{ "uniprot_canonical_ac": "P02599-1", "uniprot_ac": "P02599", "uniprot_id": "CALM_DICDI", "mass": { "chemical_mass": 17151.0, "monoisotopic_mass": 17151.0 }, "refseq": { "ac": "XP_641695", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_641695" }, "gene_names": [ { "name": "calA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P02599", "id": "P02599" }, { "name": "DDB_G0279407", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02599", "id": "P02599" }, { "name": "calA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_641695", "id": "XP_641695" }, { "name": "camA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P02599", "id": "P02599" } ], "protein_names": [ { "name": "Calmodulin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P02599" }, { "name": "CaM", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P02599" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_641695", "id": "XP_641695" } ], "function": [ { "annotation": "Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599#function" }, { "database": "PubMed", "id": "6243626", "url": "https://glygen.org/publication/PubMed/6243626" }, { "database": "PubMed", "id": "6087882", "url": "https://glygen.org/publication/PubMed/6087882" }, { "database": "PubMed", "id": "1493336", "url": "https://glygen.org/publication/PubMed/1493336" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "calA", "url": "https://www.uniprot.org/uniprot/P02599", "locus": {} } ], "crossref": [ { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0279407", "url": "http://dictybase.org/gene/DDB_G0279407", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8622104", "url": "https://www.ncbi.nlm.nih.gov/gene/8622104", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "P02599", "url": "https://www.ebi.ac.uk/intact/interactors/id:P02599*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0279407", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0279407", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SCDRHPP", "url": "https://omabrowser.org/oma/group/SCDRHPP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23050", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23050", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23050:SF518", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23050:SF518", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13499", "url": "http://pfam.xfam.org/family/PF13499", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P02599", "url": "http://purl.obolibrary.org/obo/PR_P02599", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-111932", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-111932", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-111957", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-111957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-1474151", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1474151", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-163615", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-163615", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-1855204", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1855204", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-203615", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2871809", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-4086398", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-442729", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-442729", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5218920", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5218920", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5607763", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5607763", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5626467", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5626467", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9009391", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9619229", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9619229", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_641695", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_641695", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P02599-1", "url": "https://www.uniprot.org/uniprot/P02599-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASQESLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDEFVKMMIVRN", "length": 152, "header": "sp|P02599-1|CALM_DICDI Isoform 1 of Calmodulin OS=Dictyostelium discoideum OX=44689 GN=calA PE=1 SV=3 CANONICAL=P02599-1" }, "isoforms": [ { "isoform_ac": "P02599-1", "url": "", "sequence": { "sequence": "MASQESLTEEQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGNIDFPEFLTMMARKMQDTDTEEEIREAFKVFDKDGNGYISAAELRHVMTSLGEKLTNEEVDEMIREADLDGDGQVNYDEFVKMMIVRN", "length": 152, "header": "sp|P02599-1|CALM_DICDI Isoform 1 of Calmodulin OS=Dictyostelium discoideum OX=44689 GN=calA PE=1 SV=3 CANONICAL=P02599-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Nucleomorphin. A novel, acidic, nuclear calmodulin-binding protein from Dictyostelium that regulates nuclear number.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Myre Michael A, O'Day Danton H", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "11919178", "url": "https://glygen.org/publication/PubMed/11919178" } ] }, { "title": "A transcriptional profile of multicellular development in Dictyostelium discoideum.", "journal": "Development", "date": "2002", "authors": "Van Driessche Nancy, Shaw Chad, Katoh Mariko, Morio Takahiro, Sucgang Richard, Ibarra Miroslava, Kuwayama Hidekazu, Saito Tamao, Urushihara Hideko, Maeda Mineko, Takeuchi Ikuo, Ochiai Hiroshi, Eaton William, Tollett Jeffrey, Halter John, Kuspa Adam, Tanaka Yoshimasa, Shaulsky Gad", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "11923193", "url": "https://glygen.org/publication/PubMed/11923193" } ] }, { "title": "Genome-wide expression analyses of gene regulation during early development of Dictyostelium discoideum.", "journal": "Eukaryot. Cell", "date": "2003", "authors": "Iranfar Negin, Fuller Danny, Loomis William F", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "12912885", "url": "https://glygen.org/publication/PubMed/12912885" } ] }, { "title": "DWWA, a novel protein containing two WW domains and an IQ motif, is required for scission of the residual cytoplasmic bridge during cytokinesis in Dictyostelium.", "journal": "Mol. Biol. Cell", "date": "2004", "authors": "Nagasaki Akira, Uyeda Taro Q P", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "14595117", "url": "https://glygen.org/publication/PubMed/14595117" } ] }, { "title": "Inducible expression of calmodulin antisense RNA in Dictyostelium cells inhibits the completion of cytokinesis.", "journal": "Molecular biology of the cell", "date": "1992-12", "authors": "Liu T, Williams J G, Clarke M", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "1493336", "url": "https://glygen.org/publication/PubMed/1493336" } ] }, { "title": "Calmodulin binds to and inhibits the activity of phosphoglycerate kinase.", "journal": "Biochim. Biophys. Acta", "date": "2004", "authors": "Myre Michael A, O'Day Danton H", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "15363631", "url": "https://glygen.org/publication/PubMed/15363631" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Isolation and characterization of Dictyostelium thymidine kinase 1 as a calmodulin-binding protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "O'Day Danton H, Chatterjee-Chakraborty Munmun, Wagler Stephanie, Myre Michael A", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "15883042", "url": "https://glygen.org/publication/PubMed/15883042" } ] }, { "title": "Association of calmodulin and an unconventional myosin with the contractile vacuole complex of Dictyostelium discoideum.", "journal": "J. Cell Biol.", "date": "1992", "authors": "Zhu Q, Clarke M", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "1629238", "url": "https://glygen.org/publication/PubMed/1629238" } ] }, { "title": "Isolation, characterization, and bioinformatic analysis of calmodulin-binding protein cmbB reveals a novel tandem IP22 repeat common to many Dictyostelium and Mimivirus proteins.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2006", "authors": "O'Day Danton H, Suhre Karsten, Myre Michael A, Chatterjee-Chakraborty Munmun, Chavez Sara E", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "16777069", "url": "https://glygen.org/publication/PubMed/16777069" } ] }, { "title": "Identification and isolation of Dictyostelium microtubule-associated protein interactors by tandem affinity purification.", "journal": "Eur. J. Cell Biol.", "date": "2006", "authors": "Koch Katrin V, Reinders Yvonne, Ho Thi-Hieu, Sickmann Albert, Gr\u00e4f Ralph", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "16782229", "url": "https://glygen.org/publication/PubMed/16782229" } ] }, { "title": "Identification of the single gene for calmodulin in Dictyostelium discoideum.", "journal": "Mol. Cell. Biol.", "date": "1986", "authors": "Goldhagen H, Clarke M", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "3785182", "url": "https://glygen.org/publication/PubMed/3785182" } ] }, { "title": "Structural and functional properties of calmodulin from the eukaryotic microorganism Dictyostelium discoideum.", "journal": "Biochemistry", "date": "1984-06-19", "authors": "Marshak D R, Clarke M, Roberts D M, Watterson D M", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "6087882", "url": "https://glygen.org/publication/PubMed/6087882" } ] }, { "title": "Isolation and properties of calmodulin from Dictyostelium discoideum.", "journal": "Journal of bacteriology", "date": "1980-01", "authors": "Clarke M, Bazari W L, Kayman S C", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "reference": [ { "type": "PubMed", "id": "6243626", "url": "https://glygen.org/publication/PubMed/6243626" } ] } ], "pathway": [ { "id": "ddi:DDB_G0279407", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0279407", "resource": "KEGG Pathway" }, { "id": "R-DDI-111932", "name": "CaMK IV-mediated phosphorylation of CREB", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-111932", "resource": "Reactome", "description": "CaMK IV-mediated phosphorylation of CREB" }, { "id": "R-DDI-111957", "name": "Cam-PDE 1 activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-111957", "resource": "Reactome", "description": "Cam-PDE 1 activation" }, { "id": "R-DDI-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-DDI-1474151", "name": "Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1474151", "resource": "Reactome", "description": "Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation" }, { "id": "R-DDI-163615", "name": "PKA activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-163615", "resource": "Reactome", "description": "PKA activation" }, { "id": "R-DDI-1855204", "name": "Synthesis of IP3 and IP4 in the cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1855204", "resource": "Reactome", "description": "Synthesis of IP3 and IP4 in the cytosol" }, { "id": "R-DDI-203615", "name": "eNOS activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-203615", "resource": "Reactome", "description": "eNOS activation" }, { "id": "R-DDI-2871809", "name": "FCERI mediated Ca+2 mobilization", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2871809", "resource": "Reactome", "description": "FCERI mediated Ca+2 mobilization" }, { "id": "R-DDI-4086398", "name": "Ca2+ pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-4086398", "resource": "Reactome", "description": "Ca2+ pathway" }, { "id": "R-DDI-442729", "name": "CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-442729", "resource": "Reactome", "description": "CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde" }, { "id": "R-DDI-5218920", "name": "VEGFR2 mediated vascular permeability", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5218920", "resource": "Reactome", "description": "VEGFR2 mediated vascular permeability" }, { "id": "R-DDI-5607763", "name": "CLEC7A (Dectin-1) induces NFAT activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5607763", "resource": "Reactome", "description": "CLEC7A (Dectin-1) induces NFAT activation" }, { "id": "R-DDI-5626467", "name": "RHO GTPases activate IQGAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5626467", "resource": "Reactome", "description": "RHO GTPases activate IQGAPs" }, { "id": "R-DDI-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-DDI-9009391", "name": "Extra-nuclear estrogen signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9009391", "resource": "Reactome", "description": "Extra-nuclear estrogen signaling" }, { "id": "R-DDI-9619229", "name": "Activation of RAC1 downstream of NMDARs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9619229", "resource": "Reactome", "description": "Activation of RAC1 downstream of NMDARs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "plasma membrane repair", "id": "GO:0001778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001778", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "positive regulation of sequestering of calcium ion", "id": "GO:0051284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051284", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "negative regulation of proteolysis", "id": "GO:0045861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045861", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "protein export from nucleus", "id": "GO:0006611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006611", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "establishment of protein localization to vacuole", "id": "GO:0072666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072666", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "regulation of sorocarp stalk cell differentiation", "id": "GO:0031285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031285", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "positive regulation of positive chemotaxis to cAMP", "id": "GO:0061122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061122", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "negative regulation of asexual reproduction", "id": "GO:1903665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903665", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "contractile vacuole", "id": "GO:0000331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000331", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "cell adhesion molecule binding", "id": "GO:0050839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050839", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "protein kinase regulator activity", "id": "GO:0019887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019887", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "myosin I binding", "id": "GO:0017024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017024", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "enzyme regulator activity", "id": "GO:0030234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030234", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "troponin I binding", "id": "GO:0031013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031013", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "cyclic-nucleotide phosphodiesterase activity", "id": "GO:0004112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004112", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" }, { "name": "cyclic nucleotide phosphodiesterase activator activity", "id": "GO:0170005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0170005", "evidence": [ { "database": "UniProtKB", "id": "P02599", "url": "https://www.uniprot.org/uniprot/P02599" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }