDL remodeling" }, { "id": "R-HSA-9707616", "name": "Heme signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "resource": "Reactome", "description": "Heme signaling" }, { "id": "R-HSA-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" }, { "id": "R-HSA-977225", "name": "Amyloid fiber formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "description": "Amyloid fiber formation" } ], "orthologs": [ { "uniprot_canonical_ac": "P04639-1", "protein_name": "Apolipoprotein A-I", "gene_name": "Apoa1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKAAVLAVALVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESSTLGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKMQPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRAKFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLEAWKAKIMSMIDEAKKKLNA", "length": 259 }, "evidence": [ { "id": "45916771", "url": "http://www.informatics.jax.org/homology/45916771", "database": "MGI" }, { "id": "P02647", "url": "https://omabrowser.org/oma/group/P02647/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q00623-1", "protein_name": "Apolipoprotein A-I", "gene_name": "Apoa1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ", "length": 264 }, "evidence": [ { "id": "45916771", "url": "http://www.informatics.jax.org/homology/45916771", "database": "MGI" }, { "id": "P02647", "url": "https://omabrowser.org/oma/group/P02647/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phospholipid binding", "id": "GO:0005543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005543", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "apolipoprotein A-I receptor binding", "id": "GO:0034191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034191", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "amyloid-beta binding", "id": "GO:0001540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001540", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "heat shock protein binding", "id": "GO:0031072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031072", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol binding", "id": "GO:0015485", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015485", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle binding", "id": "GO:0008035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008035", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "apolipoprotein receptor binding", "id": "GO:0034190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034190", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phosphatidylcholine-sterol O-acyltransferase activator activity", "id": "GO:0060228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060228", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle receptor binding", "id": "GO:0070653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070653", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "chemorepellent activity", "id": "GO:0045499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045499", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol transfer activity", "id": "GO:0120020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120020", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 17, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle", "id": "GO:0034364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034364", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "endocytic vesicle", "id": "GO:0030139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030139", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "very-low-density lipoprotein particle", "id": "GO:0034361", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034361", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "spherical high-density lipoprotein particle", "id": "GO:0034366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034366", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "endocytic vesicle lumen", "id": "GO:0071682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071682", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "extracellular vesicle", "id": "GO:1903561", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903561", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 50, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of cholesterol efflux", "id": "GO:0010875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010875", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phospholipid efflux", "id": "GO:0033700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033700", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "lipoprotein biosynthetic process", "id": "GO:0042158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042158", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of interleukin-1 beta production", "id": "GO:0032691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032691", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of CoA-transferase activity", "id": "GO:1905920", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905920", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phosphatidylcholine biosynthetic process", "id": "GO:0006656", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006656", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol biosynthetic process", "id": "GO:0006695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006695", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol efflux", "id": "GO:0033344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033344", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle remodeling", "id": "GO:0034375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034375", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "reverse cholesterol transport", "id": "GO:0043691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043691", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of stress fiber assembly", "id": "GO:0051496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051496", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phospholipid homeostasis", "id": "GO:0055091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055091", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "regulation of Cdc42 protein signal transduction", "id": "GO:0032489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032489", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "phosphatidylcholine metabolic process", "id": "GO:0046470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046470", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of phagocytosis", "id": "GO:0050766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050766", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of substrate adhesion-dependent cell spreading", "id": "GO:1900026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900026", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle assembly", "id": "GO:0034380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034380", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of Rho protein signal transduction", "id": "GO:0035025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035025", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of phospholipid efflux", "id": "GO:1902995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902995", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of very-low-density lipoprotein particle remodeling", "id": "GO:0010903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010903", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "protein oxidation", "id": "GO:0018158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018158", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "peptidyl-methionine modification", "id": "GO:0018206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018206", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "regulation of intestinal cholesterol absorption", "id": "GO:0030300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030300", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "high-density lipoprotein particle clearance", "id": "GO:0034384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034384", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "blood vessel endothelial cell migration", "id": "GO:0043534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043534", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "triglyceride homeostasis", "id": "GO:0070328", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070328", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor-mediated signaling pathway", "id": "GO:0010804", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010804", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of heterotypic cell-cell adhesion", "id": "GO:0034115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034115", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of response to cytokine stimulus", "id": "GO:0060761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060761", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "regulation of protein phosphorylation", "id": "GO:0001932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001932", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "endothelial cell proliferation", "id": "GO:0001935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001935", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "glucocorticoid metabolic process", "id": "GO:0008211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008211", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "lipid storage", "id": "GO:0019915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019915", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol transport", "id": "GO:0030301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030301", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "adrenal gland development", "id": "GO:0030325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030325", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative chemotaxis", "id": "GO:0050919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050919", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "vitamin transport", "id": "GO:0051180", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051180", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of hydrolase activity", "id": "GO:0051345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051345", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of cell adhesion molecule production", "id": "GO:0060354", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060354", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "cholesterol import", "id": "GO:0070508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070508", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "positive regulation of cholesterol metabolic process", "id": "GO:0090205", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090205", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "negative regulation of cytokine production involved in immune response", "id": "GO:0002719", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002719", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" }, { "name": "lipoprotein metabolic process", "id": "GO:0042157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042157", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Palmitoylated.", "evidence": [ { "database": "UniProtKB", "id": "P02647", "url": "https://www.uniprot.org/uniprot/P02647" }, { "database": "PubMed", "id": "3005308", "url": "https://glygen.org/publication/PubMed/3005308" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 220, 221, 228 ], "snv_sites": [ 76, 164, 228 ], "glycation_sites": [ 263 ], "phosphorylation_sites": [ 55, 166, 185, 191, 221, 252 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 456 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }