{ "uniprot_canonical_ac": "P01889-1", "uniprot_ac": "P01889", "uniprot_id": "HLAB_HUMAN", "mass": { "chemical_mass": 40460.0, "monoisotopic_mass": 40460.0 }, "refseq": { "ac": "NP_005505", "name": "major histocompatibility complex, class I, B precursor", "summary": "HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, "gene_names": [ { "name": "HLA-B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01889", "id": "P01889" }, { "name": "AS; B-4901; HLAB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505", "id": "NP_005505" }, { "name": "HLA-B*44032", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01889", "id": "P01889" }, { "name": "HLA-B*4403", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01889", "id": "P01889" }, { "name": "HLA-B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505", "id": "NP_005505" }, { "name": "HLAB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01889", "id": "P01889" }, { "name": "MICA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01889", "id": "P01889" } ], "protein_names": [ { "name": "HLA class I histocompatibility antigen, B alpha chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01889" }, { "name": "HLA class I histocompatibility antigen, B alpha chain; MHC HLA-B cell surface glycoprotein; MHC class I antigen HLA-B heavy chain; MHC HLA-B transmembrane glycoprotein; MHC class I antigen SHCHA; leukocyte antigen class I-B; MHC class I molecule; MHC class 1 antigen; HLA class I antigen HLA-B; MHC class I antigen HLA-B alpha chain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505", "id": "NP_005505" }, { "name": "HLA-B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01889" }, { "name": "Human leukocyte antigen B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01889" }, { "name": "major histocompatibility complex, class I, B precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505", "id": "NP_005505" } ], "function": [ { "annotation": "Accurate identification of HLA-B*15:02 allele by two-dimensional polymerase chain reaction. Erratum:[Clin Chim Acta. 2024 Jan 15;553:117735. PMID: 38151427]", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, { "database": "PubMed", "id": "37972805", "url": "https://glygen.org/publication/PubMed/37972805" } ] }, { "annotation": "Allele B*07:02: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and mainly a Leu anchor residue at the C-terminus (PubMed:7743181). Presents a long peptide (APRGPHGGAASGL) derived from the cancer-testis antigen CTAG1A/NY-ESO-1, eliciting a polyclonal CD8-positive T cell response against tumor cells (PubMed:29531227). Presents viral epitopes derived from HIV-1 gag-pol (TPQDLNTML) and Nef (RPQVPLRPM) (PubMed:25808313). Presents an immunodominant epitope derived from SARS-CoV-2 N/nucleoprotein (SPRWYFYYL) (PubMed:32887977). Displays self-peptides including a peptide derived from the signal sequence of HLA-DPB1 (APRTVALTA) (PubMed:7743181).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "29531227", "url": "https://glygen.org/publication/PubMed/29531227" }, { "database": "PubMed", "id": "32887977", "url": "https://glygen.org/publication/PubMed/32887977" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" }, { "database": "PubMed", "id": "25808313", "url": "https://glygen.org/publication/PubMed/25808313" } ] }, { "annotation": "Allele B*08:01: Presents to CD8-positive T cells viral epitopes derived from EBV/HHV-4 EBNA3 (QAKWRLQTL), eliciting cytotoxic T cell response.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "9620674", "url": "https://glygen.org/publication/PubMed/9620674" } ] }, { "annotation": "Allele B*13:02: Presents multiple HIV-1 epitopes derived from gag (RQANFLGKI, GQMREPRGSDI), nef (RQDILDLWI), gag-pol (RQYDQILIE, GQGQWTYQI) and rev (LQLPPLERL), all having in common a Gln residue at position 2 and mainly hydrophobic amino acids Leu, Ile or Val at the C-terminus. Associated with succesful control of HIV-1 infection.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "17251285", "url": "https://glygen.org/publication/PubMed/17251285" } ] }, { "annotation": "Allele B*18:01: Preferentially presents octomeric and nonameric peptides sharing a common motif, namely a Glu at position 2 and Phe or Tyr anchor residues at the C-terminus (PubMed:14978097, PubMed:23749632, PubMed:18991276). Presents an EBV/HHV-4 epitope derived from BZLF1 (SELEIKRY) (PubMed:23749632). May present to CD8-positive T cells an antigenic peptide derived from MAGEA3 (MEVDPIGHLY), triggering an anti-tumor immune response (PubMed:12366779). May display a broad repertoire of self-peptides with a preference for peptides derived from RNA-binding proteins (PubMed:14978097).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "23749632", "url": "https://glygen.org/publication/PubMed/23749632" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" }, { "database": "PubMed", "id": "14978097", "url": "https://glygen.org/publication/PubMed/14978097" }, { "database": "PubMed", "id": "12366779", "url": "https://glygen.org/publication/PubMed/12366779" } ] }, { "annotation": "Allele B*27:05: Presents to CD8-positive T cells immunodominant viral epitopes derived from HCV POLG (ARMILMTHF), HIV-1 gag (KRWIILGLNK), IAV NP (SRYWAIRTR), SARS-CoV-2 N/nucleoprotein (QRNAPRITF), EBV/HHV-4 EBNA4 (HRCQAIRKK) and EBV/HHV-4 EBNA6 (RRIYDLIEL), conferring longterm protection against viral infection (PubMed:19139562, PubMed:18385228, PubMed:15113903, PubMed:9620674, PubMed:32887977). Can present self-peptides derived from cytosolic and nuclear proteins. All peptides carry an Arg at position 2 (PubMed:1922338). The peptide-bound form interacts with NK cell inhibitory receptor KIR3DL1 and inhibits NK cell activation in a peptide-specific way, being particularly sensitive to the nature of the amino acid side chain at position 8 of the antigenic peptide (PubMed:8879234, PubMed:15657948). KIR3DL1 fails to recognize HLA-B*27:05 in complex with B2M and EBV/HHV-4 EBNA6 (RRIYDLIEL) peptide, which can lead to increased activation of NK cells during infection (PubMed:15657948). May present an altered repertoire of peptides in the absence of TAP1-TAP2 and TAPBPL (PubMed:9620674).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "9620674", "url": "https://glygen.org/publication/PubMed/9620674" }, { "database": "PubMed", "id": "15657948", "url": "https://glygen.org/publication/PubMed/15657948" }, { "database": "PubMed", "id": "18385228", "url": "https://glygen.org/publication/PubMed/18385228" }, { "database": "PubMed", "id": "19139562", "url": "https://glygen.org/publication/PubMed/19139562" }, { "database": "PubMed", "id": "15113903", "url": "https://glygen.org/publication/PubMed/15113903" }, { "database": "PubMed", "id": "1922338", "url": "https://glygen.org/publication/PubMed/1922338" }, { "database": "PubMed", "id": "8879234", "url": "https://glygen.org/publication/PubMed/8879234" } ] }, { "annotation": "Allele B*40:01: Presents immunodominant viral epitopes derived from EBV/HHV-4 LMP2 (IEDPPFNSL) and SARS-CoV-2 N/nucleoprotein (MEVTPSGTWL), triggering memory CD8-positive T cell response (PubMed:18991276, PubMed:32887977). Displays self-peptides sharing a signature motif, namely a Glu at position 2 and a Leu anchor residue at the C-terminus (PubMed:18991276).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "32887977", "url": "https://glygen.org/publication/PubMed/32887977" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*41:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*44:02: Presents immunodominant viral epitopes derived from EBV/HHV-4 EBNA4 (VEITPYKPTW) and EBNA6 (AEGGVGWRHW, EENLLDFVRF), triggering memory CD8-positive T cell response (PubMed:9620674, PubMed:18991276). Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Phe, Tyr or Trp anchor residues at the C-terminus (PubMed:18991276).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "9620674", "url": "https://glygen.org/publication/PubMed/9620674" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*45:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*46:01: Preferentially presents nonameric peptides sharing a signature motif, namely Ala and Leu at position 2 and Tyr, Phe, Leu, or Met anchor residues at the C-terminus. The peptide-bound form interacts with KIR2DL3 and inhibits NK cell cytotoxic response in a peptide-specific way.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "28514659", "url": "https://glygen.org/publication/PubMed/28514659" } ] }, { "annotation": "Allele B*47:01: Displays self-peptides sharing a signature motif, namely an Asp at position 2 and Leu or Met anchor residues at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*49:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ile or Val anchor residues at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*50:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "annotation": "Allele B*51:01: Presents an octomeric HIV-1 epitope derived from gag-pol (TAFTIPSI) to the public TRAV17/TRBV7-3 TCR clonotype, strongly suppressing HIV-1 replication.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "24600035", "url": "https://glygen.org/publication/PubMed/24600035" } ] }, { "annotation": "Allele B*54:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" } ] }, { "annotation": "Allele B*55:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" } ] }, { "annotation": "Allele B*56:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" } ] }, { "annotation": "Allele B*57:01: The peptide-bound form recognizes KIR3DL1 and inhibits NK cell cytotoxic response. Presents HIV gag peptides (immunodominant KAFSPEVIPMF and subdominant KALGPAATL epitopes) predominantly to CD8-positive T cell clones expressing a TRAV41-containing TCR, triggering HLA-B-restricted T cell responses.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "25480565", "url": "https://glygen.org/publication/PubMed/25480565" }, { "database": "PubMed", "id": "22020283", "url": "https://glygen.org/publication/PubMed/22020283" }, { "database": "PubMed", "id": "34228645", "url": "https://glygen.org/publication/PubMed/34228645" } ] }, { "annotation": "Allele B*67:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Leu anchor residue at the C-terminus.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" } ] }, { "annotation": "Antigen-presenting major histocompatibility complex class I (MHCI) molecule. In complex with B2M/beta 2 microglobulin displays primarily viral and tumor-derived peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-B-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected or transformed cells (PubMed:25808313, PubMed:29531227, PubMed:9620674, PubMed:23209413). May also present self-peptides derived from the signal sequence of secreted or membrane proteins, although T cells specific for these peptides are usually inactivated to prevent autoreactivity (PubMed:7743181, PubMed:18991276). Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells (PubMed:29531227, PubMed:9620674, PubMed:24600035). Typically presents intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via constitutive proteasome and IFNG-induced immunoproteasome (PubMed:23209413). Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9 (PubMed:25808313, PubMed:29531227).", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#function" }, { "database": "PubMed", "id": "9620674", "url": "https://glygen.org/publication/PubMed/9620674" }, { "database": "PubMed", "id": "29531227", "url": "https://glygen.org/publication/PubMed/29531227" }, { "database": "PubMed", "id": "24600035", "url": "https://glygen.org/publication/PubMed/24600035" }, { "database": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" }, { "database": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" }, { "database": "PubMed", "id": "23209413", "url": "https://glygen.org/publication/PubMed/23209413" }, { "database": "PubMed", "id": "25808313", "url": "https://glygen.org/publication/PubMed/25808313" } ] }, { "annotation": "HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ] }, { "annotation": "HLA-B27 did not protect against COVID-19 in patients with axial spondyloarthritis - data from the ReumaCov-Brasil Registry. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, { "database": "PubMed", "id": "38031143", "url": "https://glygen.org/publication/PubMed/38031143" } ] }, { "annotation": "Involved in the presentation of foreign antigens to the immune system.", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PQE2", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE2#function" }, { "database": "UniProtKB", "id": "ARBA00002297", "url": "https://www.uniprot.org/uniprot/ARBA00002297#function" }, { "database": "UniProtKB", "id": "A0A140T9Y5", "url": "https://www.uniprot.org/uniprot/A0A140T9Y5#function" }, { "database": "UniProtKB", "id": "A0A1W2PQZ3", "url": "https://www.uniprot.org/uniprot/A0A1W2PQZ3#function" }, { "database": "UniProtKB", "id": "A0A140T997", "url": "https://www.uniprot.org/uniprot/A0A140T997#function" }, { "database": "UniProtKB", "id": "A0A140TA11", "url": "https://www.uniprot.org/uniprot/A0A140TA11#function" }, { "database": "UniProtKB", "id": "A0A140TA14", "url": "https://www.uniprot.org/uniprot/A0A140TA14#function" } ] }, { "annotation": "The HLA-B*57:01 allele corresponds to a very large MHC haploblock likely explaining its massive effect for HIV-1 elite control. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, { "database": "PubMed", "id": "38146367", "url": "https://glygen.org/publication/PubMed/38146367" } ] }, { "annotation": "[Genetic analysis of a Chinese pedigree with an allele dropout at the HLA-B locus].", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, { "database": "PubMed", "id": "38171559", "url": "https://glygen.org/publication/PubMed/38171559" } ] }, { "annotation": "[Multi-sequence relation attention network for diagnosing HLA-B27-negative axial spondyloarthritis].", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" }, { "database": "PubMed", "id": "38081615", "url": "https://glygen.org/publication/PubMed/38081615" } ] } ], "disease": [ { "disease_id": "DOID:0050426", "recommended_name": { "id": "DOID:0050426", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050426", "name": "Stevens-Johnson syndrome", "description": "A skin disease that is characterized by ulceration of less than 10 percent of the surface area of the body. The disease is often precipitated by the use of medications, such as antibiotics or antiepileptics, or onset of infection." }, "synonyms": [ { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "Stevens-Johnson syndrome", "description": "Stevens-Johnson syndrome is a limited form of toxic epidermal necrolysis characterized by destruction and detachment of the skin epithelium and mucous membranes involving less than 10% of the body surface area." }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "Dermatostomatitis, Stevens Johnson type", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "Stevens Johnson syndrome", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "Stevens-Johnson syndrome, susceptibility to", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "erythema multiforme major", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "hypersensitivity syndrome, carbamazepine-induced, susceptibility to", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "severe cutaneous adverse reaction, susceptibility to", "description": "" }, { "id": "MONDO:0018229", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0018229", "name": "toxic Epidermal necrolysis, susceptibility to", "description": "" }, { "id": "MIM:608579", "resource": "MIM", "url": "https://www.omim.org/entry/608579", "name": "Stevens-Johnson syndrome", "description": "Stevens-Johnson syndrome" } ], "evidence": [ { "id": "608579", "database": "MIM", "url": "https://www.omim.org/entry/608579" } ] }, { "disease_id": "DOID:0080603", "recommended_name": { "id": "DOID:0080603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080603", "name": "ankylosing spondylitis 1", "description": "A ankylosing spondylitis that has_material_basis_in variation in the HLA-B27 allele on chromosome 6p21.3." }, "synonyms": [ { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, 1", "description": "Any spondyloarthropathy, susceptibility to in which the cause of the disease is a mutation in the HLA-B gene." }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "HLA-B spondyloarthropathy, susceptibility to", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to caused by mutation in HLA-B", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, 1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "Bechterew syndrome", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "Marie-Strumpell spondylitis", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "SPDA1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "ankylosing spondylitis, susceptibility to", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "susceptibility to spondyloarthropathy 1", "description": "" }, { "id": "MIM:106300", "resource": "MIM", "url": "https://www.omim.org/entry/106300", "name": "Spondyloarthropathy 1", "description": "Spondyloarthropathy 1" } ], "evidence": [ { "id": "106300", "database": "MIM", "url": "https://www.omim.org/entry/106300" } ] }, { "disease_id": "DOID:7147", "recommended_name": { "id": "DOID:7147", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7147", "name": "ankylosing spondylitis", "description": "A bone inflammation disease that results_in inflammation in the joints of the spine and pelvis. The disease has_symptom pain, has_symptom stiffness in the spine, has_symptom stiffness in the neck, has_symptom stiffness in the hips, has_symptom stiffness in the jaw and has_symptom stiffness in the rib cage." }, "synonyms": [ { "id": "DOID:7147", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7147", "name": "Bekhterev syndrome", "description": "" }, { "id": "DOID:7147", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7147", "name": "Bekhterev's disease", "description": "" }, { "id": "DOID:7147", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:7147", "name": "Marie-Strumpell disease", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, 1", "description": "Any spondyloarthropathy, susceptibility to in which the cause of the disease is a mutation in the HLA-B gene." }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "HLA-B spondyloarthropathy, susceptibility to", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to caused by mutation in HLA-B", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, 1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "spondyloarthropathy, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "Bechterew syndrome", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "Marie-Strumpell spondylitis", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "SPDA1", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "ankylosing spondylitis, susceptibility to", "description": "" }, { "id": "MONDO:0007126", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007126", "name": "susceptibility to spondyloarthropathy 1", "description": "" }, { "id": "MIM:106300", "resource": "MIM", "url": "https://www.omim.org/entry/106300", "name": "Spondyloarthropathy 1", "description": "Spondyloarthropathy 1" } ], "evidence": [ { "id": "106300", "database": "MIM", "url": "https://www.omim.org/entry/106300" } ] } ], "snv": [ { "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 110, "end_pos": 110, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->IQS).", "chr_id": "6", "chr_pos": "31356702", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N110", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781747083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" }, { "id": "rs781747083", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781747083" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 110, "end_pos": 110, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "6", "chr_pos": "31356701", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N110", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746186270", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746186270" }, { "id": "rs746186270", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746186270" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 110, "end_pos": 110, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "6", "chr_pos": "31356702", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N110", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs151341207", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151341207" }, { "id": "rs151341207", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs151341207" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 112, "end_pos": 112, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->NQN).", "chr_id": "6", "chr_pos": "31356696", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01889" }, { "id": "rs151341208", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151341208" }, { "id": "rs151341208", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs151341208" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 112, "end_pos": 112, "subjects_tested": "560", "subjects_positive": "1", "frequency": "0.2", "sequence_org": "S", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQS->NQR).", "chr_id": "6", "chr_pos": "31356697", "ref_nt": "T", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S112", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01889" } ], "glycoeffect": [], "start_pos": 138, "end_pos": 138, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "6", "chr_pos": "31356374", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D138", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1321902349", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1321902349" }, { "id": "rs1321902349", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1321902349" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 158, "end_pos": 158, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "6", "chr_pos": "31356313", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T158", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01889" } ], "glycoeffect": [], "start_pos": 204, "end_pos": 204, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "6", "chr_pos": "31356176", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "E204", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P01889", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01889" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 335, "end_pos": 335, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KSS->NSS).", "chr_id": "6", "chr_pos": "31355114", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "K335", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs2596492", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2596492" }, { "id": "rs2596492", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2596492" }, { "id": "rs2596492", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2596492" }, { "id": "rs2596492", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2596492#frequency_tab" }, { "id": "rs2596492", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2596492" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YTS->NTS).", "chr_id": "6", "chr_pos": "31356934", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.1583", "site_lbl": "Y33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs139817031", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139817031" }, { "id": "rs139817031", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139817031" }, { "id": "rs139817031", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139817031" }, { "id": "rs139817031", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139817031" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 350, "end_pos": 350, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SDS->NDS).", "chr_id": "6", "chr_pos": "31354523", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S350", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1232620504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1232620504" }, { "id": "rs1232620504", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1232620504" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 357, "end_pos": 357, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).", "chr_id": "6", "chr_pos": "31354503", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D357", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01889" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "common_name": "Human" } ], "gene": [ { "name": "HLA-B", "url": "https://www.uniprot.org/uniprot/P01889", "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2571447, "end_pos": 2659467, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000228964", "url": "https://www.ensembl.org/id/ENSG00000228964" } ] } } ], "crossref": [ { "id": "ENSG00000234745", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234745", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01889", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01889", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd21026", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21026", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "HLA-B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HLA-B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3106", "url": "https://www.ncbi.nlm.nih.gov/gene/3106", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1348", "url": "https://glyconnect.expasy.org/browser/proteins/1348", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4932", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4932", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01889", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01889*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001039", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001039", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010579", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010579", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011161", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011161", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3106", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3106", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "106300", "url": "http://www.omim.org/entry/106300", "database": "MIM", "categories": [ "Other" ] }, { "id": "608579", "url": "http://www.omim.org/entry/608579", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01889", "url": "https://www.nextprot.org/entry/NX_P01889", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01889", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01889", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RSHRYLE", "url": "https://omabrowser.org/oma/group/RSHRYLE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3840485at2759", "url": "http://www.orthodb.org/?query=3840485at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16675", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16675", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16675:SF251", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16675:SF251", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16675:SF270", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16675:SF270", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1A1M", "url": "https://www.rcsb.org/structure/1A1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A1N", "url": "https://www.rcsb.org/structure/1A1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A1O", "url": "https://www.rcsb.org/structure/1A1O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A9B", "url": "https://www.rcsb.org/structure/1A9B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1A9E", "url": "https://www.rcsb.org/structure/1A9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AGB", "url": "https://www.rcsb.org/structure/1AGB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AGC", "url": "https://www.rcsb.org/structure/1AGC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AGD", "url": "https://www.rcsb.org/structure/1AGD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AGE", "url": "https://www.rcsb.org/structure/1AGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1AGF", "url": "https://www.rcsb.org/structure/1AGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CG9", "url": "https://www.rcsb.org/structure/1CG9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1E27", "url": "https://www.rcsb.org/structure/1E27", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1E28", "url": "https://www.rcsb.org/structure/1E28", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HSA", "url": "https://www.rcsb.org/structure/1HSA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JGD", "url": "https://www.rcsb.org/structure/1JGD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JGE", "url": "https://www.rcsb.org/structure/1JGE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1K5N", "url": "https://www.rcsb.org/structure/1K5N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1M05", "url": "https://www.rcsb.org/structure/1M05", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1M6O", "url": "https://www.rcsb.org/structure/1M6O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MI5", "url": "https://www.rcsb.org/structure/1MI5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1N2R", "url": "https://www.rcsb.org/structure/1N2R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OF2", "url": "https://www.rcsb.org/structure/1OF2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1OGT", "url": "https://www.rcsb.org/structure/1OGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SYS", "url": "https://www.rcsb.org/structure/1SYS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SYV", "url": "https://www.rcsb.org/structure/1SYV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UXS", "url": "https://www.rcsb.org/structure/1UXS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UXW", "url": "https://www.rcsb.org/structure/1UXW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W0V", "url": "https://www.rcsb.org/structure/1W0V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1W0W", "url": "https://www.rcsb.org/structure/1W0W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XH3", "url": "https://www.rcsb.org/structure/1XH3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XR8", "url": "https://www.rcsb.org/structure/1XR8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1XR9", "url": "https://www.rcsb.org/structure/1XR9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZHK", "url": "https://www.rcsb.org/structure/1ZHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZHL", "url": "https://www.rcsb.org/structure/1ZHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZSD", "url": "https://www.rcsb.org/structure/1ZSD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A83", "url": "https://www.rcsb.org/structure/2A83", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AK4", "url": "https://www.rcsb.org/structure/2AK4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AXF", "url": "https://www.rcsb.org/structure/2AXF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2AXG", "url": "https://www.rcsb.org/structure/2AXG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BSR", "url": "https://www.rcsb.org/structure/2BSR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BSS", "url": "https://www.rcsb.org/structure/2BSS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BST", "url": "https://www.rcsb.org/structure/2BST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BVO", "url": "https://www.rcsb.org/structure/2BVO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BVP", "url": "https://www.rcsb.org/structure/2BVP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2BVQ", "url": "https://www.rcsb.org/structure/2BVQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2H6P", "url": "https://www.rcsb.org/structure/2H6P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HJL", "url": "https://www.rcsb.org/structure/2HJL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NW3", "url": "https://www.rcsb.org/structure/2NW3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NX5", "url": "https://www.rcsb.org/structure/2NX5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RFX", "url": "https://www.rcsb.org/structure/2RFX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YPK", "url": "https://www.rcsb.org/structure/2YPK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YPL", "url": "https://www.rcsb.org/structure/2YPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B3I", "url": "https://www.rcsb.org/structure/3B3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B6S", "url": "https://www.rcsb.org/structure/3B6S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BP4", "url": "https://www.rcsb.org/structure/3BP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BP7", "url": "https://www.rcsb.org/structure/3BP7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BW9", "url": "https://www.rcsb.org/structure/3BW9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BWA", "url": "https://www.rcsb.org/structure/3BWA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3C9N", "url": "https://www.rcsb.org/structure/3C9N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CZF", "url": "https://www.rcsb.org/structure/3CZF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D18", "url": "https://www.rcsb.org/structure/3D18", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DTX", "url": "https://www.rcsb.org/structure/3DTX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DX6", "url": "https://www.rcsb.org/structure/3DX6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DX7", "url": "https://www.rcsb.org/structure/3DX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DX8", "url": "https://www.rcsb.org/structure/3DX8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DXA", "url": "https://www.rcsb.org/structure/3DXA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FFC", "url": "https://www.rcsb.org/structure/3FFC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HCV", "url": "https://www.rcsb.org/structure/3HCV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPL", "url": "https://www.rcsb.org/structure/3KPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPM", "url": "https://www.rcsb.org/structure/3KPM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPN", "url": "https://www.rcsb.org/structure/3KPN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPO", "url": "https://www.rcsb.org/structure/3KPO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPP", "url": "https://www.rcsb.org/structure/3KPP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPQ", "url": "https://www.rcsb.org/structure/3KPQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPR", "url": "https://www.rcsb.org/structure/3KPR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KPS", "url": "https://www.rcsb.org/structure/3KPS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KWW", "url": "https://www.rcsb.org/structure/3KWW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KXF", "url": "https://www.rcsb.org/structure/3KXF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L3D", "url": "https://www.rcsb.org/structure/3L3D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L3G", "url": "https://www.rcsb.org/structure/3L3G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L3I", "url": "https://www.rcsb.org/structure/3L3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L3J", "url": "https://www.rcsb.org/structure/3L3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L3K", "url": "https://www.rcsb.org/structure/3L3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKN", "url": "https://www.rcsb.org/structure/3LKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKO", "url": "https://www.rcsb.org/structure/3LKO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKP", "url": "https://www.rcsb.org/structure/3LKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKQ", "url": "https://www.rcsb.org/structure/3LKQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKR", "url": "https://www.rcsb.org/structure/3LKR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LKS", "url": "https://www.rcsb.org/structure/3LKS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LN4", "url": "https://www.rcsb.org/structure/3LN4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LN5", "url": "https://www.rcsb.org/structure/3LN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LV3", "url": "https://www.rcsb.org/structure/3LV3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MV7", "url": "https://www.rcsb.org/structure/3MV7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MV8", "url": "https://www.rcsb.org/structure/3MV8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MV9", "url": "https://www.rcsb.org/structure/3MV9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SJV", "url": "https://www.rcsb.org/structure/3SJV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SKM", "url": "https://www.rcsb.org/structure/3SKM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SKO", "url": "https://www.rcsb.org/structure/3SKO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SPV", "url": "https://www.rcsb.org/structure/3SPV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UPR", "url": "https://www.rcsb.org/structure/3UPR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VCL", "url": "https://www.rcsb.org/structure/3VCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VFS", "url": "https://www.rcsb.org/structure/3VFS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VFT", "url": "https://www.rcsb.org/structure/3VFT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VFU", "url": "https://www.rcsb.org/structure/3VFU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VFV", "url": "https://www.rcsb.org/structure/3VFV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VFW", "url": "https://www.rcsb.org/structure/3VFW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VH8", "url": "https://www.rcsb.org/structure/3VH8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VRI", "url": "https://www.rcsb.org/structure/3VRI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VRJ", "url": "https://www.rcsb.org/structure/3VRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3W39", "url": "https://www.rcsb.org/structure/3W39", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WUW", "url": "https://www.rcsb.org/structure/3WUW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X11", "url": "https://www.rcsb.org/structure/3X11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X12", "url": "https://www.rcsb.org/structure/3X12", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X13", "url": "https://www.rcsb.org/structure/3X13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3X14", "url": "https://www.rcsb.org/structure/3X14", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G8G", "url": "https://www.rcsb.org/structure/4G8G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G8I", "url": "https://www.rcsb.org/structure/4G8I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G9D", "url": "https://www.rcsb.org/structure/4G9D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G9F", "url": "https://www.rcsb.org/structure/4G9F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JQV", "url": "https://www.rcsb.org/structure/4JQV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JQX", "url": "https://www.rcsb.org/structure/4JQX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LCY", "url": "https://www.rcsb.org/structure/4LCY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LNR", "url": "https://www.rcsb.org/structure/4LNR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4MJI", "url": "https://www.rcsb.org/structure/4MJI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O2C", "url": "https://www.rcsb.org/structure/4O2C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O2E", "url": "https://www.rcsb.org/structure/4O2E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O2F", "url": "https://www.rcsb.org/structure/4O2F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PR5", "url": "https://www.rcsb.org/structure/4PR5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PRN", "url": "https://www.rcsb.org/structure/4PRN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRP", "url": "https://www.rcsb.org/structure/4QRP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRQ", "url": "https://www.rcsb.org/structure/4QRQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRR", "url": "https://www.rcsb.org/structure/4QRR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRS", "url": "https://www.rcsb.org/structure/4QRS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRT", "url": "https://www.rcsb.org/structure/4QRT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QRU", "url": "https://www.rcsb.org/structure/4QRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1H", "url": "https://www.rcsb.org/structure/4U1H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1I", "url": "https://www.rcsb.org/structure/4U1I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1J", "url": "https://www.rcsb.org/structure/4U1J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1K", "url": "https://www.rcsb.org/structure/4U1K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1L", "url": "https://www.rcsb.org/structure/4U1L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1M", "url": "https://www.rcsb.org/structure/4U1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1N", "url": "https://www.rcsb.org/structure/4U1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U1S", "url": "https://www.rcsb.org/structure/4U1S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XXC", "url": "https://www.rcsb.org/structure/4XXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B38", "url": "https://www.rcsb.org/structure/5B38", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B39", "url": "https://www.rcsb.org/structure/5B39", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DEF", "url": "https://www.rcsb.org/structure/5DEF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DEG", "url": "https://www.rcsb.org/structure/5DEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EO0", "url": "https://www.rcsb.org/structure/5EO0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EO1", "url": "https://www.rcsb.org/structure/5EO1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IB1", "url": "https://www.rcsb.org/structure/5IB1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IB2", "url": "https://www.rcsb.org/structure/5IB2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IB3", "url": "https://www.rcsb.org/structure/5IB3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IB4", "url": "https://www.rcsb.org/structure/5IB4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IB5", "url": "https://www.rcsb.org/structure/5IB5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IEH", "url": "https://www.rcsb.org/structure/5IEH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IEK", "url": "https://www.rcsb.org/structure/5IEK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IM7", "url": "https://www.rcsb.org/structure/5IM7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5INC", "url": "https://www.rcsb.org/structure/5INC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IND", "url": "https://www.rcsb.org/structure/5IND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T6W", "url": "https://www.rcsb.org/structure/5T6W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T6X", "url": "https://www.rcsb.org/structure/5T6X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T6Y", "url": "https://www.rcsb.org/structure/5T6Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T6Z", "url": "https://www.rcsb.org/structure/5T6Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T70", "url": "https://www.rcsb.org/structure/5T70", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5TXS", "url": "https://www.rcsb.org/structure/5TXS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5U98", "url": "https://www.rcsb.org/structure/5U98", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V5L", "url": "https://www.rcsb.org/structure/5V5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V5M", "url": "https://www.rcsb.org/structure/5V5M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VUD", "url": "https://www.rcsb.org/structure/5VUD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VUE", "url": "https://www.rcsb.org/structure/5VUE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VUF", "url": "https://www.rcsb.org/structure/5VUF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWD", "url": "https://www.rcsb.org/structure/5VWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWF", "url": "https://www.rcsb.org/structure/5VWF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWH", "url": "https://www.rcsb.org/structure/5VWH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWJ", "url": "https://www.rcsb.org/structure/5VWJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VZ5", "url": "https://www.rcsb.org/structure/5VZ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WMN", "url": "https://www.rcsb.org/structure/5WMN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WMO", "url": "https://www.rcsb.org/structure/5WMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WMP", "url": "https://www.rcsb.org/structure/5WMP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WMQ", "url": "https://www.rcsb.org/structure/5WMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WMR", "url": "https://www.rcsb.org/structure/5WMR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XOS", "url": "https://www.rcsb.org/structure/5XOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XOT", "url": "https://www.rcsb.org/structure/5XOT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AT5", "url": "https://www.rcsb.org/structure/6AT5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVF", "url": "https://www.rcsb.org/structure/6AVF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6AVG", "url": "https://www.rcsb.org/structure/6AVG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BJ2", "url": "https://www.rcsb.org/structure/6BJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BJ3", "url": "https://www.rcsb.org/structure/6BJ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BJ8", "url": "https://www.rcsb.org/structure/6BJ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXP", "url": "https://www.rcsb.org/structure/6BXP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BXQ", "url": "https://www.rcsb.org/structure/6BXQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D29", "url": "https://www.rcsb.org/structure/6D29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D2B", "url": "https://www.rcsb.org/structure/6D2B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D2R", "url": "https://www.rcsb.org/structure/6D2R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6D2T", "url": "https://www.rcsb.org/structure/6D2T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MT3", "url": "https://www.rcsb.org/structure/6MT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MT4", "url": "https://www.rcsb.org/structure/6MT4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MT5", "url": "https://www.rcsb.org/structure/6MT5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MT6", "url": "https://www.rcsb.org/structure/6MT6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MTL", "url": "https://www.rcsb.org/structure/6MTL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MTM", "url": "https://www.rcsb.org/structure/6MTM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P23", "url": "https://www.rcsb.org/structure/6P23", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P27", "url": "https://www.rcsb.org/structure/6P27", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P2C", "url": "https://www.rcsb.org/structure/6P2C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P2F", "url": "https://www.rcsb.org/structure/6P2F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6P2S", "url": "https://www.rcsb.org/structure/6P2S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYJ", "url": "https://www.rcsb.org/structure/6PYJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYL", "url": "https://www.rcsb.org/structure/6PYL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYV", "url": "https://www.rcsb.org/structure/6PYV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PYW", "url": "https://www.rcsb.org/structure/6PYW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PZ5", "url": "https://www.rcsb.org/structure/6PZ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJ7", "url": "https://www.rcsb.org/structure/6UJ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJ8", "url": "https://www.rcsb.org/structure/6UJ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UJ9", "url": "https://www.rcsb.org/structure/6UJ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UZP", "url": "https://www.rcsb.org/structure/6UZP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UZQ", "url": "https://www.rcsb.org/structure/6UZQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UZS", "url": "https://www.rcsb.org/structure/6UZS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VMX", "url": "https://www.rcsb.org/structure/6VMX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LFZ", "url": "https://www.rcsb.org/structure/7LFZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LG0", "url": "https://www.rcsb.org/structure/7LG0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LGD", "url": "https://www.rcsb.org/structure/7LGD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LGT", "url": "https://www.rcsb.org/structure/7LGT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RZD", "url": "https://www.rcsb.org/structure/7RZD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7RZJ", "url": "https://www.rcsb.org/structure/7RZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S79", "url": "https://www.rcsb.org/structure/7S79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S7D", "url": "https://www.rcsb.org/structure/7S7D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S7E", "url": "https://www.rcsb.org/structure/7S7E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S7F", "url": "https://www.rcsb.org/structure/7S7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S8A", "url": "https://www.rcsb.org/structure/7S8A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S8E", "url": "https://www.rcsb.org/structure/7S8E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7S8F", "url": "https://www.rcsb.org/structure/7S8F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TUC", "url": "https://www.rcsb.org/structure/7TUC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TUD", "url": "https://www.rcsb.org/structure/7TUD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TUE", "url": "https://www.rcsb.org/structure/7TUE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XF3", "url": "https://www.rcsb.org/structure/7XF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00129", "url": "http://pfam.xfam.org/family/PF00129", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06623", "url": "http://pfam.xfam.org/family/PF06623", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07654", "url": "http://pfam.xfam.org/family/PF07654", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01889", "url": "https://pharos.nih.gov/targets/P01889", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052473", "url": "https://proconsortium.org/app/entry/PR:000052473", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01889", "url": "http://purl.obolibrary.org/obo/PR_P01889", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01889", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A140T951", "url": "https://www.uniprot.org/uniprot/A0A140T951", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T951-1", "url": "https://www.uniprot.org/uniprot/A0A140T951-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T953", "url": "https://www.uniprot.org/uniprot/A0A140T953", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T953-1", "url": "https://www.uniprot.org/uniprot/A0A140T953-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T997", "url": "https://www.uniprot.org/uniprot/A0A140T997", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T997-1", "url": "https://www.uniprot.org/uniprot/A0A140T997-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9A9", "url": "https://www.uniprot.org/uniprot/A0A140T9A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9A9-1", "url": "https://www.uniprot.org/uniprot/A0A140T9A9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9D4", "url": "https://www.uniprot.org/uniprot/A0A140T9D4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9D4-1", "url": "https://www.uniprot.org/uniprot/A0A140T9D4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9G0", "url": "https://www.uniprot.org/uniprot/A0A140T9G0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9G0-1", "url": "https://www.uniprot.org/uniprot/A0A140T9G0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9H3", "url": "https://www.uniprot.org/uniprot/A0A140T9H3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9H3-1", "url": "https://www.uniprot.org/uniprot/A0A140T9H3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9S9", "url": "https://www.uniprot.org/uniprot/A0A140T9S9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9S9-1", "url": "https://www.uniprot.org/uniprot/A0A140T9S9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9Y5", "url": "https://www.uniprot.org/uniprot/A0A140T9Y5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T9Y5-1", "url": "https://www.uniprot.org/uniprot/A0A140T9Y5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA02", "url": "https://www.uniprot.org/uniprot/A0A140TA02", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA02-1", "url": "https://www.uniprot.org/uniprot/A0A140TA02-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA11", "url": "https://www.uniprot.org/uniprot/A0A140TA11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA11-1", "url": "https://www.uniprot.org/uniprot/A0A140TA11-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA13", "url": "https://www.uniprot.org/uniprot/A0A140TA13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA13-1", "url": "https://www.uniprot.org/uniprot/A0A140TA13-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA14", "url": "https://www.uniprot.org/uniprot/A0A140TA14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA14-1", "url": "https://www.uniprot.org/uniprot/A0A140TA14-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA21", "url": "https://www.uniprot.org/uniprot/A0A140TA21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140TA21-1", "url": "https://www.uniprot.org/uniprot/A0A140TA21-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PNR7", "url": "https://www.uniprot.org/uniprot/A0A1W2PNR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PNR7-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PNR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP29", "url": "https://www.uniprot.org/uniprot/A0A1W2PP29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP29-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PP29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP67", "url": "https://www.uniprot.org/uniprot/A0A1W2PP67", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP67-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PP67-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQE2", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQE2-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQZ3", "url": "https://www.uniprot.org/uniprot/A0A1W2PQZ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQZ3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQZ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIV3", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8Q3SIV3-1", "url": "https://www.uniprot.org/uniprot/A0A8Q3SIV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D5H3J5-1", "url": "https://www.uniprot.org/uniprot/D5H3J5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D9J307", "url": "https://www.uniprot.org/uniprot/D9J307", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D9J307-1", "url": "https://www.uniprot.org/uniprot/D9J307-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01889-1", "url": "https://www.uniprot.org/uniprot/P01889-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q2L6G2", "url": "https://www.uniprot.org/uniprot/Q2L6G2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q2L6G2-1", "url": "https://www.uniprot.org/uniprot/Q2L6G2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SS57", "url": "https://www.uniprot.org/uniprot/Q5SS57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SS57-1", "url": "https://www.uniprot.org/uniprot/Q5SS57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S6AU73", "url": "https://www.uniprot.org/uniprot/S6AU73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S6AU73-1", "url": "https://www.uniprot.org/uniprot/S6AU73-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA", "length": 362, "header": "sp|P01889-1|HLAB_HUMAN Isoform 1 of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3 CANONICAL=P01889-1" }, "isoforms": [ { "isoform_ac": "A0A140T951-1", "url": "", "sequence": { "sequence": "XPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGHFLPTGGKGGSYSQAACSDSAQGSDVSLTA", "length": 241, "header": "tr|A0A140T951-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_COX_CTG1", "start_pos": 2836761, "end_pos": 2834845, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000416726.5", "url": "https://www.ensembl.org/id/ENST00000416726.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000392099.1", "url": "https://www.ensembl.org/id/ENSP00000392099.1" } ] } }, { "isoform_ac": "A0A140T953-1", "url": "", "sequence": { "sequence": "MASVGRSEGTAGGGAGPGEPRREEGRAGLSPSSPPGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPA", "length": 246, "header": "tr|A0A140T953-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 2699047, "end_pos": 2697490, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437866.1", "url": "https://www.ensembl.org/id/ENST00000437866.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000392235.1", "url": "https://www.ensembl.org/id/ENSP00000392235.1" } ] } }, { "isoform_ac": "A0A140T997-1", "url": "", "sequence": { "sequence": "MASVGRREGTAGGGAGPGEPRREEGRAGLSPSSPPGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPA", "length": 246, "header": "tr|A0A140T997-1|A0A140T997_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2659300, "end_pos": 2657745, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000445610.1", "url": "https://www.ensembl.org/id/ENST00000445610.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000396397.1", "url": "https://www.ensembl.org/id/ENSP00000396397.1" } ] } }, { "isoform_ac": "A0A140T9A9-1", "url": "", "sequence": { "sequence": "XPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGHFLPTGGKGGSYSQAACSDSAQGSDVSLTA", "length": 241, "header": "tr|A0A140T9A9-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2658642, "end_pos": 2656723, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437265.5", "url": "https://www.ensembl.org/id/ENST00000437265.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000398100.1", "url": "https://www.ensembl.org/id/ENSP00000398100.1" } ] } }, { "isoform_ac": "A0A140T9D4-1", "url": "", "sequence": { "sequence": "MASAGRSEGTAGGGAGPEEPRREEGRAGLSPSSPPGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPA", "length": 246, "header": "tr|A0A140T9D4-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_COX_CTG1", "start_pos": 2837422, "end_pos": 2835867, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000445222.1", "url": "https://www.ensembl.org/id/ENST00000445222.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000399675.1", "url": "https://www.ensembl.org/id/ENSP00000399675.1" } ] } }, { "isoform_ac": "A0A140T9G0-1", "url": "", "sequence": { "sequence": "XPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGHFLPTGGKGGSYSQAASSDSAQGSDVSLTA", "length": 241, "header": "tr|A0A140T9G0-1|A0A140T9G0_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 2698387, "end_pos": 2696457, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000425798.5", "url": "https://www.ensembl.org/id/ENST00000425798.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000401443.1", "url": "https://www.ensembl.org/id/ENSP00000401443.1" } ] } }, { "isoform_ac": "A0A140T9H3-1", "url": "", "sequence": { "sequence": "XPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGHFLPTGGKGGSYSQAACSDSAQGSDVSLTA", "length": 241, "header": "tr|A0A140T9H3-1|A0A140T9H3_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2665016, "end_pos": 2663097, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436729.5", "url": "https://www.ensembl.org/id/ENST00000436729.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000403471.1", "url": "https://www.ensembl.org/id/ENSP00000403471.1" } ] } }, { "isoform_ac": "A0A140T9S9-1", "url": "", "sequence": { "sequence": "XPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGHFLPTGGKGGSYSQAASSDSAQGSDVSLTA", "length": 241, "header": "tr|A0A140T9S9-1|A0A140T9S9_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_QBL_CTG1", "start_pos": 2612099, "end_pos": 2610172, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000418147.5", "url": "https://www.ensembl.org/id/ENST00000418147.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000411954.1", "url": "https://www.ensembl.org/id/ENSP00000411954.1" } ] } }, { "isoform_ac": "A0A140T9Y5-1", "url": "", "sequence": { "sequence": "MASVGRREGTAGGGAGPGEPRREEGRAGLSPSSPPGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPA", "length": 246, "header": "tr|A0A140T9Y5-1|A0A140T9Y5_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2665674, "end_pos": 2664119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430299.1", "url": "https://www.ensembl.org/id/ENST00000430299.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000416672.1", "url": "https://www.ensembl.org/id/ENSP00000416672.1" } ] } }, { "isoform_ac": "A0A140TA02-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A140TA02-1|A0A140TA02_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_QBL_CTG1", "start_pos": 2612855, "end_pos": 2611449, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000479203.1", "url": "https://www.ensembl.org/id/ENST00000479203.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000433363.1", "url": "https://www.ensembl.org/id/ENSP00000433363.1" } ] } }, { "isoform_ac": "A0A140TA11-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A140TA11-1|A0A140TA11_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2659396, "end_pos": 2657992, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000498484.5", "url": "https://www.ensembl.org/id/ENST00000498484.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435083.1", "url": "https://www.ensembl.org/id/ENSP00000435083.1" } ] } }, { "isoform_ac": "A0A140TA13-1", "url": "", "sequence": { "sequence": "MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A140TA13-1|A0A140TA13_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 2699143, "end_pos": 2697737, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000471639.5", "url": "https://www.ensembl.org/id/ENST00000471639.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435221.1", "url": "https://www.ensembl.org/id/ENSP00000435221.1" } ] } }, { "isoform_ac": "A0A140TA14-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A140TA14-1|A0A140TA14_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2665770, "end_pos": 2664366, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000481283.5", "url": "https://www.ensembl.org/id/ENST00000481283.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435817.1", "url": "https://www.ensembl.org/id/ENSP00000435817.1" } ] } }, { "isoform_ac": "A0A140TA21-1", "url": "", "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A140TA21-1|A0A140TA21_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_COX_CTG1", "start_pos": 2837517, "end_pos": 2836112, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000461583.5", "url": "https://www.ensembl.org/id/ENST00000461583.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436637.1", "url": "https://www.ensembl.org/id/ENSP00000436637.1" } ] } }, { "isoform_ac": "A0A1W2PNR7-1", "url": "", "sequence": { "sequence": "TAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRAEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGRKGGSYSQAA", "length": 253, "header": "tr|A0A1W2PNR7-1|A0A1W2PNR7_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_QBL_CTG1", "start_pos": 2612846, "end_pos": 2610321, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640475.1", "url": "https://www.ensembl.org/id/ENST00000640475.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491044.1", "url": "https://www.ensembl.org/id/ENSP00000491044.1" } ] } }, { "isoform_ac": "A0A1W2PP29-1", "url": "", "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWGGKGGSYSQAACSDSAQGSDVSLTA", "length": 323, "header": "tr|A0A1W2PP29-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=2 CANONICAL=P01889-1" }, "locus": { "chromosome": "6", "start_pos": 31357158, "end_pos": 31354486, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640094.2", "url": "https://www.ensembl.org/id/ENST00000640094.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000491275.2", "url": "https://www.ensembl.org/id/ENSP00000491275.2" } ] } }, { "isoform_ac": "A0A1W2PP67-1", "url": "", "sequence": { "sequence": "AVVVPSGEEQRYTCHVQHEGLPKPLTLRWGGKGGSYSQAACSDSAQGSD", "length": 49, "header": "tr|A0A1W2PP67-1|A0A1W2PP67_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=4 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2664016, "end_pos": 2663113, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640538.1", "url": "https://www.ensembl.org/id/ENST00000640538.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491837.1", "url": "https://www.ensembl.org/id/ENSP00000491837.1" } ] } }, { "isoform_ac": "A0A1W2PQE2-1", "url": "", "sequence": { "sequence": "AVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSCSQAAC", "length": 80, "header": "tr|A0A1W2PQE2-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2664016, "end_pos": 2578541, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639633.1", "url": "https://www.ensembl.org/id/ENST00000639633.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492667.1", "url": "https://www.ensembl.org/id/ENSP00000492667.1" } ] } }, { "isoform_ac": "A0A1W2PQZ3-1", "url": "", "sequence": { "sequence": "AVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSCSQAAC", "length": 80, "header": "tr|A0A1W2PQZ3-1|A0A1W2PQZ3_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 2697387, "end_pos": 2612219, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639001.1", "url": "https://www.ensembl.org/id/ENST00000639001.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491976.1", "url": "https://www.ensembl.org/id/ENSP00000491976.1" } ] } }, { "isoform_ac": "A0A8Q3SIV3-1", "url": "", "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADQEQKSLFPAQRLELSNE", "length": 224, "header": "tr|A0A8Q3SIV3-1|A0A8Q3SIV3_HUMAN Computationally mapped isoform of Major histocompatibility complex, class I, B OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "6", "start_pos": 31357158, "end_pos": 31355754, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696558.1", "url": "https://www.ensembl.org/id/ENST00000696558.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512716.1", "url": "https://www.ensembl.org/id/ENSP00000512716.1" } ] } }, { "isoform_ac": "D5H3J5-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA", "length": 362, "header": "tr|D5H3J5-1|D5H3J5_HUMAN Computationally mapped isoform of MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 2659396, "end_pos": 2656724, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000421349.6", "url": "https://www.ensembl.org/id/ENST00000421349.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405365.2", "url": "https://www.ensembl.org/id/ENSP00000405365.2" } ] } }, { "isoform_ac": "D9J307-1", "url": "", "sequence": { "sequence": "MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA", "length": 362, "header": "tr|D9J307-1|D9J307_HUMAN Computationally mapped isoform of MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 2699143, "end_pos": 2696458, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000450871.6", "url": "https://www.ensembl.org/id/ENST00000450871.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000388208.2", "url": "https://www.ensembl.org/id/ENSP00000388208.2" } ] } }, { "isoform_ac": "P01889-1", "url": "", "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA", "length": 362, "header": "sp|P01889-1|HLAB_HUMAN Isoform 1 of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3 CANONICAL=P01889-1" }, "locus": { "chromosome": "6", "start_pos": 31357158, "end_pos": 31354486, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000696559.1", "url": "https://www.ensembl.org/id/ENST00000696559.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000512717.1", "url": "https://www.ensembl.org/id/ENSP00000512717.1" } ] } }, { "isoform_ac": "Q2L6G2-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA", "length": 362, "header": "tr|Q2L6G2-1|Q2L6G2_HUMAN Computationally mapped isoform of Major histocompatibility complex, class I, B OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 2665770, "end_pos": 2663098, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435618.6", "url": "https://www.ensembl.org/id/ENST00000435618.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000405178.2", "url": "https://www.ensembl.org/id/ENSP00000405178.2" } ] } }, { "isoform_ac": "Q5SS57-1", "url": "", "sequence": { "sequence": "MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA", "length": 362, "header": "tr|Q5SS57-1|HLAB_HUMAN Computationally mapped isoform of HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_COX_CTG1", "start_pos": 2837517, "end_pos": 2834846, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000425848.6", "url": "https://www.ensembl.org/id/ENST00000425848.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000400842.2", "url": "https://www.ensembl.org/id/ENSP00000400842.2" } ] } }, { "isoform_ac": "S6AU73-1", "url": "", "sequence": { "sequence": "MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA", "length": 362, "header": "tr|S6AU73-1|S6AU73_HUMAN Computationally mapped isoform of MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=1 CANONICAL=P01889-1" }, "locus": { "chromosome": "HSCHR6_MHC_QBL_CTG1", "start_pos": 2612855, "end_pos": 2610173, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359635.9", "url": "https://www.ensembl.org/id/ENST00000359635.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000352656.5", "url": "https://www.ensembl.org/id/ENSP00000352656.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "1348", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1348" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01889#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 158, "start_aa": "Thr", "end_pos": 158, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr158", "evidence": [ { "id": "P01889", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P01889", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01889" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [ { "start_pos": 123, "end_pos": 123, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "34433824", "url": "" } ], "site_lbl": "Tyr123" }, { "start_pos": 227, "end_pos": 227, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Cys", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "34433824", "url": "" } ], "site_lbl": "Cys227" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "6304688", "url": "https://glygen.org/publication/PubMed/6304688" } ], "site_lbl": "Tyr344" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01889", "url": "http://phospho.elm.eu.org/byAccession/P01889.html" }, { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "1956339", "url": "https://glygen.org/publication/PubMed/1956339" } ], "site_lbl": "Tyr344" }, { "start_pos": 350, "end_pos": 350, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P01889", "url": "http://phospho.elm.eu.org/byAccession/P01889.html" }, { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "6430898", "url": "https://glygen.org/publication/PubMed/6430898" } ], "site_lbl": "Ser350" }, { "start_pos": 359, "end_pos": 359, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "6430898", "url": "https://glygen.org/publication/PubMed/6430898" } ], "site_lbl": "Ser359" }, { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Thr361" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "NKp44, a triggering receptor involved in tumor cell lysis by activated human natural killer cells, is a novel member of the immunoglobulin superfamily.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Cantoni C, Bottino C, Vitale M, Pessino A, Augugliaro R, Malaspina A, Parolini S, Moretta L, Moretta A, Biassoni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "10049942", "url": "https://glygen.org/publication/PubMed/10049942" } ] }, { "title": "Cell surface expression of HLA-E: interaction with human beta2-microglobulin and allelic differences.", "journal": "European journal of immunology", "date": "1999", "authors": "Ulbrecht M, Couturier A, Martinozzi S, Pla M, Srivastava R, Peterson PA, Weiss EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "10064069", "url": "https://glygen.org/publication/PubMed/10064069" } ] }, { "title": "Inhibition of transforming growth factor-beta/SMAD signalling by the interferon-gamma/STAT pathway.", "journal": "Nature", "date": "1999", "authors": "Ulloa L, Doody J, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10067896", "url": "https://glygen.org/publication/PubMed/10067896" } ] }, { "title": "Diversity of HLA-B17 alleles and haplotypes in East Asians and a novel Cw6 allele (Cw*0604) associated with B*5701.", "journal": "Tissue antigens", "date": "1999", "authors": "Inoue T, Ogawa A, Tokunaga K, Ishikawa Y, Kashiwase K, Tanaka H, Park MH, Jia GJ, Chimge NO, Sideltseva EW, Akaza T, Tadokoro K, Takahashi T, Juji T", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "10395103", "url": "https://glygen.org/publication/PubMed/10395103" } ] }, { "title": "Determination of residues involved in ligand binding and signal transmission in the human IFN-alpha receptor 2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Chuntharapai A, Gibbs V, Lu J, Ow A, Marsters S, Ashkenazi A, De Vos A, Jin Kim K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10395669", "url": "https://glygen.org/publication/PubMed/10395669" } ] }, { "title": "Myeloid DAP12-associating lectin (MDL)-1 is a cell surface receptor involved in the activation of myeloid cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Bakker AB, Baker E, Sutherland GR, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "10449773", "url": "https://glygen.org/publication/PubMed/10449773" } ] }, { "title": "Recycling MHC class I molecules and endosomal peptide loading.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Gromme M, Uytdehaag FG, Janssen H, Calafat J, van Binnendijk RS, Kenter MJ, Tulp A, Verwoerd D, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "10468607", "url": "https://glygen.org/publication/PubMed/10468607" } ] }, { "title": "Identification and molecular cloning of p75/AIRM1, a novel member of the sialoadhesin family that functions as an inhibitory receptor in human natural killer cells.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Falco M, Biassoni R, Bottino C, Vitale M, Sivori S, Augugliaro R, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10499918", "url": "https://glygen.org/publication/PubMed/10499918" } ] }, { "title": "Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rani MR, Leaman DW, Han Y, Leung S, Croze E, Fish EN, Wolfman A, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10542297", "url": "https://glygen.org/publication/PubMed/10542297" } ] }, { "title": "Kinetic analysis of peptide binding to the TAP transport complex: evidence for structural rearrangements induced by substrate binding.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Neumann L, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "10600378", "url": "https://glygen.org/publication/PubMed/10600378" } ] }, { "title": "Cutting edge: signal-regulatory protein beta 1 is a DAP12-associated activating receptor expressed in myeloid cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Dietrich J, Cella M, Seiffert M, Buhring HJ, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "10604985", "url": "https://glygen.org/publication/PubMed/10604985" } ] }, { "title": "The CMRF-35H gene structure predicts for an independently expressed member of an ITIM/ITAM pair of molecules localized to human chromosome 17.", "journal": "Tissue antigens", "date": "2000", "authors": "Clark GJ, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10746781", "url": "https://glygen.org/publication/PubMed/10746781" } ] }, { "title": "Functional relationship between calreticulin, calnexin, and the endoplasmic reticulum luminal domain of calnexin.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Danilczyk UG, Cohen-Doyle MF, Williams DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "10777614", "url": "https://glygen.org/publication/PubMed/10777614" } ] }, { "title": "COPI-coated ER-to-Golgi transport complexes segregate from COPII in close proximity to ER exit sites.", "journal": "Journal of cell science", "date": "2000", "authors": "Stephens DJ, Lin-Marq N, Pagano A, Pepperkok R, Paccaud JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "10825291", "url": "https://glygen.org/publication/PubMed/10825291" } ] }, { "title": "Association of signal-regulatory proteins beta with KARAP/DAP-12.", "journal": "European journal of immunology", "date": "2000", "authors": "Tomasello E, Cant C, Buhring HJ, Vely F, Andre P, Seiffert M, Ullrich A, Vivier E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "10940905", "url": "https://glygen.org/publication/PubMed/10940905" } ] }, { "title": "Dynamics of transitional endoplasmic reticulum sites in vertebrate cells.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Hammond AT, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "10982397", "url": "https://glygen.org/publication/PubMed/10982397" } ] }, { "title": "Regulation of STAT1 nuclear export by Jak1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mowen K, David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "10982844", "url": "https://glygen.org/publication/PubMed/10982844" } ] }, { "title": "Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Thiel DJ, le Du MH, Walter RL, D'Arcy A, Chene C, Fountoulakis M, Garotta G, Winkler FK, Ealick SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10986460", "url": "https://glygen.org/publication/PubMed/10986460" } ] }, { "title": "Gene structure and function of the 2'-5'-oligoadenylate synthetase family.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2000", "authors": "Justesen J, Hartmann R, Kjeldgaard NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11092454", "url": "https://glygen.org/publication/PubMed/11092454" } ] }, { "title": "A role for calnexin in the assembly of the MHC class I loading complex in the endoplasmic reticulum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Diedrich G, Bangia N, Pan M, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "11160214", "url": "https://glygen.org/publication/PubMed/11160214" } ] }, { "title": "Selective export of MHC class I molecules from the ER after their dissociation from TAP.", "journal": "Immunity", "date": "2000", "authors": "Spiliotis ET, Manley H, Osorio M, Zuniga MC, Edidin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "11163199", "url": "https://glygen.org/publication/PubMed/11163199" } ] }, { "title": "Antigen loading of MHC class I molecules in the endocytic tract.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Kleijmeer MJ, Escola JM, UytdeHaag FG, Jakobson E, Griffith JM, Osterhaus AD, Stoorvogel W, Melief CJ, Rabouille C, Geuze HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "11247303", "url": "https://glygen.org/publication/PubMed/11247303" } ] }, { "title": "Identification of NKp80, a novel triggering molecule expressed by human NK cells.", "journal": "European journal of immunology", "date": "2001", "authors": "Vitale M, Falco M, Castriconi R, Parolini S, Zambello R, Semenzato G, Biassoni R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11265639", "url": "https://glygen.org/publication/PubMed/11265639" } ] }, { "title": "Inositol hexakisphosphate kinase 2 mediates growth suppressive and apoptotic effects of interferon-beta in ovarian carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Morrison BH, Bauer JA, Kalvakolanu DV, Lindner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11337497", "url": "https://glygen.org/publication/PubMed/11337497" } ] }, { "title": "Effect of early interferon treatment on conversion to definite multiple sclerosis: a randomised study.", "journal": "Lancet (London, England)", "date": "2001", "authors": "Comi G, Filippi M, Barkhof F, Durelli L, Edan G, Fernandez O, Hartung H, Seeldrayers P, Sorensen PS, Rovaris M, Martinelli V, Hommes OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11377645", "url": "https://glygen.org/publication/PubMed/11377645" } ] }, { "title": "Free major histocompatibility complex class I heavy chain is preferentially targeted for degradation by human T-cell leukemia/lymphotropic virus type 1 p12(I) protein.", "journal": "J. Virol.", "date": "2001", "authors": "Johnson J M, Nicot C, Fullen J, Ciminale V, Casareto L, Mulloy J C, Jacobson S, Franchini G", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "11390610", "url": "https://glygen.org/publication/PubMed/11390610" } ] }, { "title": "Functional classification of interferon-stimulated genes identified using microarrays.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "de Veer MJ, Holko M, Frevel M, Walker E, Der S, Paranjape JM, Silverman RH, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11404376", "url": "https://glygen.org/publication/PubMed/11404376" } ] }, { "title": "NTB-A [correction of GNTB-A], a novel SH2D1A-associated surface molecule contributing to the inability of natural killer cells to kill Epstein-Barr virus-infected B cells in X-linked lymphoproliferative disease.", "journal": "The Journal of experimental medicine", "date": "2001", "authors": "Bottino C, Falco M, Parolini S, Marcenaro E, Augugliaro R, Sivori S, Landi E, Biassoni R, Notarangelo LD, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11489943", "url": "https://glygen.org/publication/PubMed/11489943" } ] }, { "title": "Structural basis of MHC class I recognition by natural killer cell receptors.", "journal": "Immunological reviews", "date": "2001", "authors": "Sawicki MW, Dimasi N, Natarajan K, Wang J, Margulies DH, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11513152", "url": "https://glygen.org/publication/PubMed/11513152" } ] }, { "title": "Relationship between calnexin and BiP in suppressing aggregation and promoting refolding of protein and glycoprotein substrates.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Stronge VS, Saito Y, Ihara Y, Williams DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "11514579", "url": "https://glygen.org/publication/PubMed/11514579" } ] }, { "title": "The gene encoding the immunoregulatory signaling molecule CMRF-35A localized to human chromosome 17 in close proximity to other members of the CMRF-35 family.", "journal": "Tissue antigens", "date": "2001", "authors": "Clark GJ, Cooper B, Fitzpatrick S, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11556966", "url": "https://glygen.org/publication/PubMed/11556966" } ] }, { "title": "The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Le Roy F, Bisbal C, Silhol M, Martinand C, Lebleu B, Salehzada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "11585831", "url": "https://glygen.org/publication/PubMed/11585831" } ] }, { "title": "A DAP12-mediated pathway regulates expression of CC chemokine receptor 7 and maturation of human dendritic cells.", "journal": "The Journal of experimental medicine", "date": "2001", "authors": "Bouchon A, Hernandez-Munain C, Cella M, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "11602640", "url": "https://glygen.org/publication/PubMed/11602640" } ] }, { "title": "A reassessment of the MAdCAM-1 structure and its role in integrin recognition.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Dando J, Wilkinson KW, Ortlepp S, King DJ, Brady RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11807247", "url": "https://glygen.org/publication/PubMed/11807247" } ] }, { "title": "Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.", "journal": "Medicinal research reviews", "date": "2002", "authors": "Yusuf-Makagiansar H, Anderson ME, Yakovleva TV, Murray JS, Siahaan TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11857637", "url": "https://glygen.org/publication/PubMed/11857637" } ] }, { "title": "Structure and function of major histocompatibility complex (MHC) class I specific receptors expressed on human natural killer (NK) cells.", "journal": "Molecular immunology", "date": "2002", "authors": "Borrego F, Kabat J, Kim DK, Lieto L, Maasho K, Pena J, Solana R, Coligan JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11858820", "url": "https://glygen.org/publication/PubMed/11858820" } ] }, { "title": "KIR: diverse, rapidly evolving receptors of innate and adaptive immunity.", "journal": "Annual review of immunology", "date": "2002", "authors": "Vilches C, Parham P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11861603", "url": "https://glygen.org/publication/PubMed/11861603" } ] }, { "title": "Association between presence of HLA-B*5701, HLA-DR7, and HLA-DQ3 and hypersensitivity to HIV-1 reverse-transcriptase inhibitor abacavir.", "journal": "Lancet", "date": "2002", "authors": "Mallal S, Nolan D, Witt C, Masel G, Martin A M, Moore C, Sayer D, Castley A, Mamotte C, Maxwell D, James I, Christiansen F T", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "11888582", "url": "https://glygen.org/publication/PubMed/11888582" } ] }, { "title": "A structural perspective on MHC class I recognition by killer cell immunoglobulin-like receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Boyington JC, Sun PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955593", "url": "https://glygen.org/publication/PubMed/11955593" } ] }, { "title": "Asymmetric ligand recognition by the activating natural killer cell receptor NKG2D, a symmetric homodimer.", "journal": "Molecular immunology", "date": "2002", "authors": "Strong RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955595", "url": "https://glygen.org/publication/PubMed/11955595" } ] }, { "title": "Recognition of immunoglobulins by Fcgamma receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Radaev S, Sun P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955599", "url": "https://glygen.org/publication/PubMed/11955599" } ] }, { "title": "Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Nair JS, DaFonseca CJ, Tjernberg A, Sun W, Darnell JE Jr, Chait BT, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "11972023", "url": "https://glygen.org/publication/PubMed/11972023" } ] }, { "title": "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang L, Manji GA, Grenier JM, Al-Garawi A, Merriam S, Lora JM, Geddes BJ, Briskin M, DiStefano PS, Bertin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12019269", "url": "https://glygen.org/publication/PubMed/12019269" } ] }, { "title": "Identification of X-linked inhibitor of apoptosis-associated factor-1 as an interferon-stimulated gene that augments TRAIL Apo2L-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Leaman DW, Chawla-Sarkar M, Vyas K, Reheman M, Tamai K, Toji S, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12029096", "url": "https://glygen.org/publication/PubMed/12029096" } ] }, { "title": "A road map for those who don't know JAK-STAT.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Aaronson DS, Horvath CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12040185", "url": "https://glygen.org/publication/PubMed/12040185" } ] }, { "title": "CS1, a novel member of the CD2 family, is homophilic and regulates NK cell function.", "journal": "Molecular immunology", "date": "2002", "authors": "Kumaresan PR, Lai WC, Chuang SS, Bennett M, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12213321", "url": "https://glygen.org/publication/PubMed/12213321" } ] }, { "title": "A MAGE-3 peptide presented by HLA-B44 is also recognized by cytolytic T lymphocytes on HLA-B18.", "journal": "Tissue antigens", "date": "2002-07", "authors": "Bilsborough J, Panichelli C, Duffour M-T, Warnier G, Lurquin C, Schultz E S, Thielemans K, Corthals J, Boon T, van der Bruggen P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "12366779", "url": "https://glygen.org/publication/PubMed/12366779" } ] }, { "title": "An IFN-gamma-induced aminopeptidase in the ER, ERAP1, trims precursors to MHC class I-presented peptides.", "journal": "Nature immunology", "date": "2002", "authors": "Saric T, Chang SC, Hattori A, York IA, Markant S, Rock KL, Tsujimoto M, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "12436109", "url": "https://glygen.org/publication/PubMed/12436109" } ] }, { "title": "The ER aminopeptidase ERAP1 enhances or limits antigen presentation by trimming epitopes to 8-9 residues.", "journal": "Nature immunology", "date": "2002", "authors": "York IA, Chang SC, Saric T, Keys JA, Favreau JM, Goldberg AL, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "12436110", "url": "https://glygen.org/publication/PubMed/12436110" } ] }, { "title": "Seeing the light: preassembly and ligand-induced changes of the interferon gamma receptor complex in cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2002", "authors": "Krause CD, Mei E, Xie J, Jia Y, Bopp MA, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12438563", "url": "https://glygen.org/publication/PubMed/12438563" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.", "journal": "Human genetics", "date": "2003", "authors": "Speckman RA, Wright Daw JA, Helms C, Duan S, Cao L, Taillon-Miller P, Kwok PY, Menter A, Bowcock AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12483297", "url": "https://glygen.org/publication/PubMed/12483297" } ] }, { "title": "Expression of potential lymphocyte trafficking mediator molecules in the mammary gland.", "journal": "Veterinary research", "date": "2003", "authors": "Nishimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12588680", "url": "https://glygen.org/publication/PubMed/12588680" } ] }, { "title": "Cloning and sequencing full-length HLA-B and -C genes.", "journal": "Tissue antigens", "date": "2003", "authors": "Cox ST, McWhinnie AJ, Robinson J, Marsh SG, Parham P, Madrigal JA, Little AM", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "12622774", "url": "https://glygen.org/publication/PubMed/12622774" } ] }, { "title": "The ABC-transporter signature motif is required for peptide translocation but not peptide binding by TAP.", "journal": "European journal of immunology", "date": "2003", "authors": "Hewitt EW, Lehner PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "12645939", "url": "https://glygen.org/publication/PubMed/12645939" } ] }, { "title": "Crystal structure of the human natural killer cell activating receptor KIR2DS2 (CD158j).", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Saulquin X, Gastinel LN, Vivier E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "12668644", "url": "https://glygen.org/publication/PubMed/12668644" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "Cutting edge: Monarch-1: a pyrin/nucleotide-binding domain/leucine-rich repeat protein that controls classical and nonclassical MHC class I genes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Williams KL, Taxman DJ, Linhoff MW, Reed W, Ting JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12759408", "url": "https://glygen.org/publication/PubMed/12759408" } ] }, { "title": "Apoptosis and interferons: role of interferon-stimulated genes as mediators of apoptosis.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2003", "authors": "Chawla-Sarkar M, Lindner DJ, Liu YF, Williams BR, Sen GC, Silverman RH, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12766484", "url": "https://glygen.org/publication/PubMed/12766484" } ] }, { "title": "TREMs in the immune system and beyond.", "journal": "Nature reviews. Immunology", "date": "2003", "authors": "Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "12776204", "url": "https://glygen.org/publication/PubMed/12776204" } ] }, { "title": "The human type I interferon receptor: NMR structure reveals the molecular basis of ligand binding.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Chill JH, Quadt SR, Levy R, Schreiber G, Anglister J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "12842042", "url": "https://glygen.org/publication/PubMed/12842042" } ] }, { "title": "The ins and outs of STAT1 nuclear transport.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2003", "authors": "McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12915721", "url": "https://glygen.org/publication/PubMed/12915721" } ] }, { "title": "Unusual HLA-B alleles in two tribes of Brazilian Indians.", "journal": "Nature", "date": "1992", "authors": "Belich MP, Madrigal JA, Hildebrand WH, Zemmour J, Williams RC, Luz R, Petzl-Erler ML, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1317015", "url": "https://glygen.org/publication/PubMed/1317015" } ] }, { "title": "The B*4002 allele encodes the B61 antigen: B40* is identical to B61.", "journal": "Tissue antigens", "date": "1992", "authors": "Domena JD, Johnston-Dow L, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1362296", "url": "https://glygen.org/publication/PubMed/1362296" } ] }, { "title": "Serologic cross-reactivities poorly reflect allelic relationships in the HLA-B12 and HLA-B21 groups. Dominant epitopes of the alpha 2 helix.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "Hildebrand WH, Madrigal JA, Belich MP, Zemmour J, Ward FE, Williams RC, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1385528", "url": "https://glygen.org/publication/PubMed/1385528" } ] }, { "title": "Stoichiometry of interaction between interferon gamma and its receptor.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Fountoulakis M, Zulauf M, Lustig A, Garotta G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1396683", "url": "https://glygen.org/publication/PubMed/1396683" } ] }, { "title": "Distinctive HLA-A,B antigens of black populations formed by interallelic conversion.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "Madrigal JA, Belich MP, Hildebrand WH, Benjamin RJ, Little AM, Zemmour J, Ennis PD, Ward FE, Petzl-Erler ML, du Toit ED, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1431115", "url": "https://glygen.org/publication/PubMed/1431115" } ] }, { "title": "Interferon-gamma suppresses transforming growth factor-beta-induced invasion of gastric carcinoma cells through cross-talk of Smad pathway in a three-dimensional culture model.", "journal": "Oncogene", "date": "2003", "authors": "Kuga H, Morisaki T, Nakamura K, Onishi H, Noshiro H, Uchiyama A, Tanaka M, Katano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14586410", "url": "https://glygen.org/publication/PubMed/14586410" } ] }, { "title": "Beta-2 microglobulin in ESRD: an in-depth review.", "journal": "Advances in renal replacement therapy", "date": "2003", "authors": "Winchester JF, Salsberg JA, Levin NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "14681859", "url": "https://glygen.org/publication/PubMed/14681859" } ] }, { "title": "NKp44 triggers NK cell activation through DAP12 association that is not influenced by a putative cytoplasmic inhibitory sequence.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Campbell KS, Yusa S, Kikuchi-Maki A, Catina TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "14707061", "url": "https://glygen.org/publication/PubMed/14707061" } ] }, { "title": "Quality control of MHC class I maturation.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2004", "authors": "Paulsson KM, Wang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "14718384", "url": "https://glygen.org/publication/PubMed/14718384" } ] }, { "title": "Signaling by the CD19/CD21 complex on B cells.", "journal": "Current directions in autoimmunity", "date": "2004", "authors": "Carter RH, Barrington RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14719373", "url": "https://glygen.org/publication/PubMed/14719373" } ] }, { "title": "Interferon-gamma inhibits transforming growth factor-beta production in human airway epithelial cells by targeting Smads.", "journal": "American journal of respiratory cell and molecular biology", "date": "2004", "authors": "Wen FQ, Liu X, Kobayashi T, Abe S, Fang Q, Kohyama T, Ertl R, Terasaki Y, Manouilova L, Rennard SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14722222", "url": "https://glygen.org/publication/PubMed/14722222" } ] }, { "title": "Novel growth and death related interferon-stimulated genes (ISGs) in melanoma: greater potency of IFN-beta compared with IFN-alpha2.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2003", "authors": "Leaman DW, Chawla-Sarkar M, Jacobs B, Vyas K, Sun Y, Ozdemir A, Yi T, Williams BR, Borden EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "14769151", "url": "https://glygen.org/publication/PubMed/14769151" } ] }, { "title": "A common Japanese haplotype HLA-A26-Cw3-B61-DR9-DQ3 carries HLA-B*4002.", "journal": "Tissue antigens", "date": "1992", "authors": "Ling L, Watanabe Y, Tokunaga K, Kuwata S, Kohsaka T, Akaza T, Juji T", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1481202", "url": "https://glygen.org/publication/PubMed/1481202" } ] }, { "title": "Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Shiratori I, Ogasawara K, Saito T, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14970179", "url": "https://glygen.org/publication/PubMed/14970179" } ] }, { "title": "Toward a definition of self: proteomic evaluation of the class I peptide repertoire.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004-03-01", "authors": "Hickman Heather D, Luis Angela D, Buchli Rico, Few Steven R, Sathiamurthy Muthuraman, VanGundy Rodney S, Giberson Christopher F, Hildebrand William H", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "14978097", "url": "https://glygen.org/publication/PubMed/14978097" } ] }, { "title": "Cutting edge: CD96 (tactile) promotes NK cell-target cell adhesion by interacting with the poliovirus receptor (CD155).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fuchs A, Cella M, Giurisato E, Shaw AS, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15034010", "url": "https://glygen.org/publication/PubMed/15034010" } ] }, { "title": "Human MxA protein inhibits the replication of Crimean-Congo hemorrhagic fever virus.", "journal": "Journal of virology", "date": "2004", "authors": "Andersson I, Bladh L, Mousavi-Jazi M, Magnusson KE, Lundkvist A, Haller O, Mirazimi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15047845", "url": "https://glygen.org/publication/PubMed/15047845" } ] }, { "title": "Medical genetics: a marker for Stevens-Johnson syndrome.", "journal": "Nature", "date": "2004", "authors": "Chung Wen-Hung, Hung Shuen-Iu, Hong Hong-Shang, Hsih Mo-Song, Yang Li-Cheng, Ho Hsin-Chun, Wu Jer-Yuarn, Chen Yuan-Tsong", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "15057820", "url": "https://glygen.org/publication/PubMed/15057820" } ] }, { "title": "Transcriptional induction of IFN-gamma-responsive genes is modulated by DNA surrounding the interferon stimulation response element.", "journal": "Nucleic acids research", "date": "1992", "authors": "Strehlow I, Decker T", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1508672", "url": "https://glygen.org/publication/PubMed/1508672" } ] }, { "title": "A mutation in the HLA-B*2705-restricted NP383-391 epitope affects the human influenza A virus-specific cytotoxic T-lymphocyte response in vitro.", "journal": "Journal of virology", "date": "2004-05", "authors": "Berkhoff E G M, Boon A C M, Nieuwkoop N J, Fouchier R A M, Sintnicolaas K, Osterhaus A D M E, Rimmelzwaan G F", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "15113903", "url": "https://glygen.org/publication/PubMed/15113903" } ] }, { "title": "Crystal structure of the human T cell receptor CD3 epsilon gamma heterodimer complexed to the therapeutic mAb OKT3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Kjer-Nielsen L, Dunstone MA, Kostenko L, Ely LK, Beddoe T, Mifsud NA, Purcell AW, Brooks AG, McCluskey J, Rossjohn J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15136729", "url": "https://glygen.org/publication/PubMed/15136729" } ] }, { "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15143187", "url": "https://glygen.org/publication/PubMed/15143187" } ] }, { "title": "OSCAR is an FcRgamma-associated receptor that is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells.", "journal": "Blood", "date": "2004", "authors": "Merck E, Gaillard C, Gorman DM, Montero-Julian F, Durand I, Zurawski SM, Menetrier-Caux C, Carra G, Lebecque S, Trinchieri G, Bates EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15155468", "url": "https://glygen.org/publication/PubMed/15155468" } ] }, { "title": "CD200 is a ligand for all members of the CD200R family of immunoregulatory molecules.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Gorczynski R, Chen Z, Kai Y, Lee L, Wong S, Marsden PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15187158", "url": "https://glygen.org/publication/PubMed/15187158" } ] }, { "title": "The RNA helicase RIG-I has an essential function in double-stranded RNA-induced innate antiviral responses.", "journal": "Nature immunology", "date": "2004", "authors": "Yoneyama M, Kikuchi M, Natsukawa T, Shinobu N, Imaizumi T, Miyagishi M, Taira K, Akira S, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "15208624", "url": "https://glygen.org/publication/PubMed/15208624" } ] }, { "title": "MHC class I-independent recognition of NK-activating receptor KIR2DS4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Katz G, Gazit R, Arnon TI, Gonen-Gross T, Tarcic G, Markel G, Gruda R, Achdout H, Drize O, Merims S, Mandelboim O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "15265913", "url": "https://glygen.org/publication/PubMed/15265913" } ] }, { "title": "Tapasin enhances MHC class I peptide presentation according to peptide half-life.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Howarth M, Williams A, Tolstrup AB, Elliott T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "15286279", "url": "https://glygen.org/publication/PubMed/15286279" } ] }, { "title": "The LILR family: modulators of innate and adaptive immune pathways in health and disease.", "journal": "Tissue antigens", "date": "2004", "authors": "Brown D, Trowsdale J, Allen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15304001", "url": "https://glygen.org/publication/PubMed/15304001" } ] }, { "title": "Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Lamken P, Lata S, Gavutis M, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15312780", "url": "https://glygen.org/publication/PubMed/15312780" } ] }, { "title": "Protein kinase Cdelta regulates apoptosis via activation of STAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "DeVries TA, Kalkofen RL, Matassa AA, Reyland ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15322115", "url": "https://glygen.org/publication/PubMed/15322115" } ] }, { "title": "Three-dimensional structures of a humanized anti-IFN-gamma Fab (HuZAF) in two crystal forms.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2004", "authors": "Bourne PC, Terzyan SS, Cloud G, Landolfi NF, Vasquez M, Edmundson AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15388922", "url": "https://glygen.org/publication/PubMed/15388922" } ] }, { "title": "Identification of residues of the IFNAR1 chain of the type I human interferon receptor critical for ligand binding and biological activity.", "journal": "Biochemistry", "date": "2004", "authors": "Cajean-Feroldi C, Nosal F, Nardeux PC, Gallet X, Guymarho J, Baychelier F, Sempe P, Tovey MG, Escary JL, Eid P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15449939", "url": "https://glygen.org/publication/PubMed/15449939" } ] }, { "title": "Determination of the transphosphorylation sites of Jak2 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Matsuda T, Feng J, Witthuhn BA, Sekine Y, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15530433", "url": "https://glygen.org/publication/PubMed/15530433" } ] }, { "title": "Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Arnett KL, Harrison SC, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15534202", "url": "https://glygen.org/publication/PubMed/15534202" } ] }, { "title": "The SAP family of adaptors in immune regulation.", "journal": "Seminars in immunology", "date": "2004", "authors": "Latour S, Veillette A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15541655", "url": "https://glygen.org/publication/PubMed/15541655" } ] }, { "title": "Molecular characterization of a novel immune receptor restricted to the monocytic lineage.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Aguilar H, Alvarez-Errico D, Garcia-Montero AC, Orfao A, Sayos J, Lopez-Botet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "15557162", "url": "https://glygen.org/publication/PubMed/15557162" } ] }, { "title": "The KIR gene family: life in the fast lane of evolution.", "journal": "European journal of immunology", "date": "2005", "authors": "Uhrberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15580655", "url": "https://glygen.org/publication/PubMed/15580655" } ] }, { "title": "HLA-B27 in the Greek Cypriot population: distribution of subtypes in patients with ankylosing spondylitis and other HLA-B27-related diseases. The possible protective role of B*2707.", "journal": "Hum. Immunol.", "date": "2004", "authors": "Varnavidou-Nicolaidou Agathi, Karpasitou Katerina, Georgiou Dora, Stylianou Galatia, Kokkofitou Avgousta, Michalis Christodoulides, Constantina Constantinou, Gregoriadou Christiana, Kyriakides George", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "15603872", "url": "https://glygen.org/publication/PubMed/15603872" } ] }, { "title": "PVR (CD155) and Nectin-2 (CD112) as ligands of the human DNAM-1 (CD226) activating receptor: involvement in tumor cell lysis.", "journal": "Molecular immunology", "date": "2005", "authors": "Pende D, Bottino C, Castriconi R, Cantoni C, Marcenaro S, Rivera P, Spaggiari GM, Dondero A, Carnemolla B, Reymond N, Mingari MC, Lopez M, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15607800", "url": "https://glygen.org/publication/PubMed/15607800" } ] }, { "title": "Crystal structures and KIR3DL1 recognition of three immunodominant viral peptides complexed to HLA-B*2705.", "journal": "European journal of immunology", "date": "2005-02", "authors": "Stewart-Jones Guillame B E, di Gleria Kati, Kollnberger Simon, McMichael Andrew J, Jones E Yvonne, Bowness Paul", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "15657948", "url": "https://glygen.org/publication/PubMed/15657948" } ] }, { "title": "Lateral ligand-receptor interactions on membranes probed by simultaneous fluorescence-interference detection.", "journal": "Biophysical journal", "date": "2005", "authors": "Gavutis M, Lata S, Lamken P, Muller P, Piehler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "15778442", "url": "https://glygen.org/publication/PubMed/15778442" } ] }, { "title": "CD19 function in central and peripheral B-cell development.", "journal": "Immunologic research", "date": "2005", "authors": "Del Nagro CJ, Otero DC, Anzelon AN, Omori SA, Kolla RV, Rickert RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15778510", "url": "https://glygen.org/publication/PubMed/15778510" } ] }, { "title": "Nectin-like protein 2 defines a subset of T-cell zone dendritic cells and is a ligand for class-I-restricted T-cell-associated molecule.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Galibert L, Diemer GS, Liu Z, Johnson RS, Smith JL, Walzer T, Comeau MR, Rauch CT, Wolfson MF, Sorensen RA, Van der Vuurst de Vries AR, Branstetter DG, Koelling RM, Scholler J, Fanslow WC, Baum PR, Derry JM, Yan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15781451", "url": "https://glygen.org/publication/PubMed/15781451" } ] }, { "title": "Neutrophil migration across tight junctions is mediated by adhesive interactions between epithelial coxsackie and adenovirus receptor and a junctional adhesion molecule-like protein on neutrophils.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Zen K, Liu Y, McCall IC, Wu T, Lee W, Babbin BA, Nusrat A, Parkos CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15800062", "url": "https://glygen.org/publication/PubMed/15800062" } ] }, { "title": "Anti-alpha4 integrin therapy for multiple sclerosis: mechanisms and rationale.", "journal": "Neurology", "date": "2005", "authors": "Rice GP, Hartung HP, Calabresi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15851719", "url": "https://glygen.org/publication/PubMed/15851719" } ] }, { "title": "Anatomy of CD1-lipid antigen complexes.", "journal": "Nature reviews. Immunology", "date": "2005", "authors": "Moody DB, Zajonc DM, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15864273", "url": "https://glygen.org/publication/PubMed/15864273" } ] }, { "title": "KARAP/DAP12/TYROBP: three names and a multiplicity of biological functions.", "journal": "European journal of immunology", "date": "2005", "authors": "Tomasello E, Vivier E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "15884055", "url": "https://glygen.org/publication/PubMed/15884055" } ] }, { "title": "Protein sorting in the Golgi complex: shifting paradigms.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Rodriguez-Boulan E, Musch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "15927284", "url": "https://glygen.org/publication/PubMed/15927284" } ] }, { "title": "The CD94/NKG2C killer lectin-like receptor constitutes an alternative activation pathway for a subset of CD8+ T cells.", "journal": "European journal of immunology", "date": "2005", "authors": "Guma M, Busch LK, Salazar-Fontana LI, Bellosillo B, Morte C, Garcia P, Lopez-Botet M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "15940674", "url": "https://glygen.org/publication/PubMed/15940674" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "Siglecs--the major subfamily of I-type lectins.", "journal": "Glycobiology", "date": "2006", "authors": "Varki A, Angata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16014749", "url": "https://glygen.org/publication/PubMed/16014749" } ] }, { "title": "Heterotypic interaction of CRTAM with Necl2 induces cell adhesion on activated NK cells and CD8+ T cells.", "journal": "International immunology", "date": "2005", "authors": "Arase N, Takeuchi A, Unno M, Hirano S, Yokosuka T, Arase H, Saito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16091383", "url": "https://glygen.org/publication/PubMed/16091383" } ] }, { "title": "HLA class I/NK cell receptor interaction in early human decidua basalis: possible functional consequences.", "journal": "Chemical immunology and allergy", "date": "2005", "authors": "Rabot M, Tabiasco J, Polgar B, Aguerre-Girr M, Berrebi A, Bensussan A, Strbo N, Rukavina D, Le Bouteiller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16129954", "url": "https://glygen.org/publication/PubMed/16129954" } ] }, { "title": "Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Roisman LC, Jaitin DA, Baker DP, Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16171819", "url": "https://glygen.org/publication/PubMed/16171819" } ] }, { "title": "Signaling through a mutant IFN-gamma receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Costa-Pereira AP, Hermanns HM, Is'harc H, Williams TM, Watling D, Arulampalam V, Newman SJ, Heinrich PC, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16237089", "url": "https://glygen.org/publication/PubMed/16237089" } ] }, { "title": "Cutting edge: lectin-like transcript-1 is a ligand for the inhibitory human NKR-P1A receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Rosen DB, Bettadapura J, Alsharifi M, Mathew PA, Warren HS, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16339513", "url": "https://glygen.org/publication/PubMed/16339513" } ] }, { "title": "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Hernandez-Caselles T, Martinez-Esparza M, Perez-Oliva AB, Quintanilla-Cecconi AM, Garcia-Alonso A, Alvarez-Lopez DM, Garcia-Penarrubia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16380601", "url": "https://glygen.org/publication/PubMed/16380601" } ] }, { "title": "The macromolecular peptide-loading complex in MHC class I-dependent antigen presentation.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2006", "authors": "Koch J, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "16465444", "url": "https://glygen.org/publication/PubMed/16465444" } ] }, { "title": "Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.", "journal": "Cell research", "date": "2006", "authors": "Krause CD, Lavnikova N, Xie J, Mei E, Mirochnitchenko OV, Jia Y, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16467876", "url": "https://glygen.org/publication/PubMed/16467876" } ] }, { "title": "Structural definition of the H-2Kd peptide-binding motif.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Mitaksov V, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "16473882", "url": "https://glygen.org/publication/PubMed/16473882" } ] }, { "title": "How TCRs bind MHCs, peptides, and coreceptors.", "journal": "Annual review of immunology", "date": "2006", "authors": "Rudolph MG, Stanfield RL, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16551255", "url": "https://glygen.org/publication/PubMed/16551255" } ] }, { "title": "The assembly of diverse immune receptors is focused on a polar membrane-embedded interaction site.", "journal": "PLoS biology", "date": "2006", "authors": "Feng J, Call ME, Wucherpfennig KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "16623599", "url": "https://glygen.org/publication/PubMed/16623599" } ] }, { "title": "Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.", "journal": "Genetics", "date": "2006", "authors": "Shiina Takashi, Ota Masao, Shimizu Sayoko, Katsuyama Yoshihiko, Hashimoto Nami, Takasu Miwa, Anzai Tatsuya, Kulski Jerzy K, Kikkawa Eri, Naruse Taeko, Kimura Natsuki, Yanagiya Kazuyo, Watanabe Atsushi, Hosomichi Kazuyoshi, Kohara Sakae, Iwamoto Chie, Umehara Yumi, Meyer Alice, Wanner Val\u00e9rie, Sano Kazumi, Macquin C\u00e9cile, Ikeo Kazuho, Tokunaga Katsushi, Gojobori Takashi, Inoko Hidetoshi, Bahram Seiamak", "evidence": [ { "database": "UniProtKB", "id": "Q2L6G2", "url": "https://www.uniprot.org/uniprot/Q2L6G2" } ], "reference": [ { "type": "PubMed", "id": "16702430", "url": "https://glygen.org/publication/PubMed/16702430" } ] }, { "title": "Structural basis for recognition of MHC and MHC-like ligands by natural killer cell receptors.", "journal": "Seminars in immunology", "date": "2006", "authors": "Deng L, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16737824", "url": "https://glygen.org/publication/PubMed/16737824" } ] }, { "title": "Collagens are functional, high affinity ligands for the inhibitory immune receptor LAIR-1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Lebbink RJ, de Ruiter T, Adelmeijer J, Brenkman AB, van Helvoort JM, Koch M, Farndale RW, Lisman T, Sonnenberg A, Lenting PJ, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16754721", "url": "https://glygen.org/publication/PubMed/16754721" } ] }, { "title": "CD40/CD40L dyad in the inflammatory and immune responses in the central nervous system.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Chen K, Huang J, Gong W, Zhang L, Yu P, Wang JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16893496", "url": "https://glygen.org/publication/PubMed/16893496" } ] }, { "title": "The role of NK cell recognition of nectin and nectin-like proteins in tumor immunosurveillance.", "journal": "Seminars in cancer biology", "date": "2006", "authors": "Fuchs A, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16904340", "url": "https://glygen.org/publication/PubMed/16904340" } ] }, { "title": "Allodeterminants and evolution of a novel HLA-B5 CREG antigen, HLA-B SNA.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1990", "authors": "Sekimata M, Hiraiwa M, Andrien M, Dupont E, Karaki S, Yamamoto J, Kano K, Takiguchi M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1691230", "url": "https://glygen.org/publication/PubMed/1691230" } ] }, { "title": "Molecular and functional characterization of CD300b, a new activating immunoglobulin receptor able to transduce signals through two different pathways.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Martinez-Barriocanal A, Sayos J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "16920917", "url": "https://glygen.org/publication/PubMed/16920917" } ] }, { "title": "Is the CD200/CD200 receptor interaction more than just a myeloid cell inhibitory signal?", "journal": "Critical reviews in immunology", "date": "2006", "authors": "Minas K, Liversidge J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16928187", "url": "https://glygen.org/publication/PubMed/16928187" } ] }, { "title": "KIR/HLA pleiotropism: protection against both HIV and opportunistic infections.", "journal": "PLoS pathogens", "date": "2006", "authors": "Qi Y, Martin MP, Gao X, Jacobson L, Goedert JJ, Buchbinder S, Kirk GD, O'Brien SJ, Trowsdale J, Carrington M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "16933987", "url": "https://glygen.org/publication/PubMed/16933987" } ] }, { "title": "The Epstein-Barr virus-encoded LMP-1 oncoprotein negatively affects Tyk2 phosphorylation and interferon signaling in human B cells.", "journal": "Journal of virology", "date": "2006", "authors": "Geiger TR, Martin JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "16987978", "url": "https://glygen.org/publication/PubMed/16987978" } ] }, { "title": "Allospecificities between HLA-Bw53 and HLA-B35 are generated by substitution of the residues associated with HLA-Bw4/Bw6 public epitopes.", "journal": "Immunogenetics", "date": "1990", "authors": "Hayashi H, Ooba T, Nakayama S, Sekimata M, Kano K, Takiguchi M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1699887", "url": "https://glygen.org/publication/PubMed/1699887" } ] }, { "title": "Discovery of Siglec-14, a novel sialic acid receptor undergoing concerted evolution with Siglec-5 in primates.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Angata T, Hayakawa T, Yamanaka M, Varki A, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "17012248", "url": "https://glygen.org/publication/PubMed/17012248" } ] }, { "title": "NTB-A receptor crystal structure: insights into homophilic interactions in the signaling lymphocytic activation molecule receptor family.", "journal": "Immunity", "date": "2006", "authors": "Cao E, Ramagopal UA, Fedorov A, Fedorov E, Yan Q, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17045824", "url": "https://glygen.org/publication/PubMed/17045824" } ] }, { "title": "Bap31 enhances the endoplasmic reticulum export and quality control of human class I MHC molecules.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Ladasky JJ, Boyle S, Seth M, Li H, Pentcheva T, Abe F, Steinberg SJ, Edidin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "17056546", "url": "https://glygen.org/publication/PubMed/17056546" } ] }, { "title": "Crystal structures of two peptide-HLA-B*1501 complexes; structural characterization of the HLA-B62 supertype.", "journal": "Acta Crystallogr. D", "date": "2006", "authors": "R\u00f8der Gustav, Blicher Thomas, Justesen Sune, Johannesen Birthe, Kristensen Ole, Kastrup Jette, Buus S\u00f8ren, Gajhede Michael", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "17057332", "url": "https://glygen.org/publication/PubMed/17057332" } ] }, { "title": "Mutual activation of natural killer cells and monocytes mediated by NKp80-AICL interaction.", "journal": "Nature immunology", "date": "2006", "authors": "Welte S, Kuttruff S, Waldhauer I, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17057721", "url": "https://glygen.org/publication/PubMed/17057721" } ] }, { "title": "ERAAP synergizes with MHC class I molecules to make the final cut in the antigenic peptide precursors in the endoplasmic reticulum.", "journal": "Immunity", "date": "2006", "authors": "Kanaseki T, Blanchard N, Hammer GE, Gonzalez F, Shastri N", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "17088086", "url": "https://glygen.org/publication/PubMed/17088086" } ] }, { "title": "The TREM receptor family and signal integration.", "journal": "Nature immunology", "date": "2006", "authors": "Klesney-Tait J, Turnbull IR, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "17110943", "url": "https://glygen.org/publication/PubMed/17110943" } ] }, { "title": "IFN-gamma abrogates profibrogenic TGF-beta signaling in liver by targeting expression of inhibitory and receptor Smads.", "journal": "Journal of hepatology", "date": "2007", "authors": "Weng H, Mertens PR, Gressner AM, Dooley S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "17125875", "url": "https://glygen.org/publication/PubMed/17125875" } ] }, { "title": "Cutting Edge: KIR3DS1, a gene implicated in resistance to progression to AIDS, encodes a DAP12-associated receptor expressed on NK cells that triggers NK cell activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Carr WH, Rosen DB, Arase H, Nixon DF, Michaelsson J, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "17202323", "url": "https://glygen.org/publication/PubMed/17202323" } ] }, { "title": "A soluble form of the MHC class I-specific CD160 receptor is released from human activated NK lymphocytes and inhibits cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Giustiniani J, Marie-Cardine A, Bensussan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17237375", "url": "https://glygen.org/publication/PubMed/17237375" } ] }, { "title": "Control of human immunodeficiency virus type 1 is associated with HLA-B*13 and targeting of multiple gag-specific CD8+ T-cell epitopes.", "journal": "Journal of virology", "date": "2007-04", "authors": "Honeyborne Isobella, Prendergast Andrew, Pereyra Florencia, Leslie Alasdair, Crawford Hayley, Payne Rebecca, Reddy Shabashini, Bishop Karen, Moodley Eshia, Nair Kriebashnie, van der Stok Mary, McCarthy Noel, Rousseau Christine M, Addo Marylyn, Mullins James I, Brander Christian, Kiepiela Photini, Walker Bruce D, Goulder Philip J R", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "17251285", "url": "https://glygen.org/publication/PubMed/17251285" } ] }, { "title": "Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.", "journal": "Journal of virology", "date": "2007-04", "authors": "Elliott Joanne, Lynch Oonagh T, Suessmuth Yvonne, Qian Ping, Boyd Caroline R, Burrows James F, Buick Richard, Stevenson Nigel J, Touzelet Olivier, Gadina Massimo, Power Ultan F, Johnston James A", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17251292", "url": "https://glygen.org/publication/PubMed/17251292" } ] }, { "title": "Regulation of the Egr-1 gene by tumor necrosis factor and interferons in primary human fibroblasts.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Cao XM, Guy GR, Sukhatme VP, Tan YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "1730654", "url": "https://glygen.org/publication/PubMed/1730654" } ] }, { "title": "Mechanisms of COPII vesicle formation and protein sorting.", "journal": "FEBS letters", "date": "2007", "authors": "Sato K, Nakano A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "17316621", "url": "https://glygen.org/publication/PubMed/17316621" } ] }, { "title": "Complement-mediated activation of the adaptive immune responses: role of C3d in linking the innate and adaptive immunity.", "journal": "Immunologic research", "date": "2006", "authors": "Toapanta FR, Ross TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17337780", "url": "https://glygen.org/publication/PubMed/17337780" } ] }, { "title": "STAT activation and differential complex formation dictate selectivity of interferon responses.", "journal": "Acta biochimica Polonica", "date": "2007", "authors": "Wesoly J, Szweykowska-Kulinska Z, Bluyssen HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17351669", "url": "https://glygen.org/publication/PubMed/17351669" } ] }, { "title": "HLA-Bw22: a family of molecules with identity to HLA-B7 in the alpha 1-helix.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "Hildebrand WH, Madrigal JA, Little AM, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1737933", "url": "https://glygen.org/publication/PubMed/1737933" } ] }, { "title": "Siglec-15: an immune system Siglec conserved throughout vertebrate evolution.", "journal": "Glycobiology", "date": "2007", "authors": "Angata T, Tabuchi Y, Nakamura K, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "17483134", "url": "https://glygen.org/publication/PubMed/17483134" } ] }, { "title": "Detection of KIR3DS1 on the cell surface of peripheral blood NK cells facilitates identification of a novel null allele and assessment of KIR3DS1 expression during HIV-1 infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Pascal V, Yamada E, Martin MP, Alter G, Altfeld M, Metcalf JA, Baseler MW, Adelsberger JW, Carrington M, Anderson SK, McVicar DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "17641029", "url": "https://glygen.org/publication/PubMed/17641029" } ] }, { "title": "Peptide-receptive major histocompatibility complex class I molecules cycle between endoplasmic reticulum and cis-Golgi in wild-type lymphocytes.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Garstka M, Borchert B, Al-Balushi M, Praveen PV, Kuhl N, Majoul I, Duden R, Springer S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "17656363", "url": "https://glygen.org/publication/PubMed/17656363" } ] }, { "title": "The receptor of the type I interferon family.", "journal": "Current topics in microbiology and immunology", "date": "2007", "authors": "Uze G, Schreiber G, Piehler J, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "17969444", "url": "https://glygen.org/publication/PubMed/17969444" } ] }, { "title": "Homotypic interactions mediated by Slamf1 and Slamf6 receptors control NKT cell lineage development.", "journal": "Immunity", "date": "2007", "authors": "Griewank K, Borowski C, Rietdijk S, Wang N, Julien A, Wei DG, Mamchak AA, Terhorst C, Bendelac A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18031695", "url": "https://glygen.org/publication/PubMed/18031695" } ] }, { "title": "Full results of the Evidence of Interferon Dose-Response-European North American Comparative Efficacy (EVIDENCE) study: a multicenter, randomized, assessor-blinded comparison of low-dose weekly versus high-dose, high-frequency interferon beta-1a for relapsing multiple sclerosis.", "journal": "Clinical therapeutics", "date": "2007", "authors": "Schwid SR, Panitch HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18035202", "url": "https://glygen.org/publication/PubMed/18035202" } ] }, { "title": "CD1 antigen presentation: how it works.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Barral DC, Brenner MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18037897", "url": "https://glygen.org/publication/PubMed/18037897" } ] }, { "title": "Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells.", "journal": "Immunity", "date": "2007", "authors": "Pogge von Strandmann E, Simhadri VR, von Tresckow B, Sasse S, Reiners KS, Hansen HP, Rothe A, Boll B, Simhadri VL, Borchmann P, McKinnon PJ, Hallek M, Engert A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18055229", "url": "https://glygen.org/publication/PubMed/18055229" } ] }, { "title": "The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Lebbink RJ, van den Berg MC, de Ruiter T, Raynal N, van Roon JA, Lenting PJ, Jin B, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18209062", "url": "https://glygen.org/publication/PubMed/18209062" } ] }, { "title": "Biophysical characterization of O-glycosylated CD99 recognition by paired Ig-like type 2 receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tabata S, Kuroki K, Wang J, Kajikawa M, Shiratori I, Kohda D, Arase H, Maenaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18234675", "url": "https://glygen.org/publication/PubMed/18234675" } ] }, { "title": "The cell biology of cross-presentation and the role of dendritic cell subsets.", "journal": "Immunology and cell biology", "date": "2008", "authors": "Lin ML, Zhan Y, Villadangos JA, Lew AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "18268517", "url": "https://glygen.org/publication/PubMed/18268517" } ] }, { "title": "Induction of guanylate binding protein 5 by gamma interferon increases susceptibility to Salmonella enterica serovar Typhimurium-induced pyroptosis in RAW 264.7 cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rupper AC, Cardelli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18362138", "url": "https://glygen.org/publication/PubMed/18362138" } ] }, { "title": "Structural and functional constraints limit options for cytotoxic T-lymphocyte escape in the immunodominant HLA-B27-restricted epitope in human immunodeficiency virus type 1 capsid.", "journal": "Journal of virology", "date": "2008-06", "authors": "Schneidewind Arne, Brockman Mark A, Sidney John, Wang Yaoyu E, Chen Huabiao, Suscovich Todd J, Li Bin, Adam Rahma I, Allgaier Rachel L, Moth\u00e9 Bianca R, Kuntzen Thomas, Oniangue-Ndza Cesar, Trocha Alicja, Yu Xu G, Brander Christian, Sette Alessandro, Walker Bruce D, Allen Todd M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "18385228", "url": "https://glygen.org/publication/PubMed/18385228" } ] }, { "title": "Interferon-inducible antiviral effectors.", "journal": "Nature reviews. Immunology", "date": "2008", "authors": "Sadler AJ, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "18575461", "url": "https://glygen.org/publication/PubMed/18575461" } ] }, { "title": "Tyrosine phosphorylation regulates the partitioning of STAT1 between different dimer conformations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wenta N, Strauss H, Meyer S, Vinkemeier U", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18591661", "url": "https://glygen.org/publication/PubMed/18591661" } ] }, { "title": "Structural and functional aspects of lipid binding by CD1 molecules.", "journal": "Annual review of cell and developmental biology", "date": "2008", "authors": "Silk JD, Salio M, Brown J, Jones EY, Cerundolo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18593354", "url": "https://glygen.org/publication/PubMed/18593354" } ] }, { "title": "Evidence that the KIR2DS5 gene codes for a surface receptor triggering natural killer cell function.", "journal": "European journal of immunology", "date": "2008", "authors": "Della Chiesa M, Romeo E, Falco M, Balsamo M, Augugliaro R, Moretta L, Bottino C, Moretta A, Vitale M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "18624290", "url": "https://glygen.org/publication/PubMed/18624290" } ] }, { "title": "SIGLEC16 encodes a DAP12-associated receptor expressed in macrophages that evolved from its inhibitory counterpart SIGLEC11 and has functional and non-functional alleles in humans.", "journal": "European journal of immunology", "date": "2008", "authors": "Cao H, Lakner U, de Bono B, Traherne JA, Trowsdale J, Barrow AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "18629938", "url": "https://glygen.org/publication/PubMed/18629938" } ] }, { "title": "Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation.", "journal": "Cell", "date": "2008", "authors": "Suzuki K, Verma IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "18692471", "url": "https://glygen.org/publication/PubMed/18692471" } ] }, { "title": "The two major subtypes of HLA-B44 differ for a single amino acid in codon 156.", "journal": "Tissue Antigens", "date": "1991", "authors": "Fleischhauer K, Kernan N A, Dupont B, Yang S Y", "evidence": [ { "database": "UniProtKB", "id": "Q2L6G2", "url": "https://www.uniprot.org/uniprot/Q2L6G2" } ], "reference": [ { "type": "PubMed", "id": "1871765", "url": "https://glygen.org/publication/PubMed/1871765" } ] }, { "title": "MHC class I endosomal and lysosomal trafficking coincides with exogenous antigen loading in dendritic cells.", "journal": "PloS one", "date": "2008", "authors": "Basha G, Lizee G, Reinicke AT, Seipp RP, Omilusik KD, Jefferies WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "18802471", "url": "https://glygen.org/publication/PubMed/18802471" } ] }, { "title": "Essential differences in ligand presentation and T cell epitope recognition among HLA molecules of the HLA-B44 supertype.", "journal": "European journal of immunology", "date": "2008-11", "authors": "Hillen Nina, Mester Gabor, Lemmel Claudia, Weinzierl Andreas O, M\u00fcller Margret, Wernet Dorothee, Hennenlotter J\u00f6rg, Stenzl Arnulf, Rammensee Hans-Georg, Stevanovi\u0107 Stefan", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "18991276", "url": "https://glygen.org/publication/PubMed/18991276" } ] }, { "title": "Insights into MHC class I peptide loading from the structure of the tapasin-ERp57 thiol oxidoreductase heterodimer.", "journal": "Immunity", "date": "2009", "authors": "Dong G, Wearsch PA, Peaper DR, Cresswell P, Reinisch KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19119025", "url": "https://glygen.org/publication/PubMed/19119025" } ] }, { "title": "Loss of viral fitness and cross-recognition by CD8+ T cells limit HCV escape from a protective HLA-B27-restricted human immune response.", "journal": "The Journal of clinical investigation", "date": "2009-02", "authors": "Dazert Eva, Neumann-Haefelin Christoph, Bressanelli St\u00e9phane, Fitzmaurice Karen, Kort Julia, Timm J\u00f6rg, McKiernan Susan, Kelleher Dermot, Gruener Norbert, Tavis John E, Rosen Hugo R, Shaw Jaqueline, Bowness Paul, Blum Hubert E, Klenerman Paul, Bartenschlager Ralf, Thimme Robert", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "19139562", "url": "https://glygen.org/publication/PubMed/19139562" } ] }, { "title": "Triggering Receptor Expressed on Myeloid Cells (TREM) family and the application of its antagonists.", "journal": "Recent patents on anti-infective drug discovery", "date": "2009", "authors": "Molloy EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19149696", "url": "https://glygen.org/publication/PubMed/19149696" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889#ptm_processing" }, { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Mechanisms of transport through the Golgi complex.", "journal": "Journal of cell science", "date": "2009", "authors": "Jackson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19193869", "url": "https://glygen.org/publication/PubMed/19193869" } ] }, { "title": "MHC molecules and microbial antigen processing in phagosomes.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Ramachandra L, Simmons D, Harding CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "19217269", "url": "https://glygen.org/publication/PubMed/19217269" } ] }, { "title": "Identification of self peptides bound to purified HLA-B27.", "journal": "Nature", "date": "1991-09-26", "authors": "Jardetzky T S, Lane W S, Robinson R A, Madden D R, Wiley D C", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "1922338", "url": "https://glygen.org/publication/PubMed/1922338" } ] }, { "title": "Antigen processing and presentation: TAPping into ABC transporters.", "journal": "Current opinion in immunology", "date": "2009", "authors": "Procko E, Gaudet R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19261456", "url": "https://glygen.org/publication/PubMed/19261456" } ] }, { "title": "Interaction of Bap31 and MHC class I molecules and their traffic out of the endoplasmic reticulum.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Abe F, Van Prooyen N, Ladasky JJ, Edidin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19342655", "url": "https://glygen.org/publication/PubMed/19342655" } ] }, { "title": "The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.", "journal": "Trends in immunology", "date": "2009", "authors": "Clark GJ, Ju X, Tate C, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19359216", "url": "https://glygen.org/publication/PubMed/19359216" } ] }, { "title": "A transmembrane tail: interaction of tapasin with TAP and the MHC class I molecule.", "journal": "Molecular immunology", "date": "2009", "authors": "Simone LC, Wang X, Solheim JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19361863", "url": "https://glygen.org/publication/PubMed/19361863" } ] }, { "title": "The peptide-loading complex--antigen translocation and MHC class I loading.", "journal": "Biological chemistry", "date": "2009", "authors": "Scholz C, Tampe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19426129", "url": "https://glygen.org/publication/PubMed/19426129" } ] }, { "title": "IRAP identifies an endosomal compartment required for MHC class I cross-presentation.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Saveanu L, Carroll O, Weimershaus M, Guermonprez P, Firat E, Lindo V, Greer F, Davoust J, Kratzer R, Keller SR, Niedermann G, van Endert P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "19498108", "url": "https://glygen.org/publication/PubMed/19498108" } ] }, { "title": "Protein kinase phosphorylation site sequences and consensus specificity motifs: tabulations.", "journal": "Methods in enzymology", "date": "1991", "authors": "Pearson RB, Kemp BE", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" } ], "reference": [ { "type": "PubMed", "id": "1956339", "url": "https://glygen.org/publication/PubMed/1956339" } ] }, { "title": "Membrane traffic within the Golgi apparatus.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Glick BS, Nakano A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19575639", "url": "https://glygen.org/publication/PubMed/19575639" } ] }, { "title": "The CD300 molecules regulate monocyte and dendritic cell functions.", "journal": "Immunobiology", "date": "2009", "authors": "Clark GJ, Ju X, Azlan M, Tate C, Ding Y, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19592130", "url": "https://glygen.org/publication/PubMed/19592130" } ] }, { "title": "Calreticulin-dependent recycling in the early secretory pathway mediates optimal peptide loading of MHC class I molecules.", "journal": "The EMBO journal", "date": "2009", "authors": "Howe C, Garstka M, Al-Balushi M, Ghanem E, Antoniou AN, Fritzsche S, Jankevicius G, Kontouli N, Schneeweiss C, Williams A, Elliott T, Springer S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "19851281", "url": "https://glygen.org/publication/PubMed/19851281" } ] }, { "title": "KIR2DS4 is a product of gene conversion with KIR3DL2 that introduced specificity for HLA-A*11 while diminishing avidity for HLA-C.", "journal": "The Journal of experimental medicine", "date": "2009", "authors": "Graef T, Moesta AK, Norman PJ, Abi-Rached L, Vago L, Older Aguilar AM, Gleimer M, Hammond JA, Guethlein LA, Bushnell DA, Robinson PJ, Parham P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "19858347", "url": "https://glygen.org/publication/PubMed/19858347" } ] }, { "title": "Different cross-presentation pathways in steady-state and inflammatory dendritic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Segura E, Albiston AL, Wicks IP, Chai SY, Villadangos JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236977", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977" } ], "reference": [ { "type": "PubMed", "id": "19918052", "url": "https://glygen.org/publication/PubMed/19918052" } ] }, { "title": "Neutralization of IFNgamma defeats haemophagocytosis in LCMV-infected perforin- and Rab27a-deficient mice.", "journal": "EMBO molecular medicine", "date": "2009", "authors": "Pachlopnik Schmid J, Ho CH, Chretien F, Lefebvre JM, Pivert G, Kosco-Vilbois M, Ferlin W, Geissmann F, Fischer A, de Saint Basile G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20049711", "url": "https://glygen.org/publication/PubMed/20049711" } ] }, { "title": "Expression of the HLA-C2-specific activating killer-cell Ig-like receptor KIR2DS1 on NK and T cells.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2010", "authors": "Cognet C, Farnarier C, Gauthier L, Frassati C, Andre P, Magerus-Chatinet A, Anfossi N, Rieux-Laucat F, Vivier E, Schleinitz N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "20093094", "url": "https://glygen.org/publication/PubMed/20093094" } ] }, { "title": "Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms.", "journal": "Blood", "date": "2010", "authors": "Quintas-Cardama A, Vaddi K, Liu P, Manshouri T, Li J, Scherle PA, Caulder E, Wen X, Li Y, Waeltz P, Rupar M, Burn T, Lo Y, Kelley J, Covington M, Shepard S, Rodgers JD, Haley P, Kantarjian H, Fridman JS, Verstovsek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20130243", "url": "https://glygen.org/publication/PubMed/20130243" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20304997", "url": "https://glygen.org/publication/PubMed/20304997" } ] }, { "title": "Nomenclature for factors of the HLA system, 2010.", "journal": "Tissue Antigens", "date": "2010", "authors": "Marsh S G E, Albert E D, Bodmer W F, Bontrop R E, Dupont B, Erlich H A, Fern\u00e1ndez-Vi\u00f1a M, Geraghty D E, Holdsworth R, Hurley C K, Lau M, Lee K W, Mach B, Maiers M, Mayr W R, M\u00fcller C R, Parham P, Petersdorf E W, Sasazuki T, Strominger J L, Svejgaard A, Terasaki P I, Tiercy J M, Trowsdale J", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "20356336", "url": "https://glygen.org/publication/PubMed/20356336" } ] }, { "title": "Selective inhibition of JAK1 and JAK2 is efficacious in rodent models of arthritis: preclinical characterization of INCB028050.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Fridman JS, Scherle PA, Collins R, Burn TC, Li Y, Li J, Covington MB, Thomas B, Collier P, Favata MF, Wen X, Shi J, McGee R, Haley PJ, Shepard S, Rodgers JD, Yeleswaram S, Hollis G, Newton RC, Metcalf B, Friedman SM, Vaddi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20363976", "url": "https://glygen.org/publication/PubMed/20363976" } ] }, { "title": "Refined structure of the human histocompatibility antigen HLA-A2 at 2.6 A resolution.", "journal": "Journal of molecular biology", "date": "1991", "authors": "Saper MA, Bjorkman PJ, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "2038058", "url": "https://glygen.org/publication/PubMed/2038058" } ] }, { "title": "Passage through the Golgi.", "journal": "Current opinion in cell biology", "date": "2010", "authors": "Nakano A, Luini A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "20605430", "url": "https://glygen.org/publication/PubMed/20605430" } ] }, { "title": "Molecular basis for the recognition of phosphorylated STAT1 by importin alpha5.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Nardozzi J, Wenta N, Yasuhara N, Vinkemeier U, Cingolani G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "20643137", "url": "https://glygen.org/publication/PubMed/20643137" } ] }, { "title": "Efficient inhibition of collagen-induced platelet activation and adhesion by LAIR-2, a soluble Ig-like receptor family member.", "journal": "PloS one", "date": "2010", "authors": "Lenting PJ, Westerlaken GH, Denis CV, Akkerman JW, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "20730098", "url": "https://glygen.org/publication/PubMed/20730098" } ] }, { "title": "Does the KIR2DS5 gene protect from some human diseases?", "journal": "PloS one", "date": "2010", "authors": "Nowak I, Majorczyk E, Wisniewski A, Pawlik A, Magott-Procelewska M, Passowicz-Muszynska E, Malejczyk J, Ploski R, Giebel S, Barcz E, Zon-Giebel A, Malinowski A, Tchorzewski H, Chlebicki A, Luszczek W, Kurpisz M, Grybos M, Wilczynski J, Wiland P, Senitzer D, Sun JY, Jankowska R, Klinger M, Kusnierczyk P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "20865034", "url": "https://glygen.org/publication/PubMed/20865034" } ] }, { "title": "The structural basis for intramembrane assembly of an activating immunoreceptor complex.", "journal": "Nature immunology", "date": "2010", "authors": "Call ME, Wucherpfennig KW, Chou JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "20890284", "url": "https://glygen.org/publication/PubMed/20890284" } ] }, { "title": "The cell biology of major histocompatibility complex class I assembly: towards a molecular understanding.", "journal": "Tissue antigens", "date": "2010", "authors": "Van Hateren A, James E, Bailey A, Phillips A, Dalchau N, Elliott T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "21050182", "url": "https://glygen.org/publication/PubMed/21050182" } ] }, { "title": "PANP is a novel O-glycosylated PILRalpha ligand expressed in neural tissues.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Kogure A, Shiratori I, Wang J, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21241660", "url": "https://glygen.org/publication/PubMed/21241660" } ] }, { "title": "Analysis for complete genomic sequence of HLA-B and HLA-C alleles in the Chinese Han population.", "journal": "International journal of immunogenetics", "date": "2011", "authors": "Zhu F, He Y, Zhang W, He J, He J, Xu X, Lv H, Yan L", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "21585707", "url": "https://glygen.org/publication/PubMed/21585707" } ] }, { "title": "Specific lipid recognition is a general feature of CD300 and TREM molecules.", "journal": "Immunogenetics", "date": "2012", "authors": "Cannon JP, O'Driscoll M, Litman GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21800138", "url": "https://glygen.org/publication/PubMed/21800138" } ] }, { "title": "OSCAR is a collagen receptor that costimulates osteoclastogenesis in DAP12-deficient humans and mice.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Barrow AD, Raynal N, Andersen TL, Slatter DA, Bihan D, Pugh N, Cella M, Kim T, Rho J, Negishi-Koga T, Delaisse JM, Takayanagi H, Lorenzo J, Colonna M, Farndale RW, Choi Y, Trowsdale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21841309", "url": "https://glygen.org/publication/PubMed/21841309" } ] }, { "title": "The shaping of modern human immune systems by multiregional admixture with archaic humans.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Abi-Rached L, Jobin MJ, Kulkarni S, McWhinnie A, Dalva K, Gragert L, Babrzadeh F, Gharizadeh B, Luo M, Plummer FA, Kimani J, Carrington M, Middleton D, Rajalingam R, Beksac M, Marsh SG, Maiers M, Guethlein LA, Tavoularis S, Little AM, Green RE, Norman PJ, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "21868630", "url": "https://glygen.org/publication/PubMed/21868630" } ] }, { "title": "B7-H6/NKp30 interaction: a mechanism of alerting NK cells against tumors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kaifu T, Escaliere B, Gastinel LN, Vivier E, Baratin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21877119", "url": "https://glygen.org/publication/PubMed/21877119" } ] }, { "title": "Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B.", "journal": "Nature", "date": "2011", "authors": "Vivian JP, Duncan RC, Berry R, O'Connor GM, Reid HH, Beddoe T, Gras S, Saunders PM, Olshina MA, Widjaja JM, Harpur CM, Lin J, Maloveste SM, Price DA, Lafont BA, McVicar DW, Clements CS, Brooks AG, Rossjohn J", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "22020283", "url": "https://glygen.org/publication/PubMed/22020283" } ] }, { "title": "Differential expression and distinct structure of 69- and 100-kDa forms of 2-5A synthetase in human cells treated with interferon.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Marie I, Svab J, Robert N, Galabru J, Hovanessian AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "2211721", "url": "https://glygen.org/publication/PubMed/2211721" } ] }, { "title": "Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.", "journal": "Cell", "date": "2011", "authors": "Cebrian I, Visentin G, Blanchard N, Jouve M, Bobard A, Moita C, Enninga J, Moita LF, Amigorena S, Savina A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "22153078", "url": "https://glygen.org/publication/PubMed/22153078" } ] }, { "title": "Five amino acids in three HLA proteins explain most of the association between MHC and seropositive rheumatoid arthritis.", "journal": "Nature genetics", "date": "2012", "authors": "Raychaudhuri S, Sandor C, Stahl EA, Freudenberg J, Lee HS, Jia X, Alfredsson L, Padyukov L, Klareskog L, Worthington J, Siminovitch KA, Bae SC, Plenge RM, Gregersen PK, de Bakker PI", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "22286218", "url": "https://glygen.org/publication/PubMed/22286218" } ] }, { "title": "Evolutionarily conserved paired immunoglobulin-like receptor alpha (PILRalpha) domain mediates its interaction with diverse sialylated ligands.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sun Y, Senger K, Baginski TK, Mazloom A, Chinn Y, Pantua H, Hamidzadeh K, Ramani SR, Luis E, Tom I, Sebrell A, Quinones G, Ma Y, Mukhyala K, Sai T, Ding J, Haley B, Shadnia H, Kapadia SB, Gonzalez LC, Hass PE, Zarrin AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "22396535", "url": "https://glygen.org/publication/PubMed/22396535" } ] }, { "title": "Nucleotide sequence of an HLA-Bw57 gene.", "journal": "Nucleic acids research", "date": "1990", "authors": "Isamat M, Girdlestone J, Milstein C", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2251138", "url": "https://glygen.org/publication/PubMed/2251138" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Hanan EJ, van Abbema A, Barrett K, Blair WS, Blaney J, Chang C, Eigenbrot C, Flynn S, Gibbons P, Hurley CA, Kenny JR, Kulagowski J, Lee L, Magnuson SR, Morris C, Murray J, Pastor RM, Rawson T, Siu M, Ultsch M, Zhou A, Sampath D, Lyssikatos JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23061660", "url": "https://glygen.org/publication/PubMed/23061660" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Distinct and overlapping genomic profiles and antiviral effects of Interferon-lambda and -alpha on HCV-infected and noninfected hepatoma cells.", "journal": "Journal of viral hepatitis", "date": "2012", "authors": "Kohli A, Zhang X, Yang J, Russell RS, Donnelly RP, Sheikh F, Sherman A, Young H, Imamichi T, Lempicki RA, Masur H, Kottilil S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "23121362", "url": "https://glygen.org/publication/PubMed/23121362" } ] }, { "title": "Rapid cloning of HLA-A,B cDNA by using the polymerase chain reaction: frequency and nature of errors produced in amplification.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Ennis PD, Zemmour J, Salter RD, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2320591", "url": "https://glygen.org/publication/PubMed/2320591" } ] }, { "title": "Rapid antigen processing and presentation of a protective and immunodominant HLA-B*27-restricted hepatitis C virus-specific CD8+ T-cell epitope.", "journal": "PLoS pathogens", "date": "2012", "authors": "Schmidt Julia, Iversen Astrid K N, Tenzer Stefan, Gostick Emma, Price David A, Lohmann Volker, Distler Ute, Bowness Paul, Schild Hansj\u00f6rg, Blum Hubert E, Klenerman Paul, Neumann-Haefelin Christoph, Thimme Robert", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "23209413", "url": "https://glygen.org/publication/PubMed/23209413" } ] }, { "title": "Genome-wide association analysis identifies new susceptibility loci for Behcet's disease and epistasis between HLA-B*51 and ERAP1.", "journal": "Nat. Genet.", "date": "2013", "authors": "Kirino Y, Bertsias G, Ishigatsubo Y, Mizuki N, Tugal-Tutkun I, Seyahi E, Ozyazgan Y, Sacli FS, Erer B, Inoko H, Emrence Z, Cakar A, Abaci N, Ustek D, Satorius C, Ueda A, Takeno M, Kim Y, Wood GM, Ombrello MJ, Meguro A, Gul A, Remmers EF, Kastner DL", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "23291587", "url": "https://glygen.org/publication/PubMed/23291587" } ] }, { "title": "The novel HLA-B*44:02:27 allele, identified by sequencing-based typing of a candidate stem-cell donor.", "journal": "Tissue Antigens", "date": "2013", "authors": "van Soest M, Rosel M, de Graaff A, Zwan B, Spierings E", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "23510421", "url": "https://glygen.org/publication/PubMed/23510421" } ] }, { "title": "IkappaB kinase phosphorylation of SNAP-23 controls platelet secretion.", "journal": "Blood", "date": "2013", "authors": "Karim ZA, Zhang J, Banerjee M, Chicka MC, Al Hawas R, Hamilton TR, Roche PA, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "23613522", "url": "https://glygen.org/publication/PubMed/23613522" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "CS1 (SLAMF7) inhibits production of proinflammatory cytokines by activated monocytes.", "journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]", "date": "2013", "authors": "Kim JR, Horton NC, Mathew SO, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23695528", "url": "https://glygen.org/publication/PubMed/23695528" } ] }, { "title": "Phase-defined complete sequencing of the HLA genes by next-generation sequencing.", "journal": "BMC Genomics", "date": "2013", "authors": "Hosomichi Kazuyoshi, Jinam Timothy A, Mitsunaga Shigeki, Nakaoka Hirofumi, Inoue Ituro", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "23714642", "url": "https://glygen.org/publication/PubMed/23714642" } ] }, { "title": "HLA peptide length preferences control CD8+ T cell responses.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013-07-15", "authors": "Rist Melissa J, Theodossis Alex, Croft Nathan P, Neller Michelle A, Welland Andrew, Chen Zhenjun, Sullivan Lucy C, Burrows Jacqueline M, Miles John J, Brennan Rebekah M, Gras Stephanie, Khanna Rajiv, Brooks Andrew G, McCluskey James, Purcell Anthony W, Rossjohn Jamie, Burrows Scott R", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "23749632", "url": "https://glygen.org/publication/PubMed/23749632" } ] }, { "title": "Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.", "journal": "Blood", "date": "2013", "authors": "Klimosch SN, Bartel Y, Wiemann S, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23929856", "url": "https://glygen.org/publication/PubMed/23929856" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "BAG-6, a jack of all trades in health and disease.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2014", "authors": "Binici J, Koch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "24305946", "url": "https://glygen.org/publication/PubMed/24305946" } ] }, { "title": "A transposable epitope of HLA-B7, B40 molecules.", "journal": "Immunogenetics", "date": "1987", "authors": "Ways JP, Lawlor DA, Wan AM, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2437025", "url": "https://glygen.org/publication/PubMed/2437025" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Specific associations of fluorescent beta-2-microglobulin with cell surfaces. The affinity of different H-2 and HLA antigens for beta-2-microglobulin.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1988", "authors": "Hochman JH, Shimizu Y, DeMars R, Edidin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "2450918", "url": "https://glygen.org/publication/PubMed/2450918" } ] }, { "title": "Molecular basis of a dominant T cell response to an HIV reverse transcriptase 8-mer epitope presented by the protective allele HLA-B*51:01.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014-04-01", "authors": "Motozono Chihiro, Kuse Nozomi, Sun Xiaoming, Rizkallah Pierre J, Fuller Anna, Oka Shinichi, Cole David K, Sewell Andrew K, Takiguchi Masafumi", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "24600035", "url": "https://glygen.org/publication/PubMed/24600035" } ] }, { "title": "TLR signals induce phagosomal MHC-I delivery from the endosomal recycling compartment to allow cross-presentation.", "journal": "Cell", "date": "2014", "authors": "Nair-Gupta P, Baccarini A, Tung N, Seyffer F, Florey O, Huang Y, Banerjee M, Overholtzer M, Roche PA, Tampe R, Brown BD, Amsen D, Whiteheart SW, Blander JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1236974", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974" } ], "reference": [ { "type": "PubMed", "id": "25083866", "url": "https://glygen.org/publication/PubMed/25083866" } ] }, { "title": "Evidence for the efficacy of interferon beta-1b in delaying the onset of clinically definite multiple sclerosis in individuals with clinically isolated syndrome.", "journal": "Therapeutic advances in neurological disorders", "date": "2014", "authors": "Freedman MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "25371710", "url": "https://glygen.org/publication/PubMed/25371710" } ] }, { "title": "The interaction of KIR3DL1*001 with HLA class I molecules is dependent upon molecular microarchitecture within the Bw4 epitope.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Saunders PM, Vivian JP, Baschuk N, Beddoe T, Widjaja J, O'Connor GM, Hitchen C, Pymm P, Andrews DM, Gras S, McVicar DW, Rossjohn J, Brooks AG", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "25480565", "url": "https://glygen.org/publication/PubMed/25480565" } ] }, { "title": "CD1 and mycobacterial lipids activate human T cells.", "journal": "Immunological reviews", "date": "2015", "authors": "Van Rhijn I, Moody DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25703557", "url": "https://glygen.org/publication/PubMed/25703557" } ] }, { "title": "OSCAR is a receptor for surfactant protein D that activates TNF-alpha release from human CCR2+ inflammatory monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Barrow AD, Palarasah Y, Bugatti M, Holehouse AS, Byers DE, Holtzman MJ, Vermi W, Skjodt K, Crouch E, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25716998", "url": "https://glygen.org/publication/PubMed/25716998" } ] }, { "title": "A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.", "journal": "Retrovirology", "date": "2015", "authors": "Kloverpris HN, Cole DK, Fuller A, Carlson J, Beck K, Schauenburg AJ, Rizkallah PJ, Buus S, Sewell AK, Goulder P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "25808313", "url": "https://glygen.org/publication/PubMed/25808313" } ] }, { "title": "Activation of human T cells by CD1 and self-lipids.", "journal": "Immunological reviews", "date": "2015", "authors": "de Jong A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26284469", "url": "https://glygen.org/publication/PubMed/26284469" } ] }, { "title": "Recognition of Microbial Glycolipids by Natural Killer T Cells.", "journal": "Frontiers in immunology", "date": "2015", "authors": "Zajonc DM, Girardi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26300885", "url": "https://glygen.org/publication/PubMed/26300885" } ] }, { "title": "Mechanistic Basis for Epitope Proofreading in the Peptide-Loading Complex.", "journal": "J. Immunol.", "date": "2015", "authors": "Fleischmann Gerda, Fisette Olivier, Thomas Christoph, Wieneke Ralph, Tumulka Franz, Schneeweiss Clemens, Springer Sebastian, Sch\u00e4fer Lars V, Tamp\u00e9 Robert", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "26416272", "url": "https://glygen.org/publication/PubMed/26416272" } ] }, { "title": "Allelic variation in HLA-B and HLA-C sequences and the evolution of the HLA-B alleles.", "journal": "Immunogenetics", "date": "1989", "authors": "Pohla H, Kuon W, Tabaczewski P, Doerner C, Weiss EH", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2714852", "url": "https://glygen.org/publication/PubMed/2714852" } ] }, { "title": "Diversity and diversification of HLA-A,B,C alleles.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1989", "authors": "Parham P, Lawlor DA, Lomen CE, Ennis PD", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2715640", "url": "https://glygen.org/publication/PubMed/2715640" } ] }, { "title": "The structure of HLA-B35 suggests that it is derived from HLA-Bw58 by two genetic mechanisms.", "journal": "Immunogenetics", "date": "1989", "authors": "Ooba T, Hayashi H, Karaki S, Tanabe M, Kano K, Takiguchi M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2788131", "url": "https://glygen.org/publication/PubMed/2788131" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01889", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01889" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "The Intergenic Recombinant HLA-B *46:01 Has a Distinctive Peptidome that Includes KIR2DL3 Ligands.", "journal": "Cell reports", "date": "2017", "authors": "Hilton HG, McMurtrey CP, Han AS, Djaoud Z, Guethlein LA, Blokhuis JH, Pugh JL, Goyos A, Horowitz A, Buchli R, Jackson KW, Bardet W, Bushnell DA, Robinson PJ, Mendoza JL, Birnbaum ME, Nielsen M, Garcia KC, Hildebrand WH, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "28514659", "url": "https://glygen.org/publication/PubMed/28514659" } ] }, { "title": "Dual redundant sequencing strategy: Full-length gene characterisation of 1056 novel and confirmatory HLA alleles.", "journal": "HLA", "date": "2017", "authors": "Albrecht V, Zweiniger C, Surendranath V, Lang K, Sch\u00f6fl G, Dahl A, Winkler S, Lange V, B\u00f6hme I, Schmidt A H", "evidence": [ { "database": "UniProtKB", "id": "Q5SS57", "url": "https://www.uniprot.org/uniprot/Q5SS57" } ], "reference": [ { "type": "PubMed", "id": "28547825", "url": "https://glygen.org/publication/PubMed/28547825" } ] }, { "title": "Distinguishing functional polymorphism from random variation in the sequences of >10,000 HLA-A, -B and -C alleles.", "journal": "PLoS Genet.", "date": "2017", "authors": "Robinson James, Guethlein Lisbeth A, Cereb Nezih, Yang Soo Young, Norman Paul J, Marsh Steven G E, Parham Peter", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "28650991", "url": "https://glygen.org/publication/PubMed/28650991" } ] }, { "title": "Next generation sequencing characterizes the extent of HLA diversity in an Argentinian registry population.", "journal": "HLA", "date": "2018", "authors": "Hurley C K, Hou L, Lazaro A, Gerfen J, Enriquez E, Galarza P, Rodriguez Cardozo M B, Halagan M, Maiers M, Behm D, Ng J", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "29327506", "url": "https://glygen.org/publication/PubMed/29327506" } ] }, { "title": "Nomenclature for factors of the HLA system, update December 2017.", "journal": "Int. J. Immunogenet.", "date": "2018", "authors": "Marsh S G E", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "29405566", "url": "https://glygen.org/publication/PubMed/29405566" } ] }, { "title": "Divergent T-cell receptor recognition modes of a HLA-I restricted extended tumour-associated peptide.", "journal": "Nature communications", "date": "2018-03-12", "authors": "Chan Kok Fei, Gully Benjamin S, Gras Stephanie, Beringer Dennis X, Kjer-Nielsen Lars, Cebon Jonathan, McCluskey James, Chen Weisan, Rossjohn Jamie", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "29531227", "url": "https://glygen.org/publication/PubMed/29531227" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1348", "url": "https://glyconnect.expasy.org/browser/proteins/1348" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "The complete primary structure of HLA-Bw58.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Ways JP, Coppin HL, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "2995352", "url": "https://glygen.org/publication/PubMed/2995352" } ] }, { "title": "Gene conversion-like mechanisms may generate polymorphism in human class I genes.", "journal": "The EMBO journal", "date": "1986", "authors": "Seemann GH, Rein RS, Brown CS, Ploegh HL", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "3011411", "url": "https://glygen.org/publication/PubMed/3011411" } ] }, { "title": "Reference Grade Characterization of Polymorphisms in Full-Length HLA Class I and II Genes With Short-Read Sequencing on the ION PGM System and Long-Reads Generated by Single Molecule, Real-Time Sequencing on the PacBio Platform.", "journal": "Front. Immunol.", "date": "2018", "authors": "Suzuki S, Ranade S, Osaki K, Ito S, Shigenari A, Ohnuki Y, Oka A, Masuya A, Harting J, Baybayan P, Kitazume M, Sunaga J, Morishima S, Morishima Y, Inoko H, Kulski JK, Shiina T", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "30337930", "url": "https://glygen.org/publication/PubMed/30337930" } ] }, { "title": "O-GlcNAc-induced nuclear translocation of hnRNP-K is associated with progression and metastasis of cholangiocarcinoma.", "journal": "Molecular oncology", "date": "2019", "authors": "Phoomak C, Park D, Silsirivanit A, Sawanyawisuth K, Vaeteewoottacharn K, Detarya M, Wongkham C, Lebrilla CB, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01889", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01889" } ], "reference": [ { "type": "PubMed", "id": "30444036", "url": "https://glygen.org/publication/PubMed/30444036" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01889", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Differential induction of interferon stimulated genes between type I and type III interferons is independent of interferon receptor abundance.", "journal": "PLoS pathogens", "date": "2018", "authors": "Pervolaraki K, Rastgou Talemi S, Albrecht D, Bormann F, Bamford C, Mendoza JL, Garcia KC, McLauchlan J, Hofer T, Stanifer ML, Boulant S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "30485383", "url": "https://glygen.org/publication/PubMed/30485383" } ] }, { "title": "ZBP1 and TAK1: Master Regulators of NLRP3 Inflammasome/Pyroptosis, Apoptosis, and Necroptosis (PAN-optosis).", "journal": "Frontiers in cellular and infection microbiology", "date": "2019", "authors": "Malireddi RKS, Kesavardhana S, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "31850239", "url": "https://glygen.org/publication/PubMed/31850239" } ] }, { "title": "Baricitinib as potential treatment for 2019-nCoV acute respiratory disease.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Richardson P, Griffin I, Tucker C, Smith D, Oechsle O, Phelan A, Rawling M, Savory E, Stebbing J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32032529", "url": "https://glygen.org/publication/PubMed/32032529" } ] }, { "title": "COVID-19: combining antiviral and anti-inflammatory treatments.", "journal": "The Lancet. Infectious diseases", "date": "2020", "authors": "Stebbing J, Phelan A, Griffin I, Tucker C, Oechsle O, Smith D, Richardson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32113509", "url": "https://glygen.org/publication/PubMed/32113509" } ] }, { "title": "A SARS-CoV-2 protein interaction map reveals targets for drug repurposing.", "journal": "Nature", "date": "2020", "authors": "Gordon DE, Jang GM, Bouhaddou M, Xu J, Obernier K, White KM, O'Meara MJ, Rezelj VV, Guo JZ, Swaney DL, Tummino TA, Huttenhain R, Kaake RM, Richards AL, Tutuncuoglu B, Foussard H, Batra J, Haas K, Modak M, Kim M, Haas P, Polacco BJ, Braberg H, Fabius JM, Eckhardt M, Soucheray M, Bennett MJ, Cakir M, McGregor MJ, Li Q, Meyer B, Roesch F, Vallet T, Mac Kain A, Miorin L, Moreno E, Naing ZZC, Zhou Y, Peng S, Shi Y, Zhang Z, Shen W, Kirby IT, Melnyk JE, Chorba JS, Lou K, Dai SA, Barrio-Hernandez I, Memon D, Hernandez-Armenta C, Lyu J, Mathy CJP, Perica T, Pilla KB, Ganesan SJ, Saltzberg DJ, Rakesh R, Liu X, Rosenthal SB, Calviello L, Venkataramanan S, Liboy-Lugo J, Lin Y, Huang XP, Liu Y, Wankowicz SA, Bohn M, Safari M, Ugur FS, Koh C, Savar NS, Tran QD, Shengjuler D, Fletcher SJ, O'Neal MC, Cai Y, Chang JCJ, Broadhurst DJ, Klippsten S, Sharp PP, Wenzell NA, Kuzuoglu-Ozturk D, Wang HY, Trenker R, Young JM, Cavero DA, Hiatt J, Roth TL, Rathore U, Subramanian A, Noack J, Hubert M, Stroud RM, Frankel AD, Rosenberg OS, Verba KA, Agard DA, Ott M, Emerman M, Jura N, von Zastrow M, Verdin E, Ashworth A, Schwartz O, d'Enfert C, Mukherjee S, Jacobson M, Malik HS, Fujimori DG, Ideker T, Craik CS, Floor SN, Fraser JS, Gross JD, Sali A, Roth BL, Ruggero D, Taunton J, Kortemme T, Beltrao P, Vignuzzi M, Garcia-Sastre A, Shokat KM, Shoichet BK, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32353859", "url": "https://glygen.org/publication/PubMed/32353859" } ] }, { "title": "Characterization and Noncovalent Inhibition of the Deubiquitinase and deISGylase Activity of SARS-CoV-2 Papain-Like Protease.", "journal": "ACS infectious diseases", "date": "2020", "authors": "Freitas BT, Durie IA, Murray J, Longo JE, Miller HC, Crich D, Hogan RJ, Tripp RA, Pegan SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32428392", "url": "https://glygen.org/publication/PubMed/32428392" } ] }, { "title": "Discovery of a Janus Kinase Inhibitor Bearing a Highly Three-Dimensional Spiro Scaffold: JTE-052 (Delgocitinib) as a New Dermatological Agent to Treat Inflammatory Skin Disorders.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Noji S, Hara Y, Miura T, Yamanaka H, Maeda K, Hori A, Yamamoto H, Obika S, Inoue M, Hase Y, Orita T, Doi S, Adachi T, Tanimoto A, Oki C, Kimoto Y, Ogawa Y, Negoro T, Hashimoto H, Shiozaki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32511913", "url": "https://glygen.org/publication/PubMed/32511913" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32574262", "url": "https://glygen.org/publication/PubMed/32574262" } ] }, { "title": "Comparison of the structure of HLA-Bw47 to HLA-B13 and its relationship to 21-hydroxylase deficiency.", "journal": "Immunogenetics", "date": "1988", "authors": "Zemmour J, Ennis PD, Parham P, Dupont B", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "3257938", "url": "https://glygen.org/publication/PubMed/3257938" } ] }, { "title": "The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway.", "journal": "Virus research", "date": "2020", "authors": "Li JY, Liao CH, Wang Q, Tan YJ, Luo R, Qiu Y, Ge XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32589897", "url": "https://glygen.org/publication/PubMed/32589897" } ] }, { "title": "A Randomized Clinical Trial of the Efficacy and Safety of Interferon beta-1a in Treatment of Severe COVID-19.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Davoudi-Monfared E, Rahmani H, Khalili H, Hajiabdolbaghi M, Salehi M, Abbasian L, Kazemzadeh H, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32661006", "url": "https://glygen.org/publication/PubMed/32661006" } ] }, { "title": "Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity.", "journal": "Nature", "date": "2020", "authors": "Shin D, Mukherjee R, Grewe D, Bojkova D, Baek K, Bhattacharya A, Schulz L, Widera M, Mehdipour AR, Tascher G, Geurink PP, Wilhelm A, van der Heden van Noort GJ, Ovaa H, Muller S, Knobeloch KP, Rajalingam K, Schulman BA, Cinatl J, Hummer G, Ciesek S, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32726803", "url": "https://glygen.org/publication/PubMed/32726803" } ] }, { "title": "SARS-CoV-2 Orf9b suppresses type I interferon responses by targeting TOM70.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Jiang HW, Zhang HN, Meng QF, Xie J, Li Y, Chen H, Zheng YX, Wang XN, Qi H, Zhang J, Wang PH, Han ZG, Tao SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32728199", "url": "https://glygen.org/publication/PubMed/32728199" } ] }, { "title": "SARS-CoV-2 clearance in COVID-19 patients with Novaferon treatment: A randomized, open-label, parallel-group trial.", "journal": "International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases", "date": "2020", "authors": "Zheng F, Zhou Y, Zhou Z, Ye F, Huang B, Huang Y, Ma J, Zuo Q, Tan X, Xie J, Niu P, Wang W, Xu Y, Peng F, Zhou N, Cai C, Tang W, Xiao X, Li Y, Zhou Z, Jiang Y, Xie Y, Tan W, Gong G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32758689", "url": "https://glygen.org/publication/PubMed/32758689" } ] }, { "title": "Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.", "journal": "International immunopharmacology", "date": "2020", "authors": "Rahmani H, Davoudi-Monfared E, Nourian A, Khalili H, Hajizadeh N, Jalalabadi NZ, Fazeli MR, Ghazaeian M, Yekaninejad MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "32862111", "url": "https://glygen.org/publication/PubMed/32862111" } ] }, { "title": "Broad and strong memory CD4+ and CD8+ T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19.", "journal": "Nature immunology", "date": "2020-11", "authors": "Peng Yanchun, Mentzer Alexander J, Liu Guihai, Yao Xuan, Yin Zixi, Dong Danning, Dejnirattisai Wanwisa, Rostron Timothy, Supasa Piyada, Liu Chang, L\u00f3pez-Camacho C\u00e9sar, Slon-Campos Jose, Zhao Yuguang, Stuart David I, Paesen Guido C, Grimes Jonathan M, Antson Alfred A, Bayfield Oliver W, Hawkins Dorothy E D P, Ker De-Sheng, Wang Beibei, Turtle Lance, Subramaniam Krishanthi, Thomson Paul, Zhang Ping, Dold Christina, Ratcliff Jeremy, Simmonds Peter, de Silva Thushan, Sopp Paul, Wellington Dannielle, Rajapaksa Ushani, Chen Yi-Ling, Salio Mariolina, Napolitani Giorgio, Paes Wayne, Borrow Persephone, Kessler Benedikt M, Fry Jeremy W, Schwabe Nikolai F, Semple Malcolm G, Baillie J Kenneth, Moore Shona C, Openshaw Peter J M, Ansari M Azim, Dunachie Susanna, Barnes Eleanor, Frater John, Kerr Georgina, Goulder Philip, Lockett Teresa, Levin Robert, Zhang Yonghong, Jing Ronghua, Ho Ling-Pei, , , Cornall Richard J, Conlon Christopher P, Klenerman Paul, Screaton Gavin R, Mongkolsapaya Juthathip, McMichael Andrew, Knight Julian C, Ogg Graham, Dong Tao", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "32887977", "url": "https://glygen.org/publication/PubMed/32887977" } ] }, { "title": "SARS-CoV-2 N protein antagonizes type I interferon signaling by suppressing phosphorylation and nuclear translocation of STAT1 and STAT2.", "journal": "Cell discovery", "date": "2020", "authors": "Mu J, Fang Y, Yang Q, Shu T, Wang A, Huang M, Jin L, Deng F, Qiu Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32953130", "url": "https://glygen.org/publication/PubMed/32953130" } ] }, { "title": "Evasion of Type I Interferon by SARS-CoV-2.", "journal": "Cell reports", "date": "2020", "authors": "Xia H, Cao Z, Xie X, Zhang X, Chen JY, Wang H, Menachery VD, Rajsbaum R, Shi PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32979938", "url": "https://glygen.org/publication/PubMed/32979938" } ] }, { "title": "Main protease of SARS-CoV-2 serves as a bifunctional molecule in restricting type I interferon antiviral signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Wu Y, Ma L, Zhuang Z, Cai S, Zhao Z, Zhou L, Zhang J, Wang PH, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33024073", "url": "https://glygen.org/publication/PubMed/33024073" } ] }, { "title": "Comparative host-coronavirus protein interaction networks reveal pan-viral disease mechanisms.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Gordon DE, Hiatt J, Bouhaddou M, Rezelj VV, Ulferts S, Braberg H, Jureka AS, Obernier K, Guo JZ, Batra J, Kaake RM, Weckstein AR, Owens TW, Gupta M, Pourmal S, Titus EW, Cakir M, Soucheray M, McGregor M, Cakir Z, Jang G, O'Meara MJ, Tummino TA, Zhang Z, Foussard H, Rojc A, Zhou Y, Kuchenov D, Huttenhain R, Xu J, Eckhardt M, Swaney DL, Fabius JM, Ummadi M, Tutuncuoglu B, Rathore U, Modak M, Haas P, Haas KM, Naing ZZC, Pulido EH, Shi Y, Barrio-Hernandez I, Memon D, Petsalaki E, Dunham A, Marrero MC, Burke D, Koh C, Vallet T, Silvas JA, Azumaya CM, Billesbolle C, Brilot AF, Campbell MG, Diallo A, Dickinson MS, Diwanji D, Herrera N, Hoppe N, Kratochvil HT, Liu Y, Merz GE, Moritz M, Nguyen HC, Nowotny C, Puchades C, Rizo AN, Schulze-Gahmen U, Smith AM, Sun M, Young ID, Zhao J, Asarnow D, Biel J, Bowen A, Braxton JR, Chen J, Chio CM, Chio US, Deshpande I, Doan L, Faust B, Flores S, Jin M, Kim K, Lam VL, Li F, Li J, Li YL, Li Y, Liu X, Lo M, Lopez KE, Melo AA, Moss FR 3rd, Nguyen P, Paulino J, Pawar KI, Peters JK, Pospiech TH Jr, Safari M, Sangwan S, Schaefer K, Thomas PV, Thwin AC, Trenker R, Tse E, Tsui TKM, Wang F, Whitis N, Yu Z, Zhang K, Zhang Y, Zhou F, Saltzberg D, Hodder AJ, Shun-Shion AS, Williams DM, White KM, Rosales R, Kehrer T, Miorin L, Moreno E, Patel AH, Rihn S, Khalid MM, Vallejo-Gracia A, Fozouni P, Simoneau CR, Roth TL, Wu D, Karim MA, Ghoussaini M, Dunham I, Berardi F, Weigang S, Chazal M, Park J, Logue J, McGrath M, Weston S, Haupt R, Hastie CJ, Elliott M, Brown F, Burness KA, Reid E, Dorward M, Johnson C, Wilkinson SG, Geyer A, Giesel DM, Baillie C, Raggett S, Leech H, Toth R, Goodman N, Keough KC, Lind AL, Klesh RJ, Hemphill KR, Carlson-Stevermer J, Oki J, Holden K, Maures T, Pollard KS, Sali A, Agard DA, Cheng Y, Fraser JS, Frost A, Jura N, Kortemme T, Manglik A, Southworth DR, Stroud RM, Alessi DR, Davies P, Frieman MB, Ideker T, Abate C, Jouvenet N, Kochs G, Shoichet B, Ott M, Palmarini M, Shokat KM, Garcia-Sastre A, Rassen JA, Grosse R, Rosenberg OS, Verba KA, Basler CF, Vignuzzi M, Peden AA, Beltrao P, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33060197", "url": "https://glygen.org/publication/PubMed/33060197" } ] }, { "title": "SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Miorin L, Kehrer T, Sanchez-Aparicio MT, Zhang K, Cohen P, Patel RS, Cupic A, Makio T, Mei M, Moreno E, Danziger O, White KM, Rathnasinghe R, Uccellini M, Gao S, Aydillo T, Mena I, Yin X, Martin-Sancho L, Krogan NJ, Chanda SK, Schotsaert M, Wozniak RW, Ren Y, Rosenberg BR, Fontoura BMA, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33097660", "url": "https://glygen.org/publication/PubMed/33097660" } ] }, { "title": "SARS-CoV-2 membrane glycoprotein M antagonizes the MAVS-mediated innate antiviral response.", "journal": "Cellular & molecular immunology", "date": "2021", "authors": "Fu YZ, Wang SY, Zheng ZQ, Yi Huang, Li WW, Xu ZS, Wang YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33110251", "url": "https://glygen.org/publication/PubMed/33110251" } ] }, { "title": "The Role of Type I Interferons in the Pathogenesis and Treatment of COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Schreiber G", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33117408", "url": "https://glygen.org/publication/PubMed/33117408" } ] }, { "title": "Safety and efficacy of inhaled nebulised interferon beta-1a (SNG001) for treatment of SARS-CoV-2 infection: a randomised, double-blind, placebo-controlled, phase 2 trial.", "journal": "The Lancet. Respiratory medicine", "date": "2021", "authors": "Monk PD, Marsden RJ, Tear VJ, Brookes J, Batten TN, Mankowski M, Gabbay FJ, Davies DE, Holgate ST, Ho LP, Clark T, Djukanovic R, Wilkinson TMA", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33189161", "url": "https://glygen.org/publication/PubMed/33189161" } ] }, { "title": "Corrigendum: Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33193462", "url": "https://glygen.org/publication/PubMed/33193462" } ] }, { "title": "Splicing factor YBX1 mediates persistence of JAK2-mutated neoplasms.", "journal": "Nature", "date": "2020-12", "authors": "Jayavelu Ashok Kumar, Schn\u00f6der Tina M, Perner Florian, Herzog Carolin, Meiler Arno, Krishnamoorthy Gurumoorthy, Huber Nicolas, Mohr Juliane, Edelmann-Stephan B\u00e4rbel, Austin Rebecca, Brandt Sabine, Palandri Francesca, Schr\u00f6der Nicolas, Isermann Berend, Edlich Frank, Sinha Amit U, Ungelenk Martin, H\u00fcbner Christian A, Zeiser Robert, Rahmig Susann, Waskow Claudia, Coldham Iain, Ernst Thomas, Hochhaus Andreas, Jilg Stefanie, Jost Philipp J, Mullally Ann, Bullinger Lars, Mertens Peter R, Lane Steven W, Mann Matthias, Heidel Florian H", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "33239784", "url": "https://glygen.org/publication/PubMed/33239784" } ] }, { "title": "The SARS-CoV-2 RNA-protein interactome in infected human cells.", "journal": "Nature microbiology", "date": "2021", "authors": "Schmidt N, Lareau CA, Keshishian H, Ganskih S, Schneider C, Hennig T, Melanson R, Werner S, Wei Y, Zimmer M, Ade J, Kirschner L, Zielinski S, Dolken L, Lander ES, Caliskan N, Fischer U, Vogel J, Carr SA, Bodem J, Munschauer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33349665", "url": "https://glygen.org/publication/PubMed/33349665" } ] }, { "title": "Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Kato K, Ikliptikawati DK, Kobayashi A, Kondo H, Lim K, Hazawa M, Wong RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33360543", "url": "https://glygen.org/publication/PubMed/33360543" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) membrane (M) protein inhibits type I and III interferon production by targeting RIG-I/MDA-5 signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Zheng Y, Zhuang MW, Han L, Zhang J, Nan ML, Zhan P, Kang D, Liu X, Gao C, Wang PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372174", "url": "https://glygen.org/publication/PubMed/33372174" } ] }, { "title": "SARS-CoV-2 proteases PLpro and 3CLpro cleave IRF3 and critical modulators of inflammatory pathways (NLRP12 and TAB1): implications for disease presentation across species.", "journal": "Emerging microbes & infections", "date": "2021", "authors": "Moustaqil M, Ollivier E, Chiu HP, Van Tol S, Rudolffi-Soto P, Stevens C, Bhumkar A, Hunter DJB, Freiberg AN, Jacques D, Lee B, Sierecki E, Gambin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372854", "url": "https://glygen.org/publication/PubMed/33372854" } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19 Is Associated with Improvements in Lung Abnormalities.", "journal": "Viruses", "date": "2020", "authors": "Zhou Q, MacArthur MR, He X, Wei X, Zarin P, Hanna BS, Wang ZH, Xiang X, Fish EN", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "33396578", "url": "https://glygen.org/publication/PubMed/33396578" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Interacts with RIG-I and Represses RIG-Mediated IFN-beta Production.", "journal": "Viruses", "date": "2020", "authors": "Chen K, Xiao F, Hu D, Ge W, Tian M, Wang W, Pan P, Wu K, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33396605", "url": "https://glygen.org/publication/PubMed/33396605" } ] }, { "title": "MDA5 Governs the Innate Immune Response to SARS-CoV-2 in Lung Epithelial Cells.", "journal": "Cell reports", "date": "2021", "authors": "Yin X, Riva L, Pu Y, Martin-Sancho L, Kanamune J, Yamamoto Y, Sakai K, Gotoh S, Miorin L, De Jesus PD, Yang CC, Herbert KM, Yoh S, Hultquist JF, Garcia-Sastre A, Chanda SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33440148", "url": "https://glygen.org/publication/PubMed/33440148" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein undergoes liquid-liquid phase separation into stress granules through its N-terminal intrinsically disordered region.", "journal": "Cell discovery", "date": "2021", "authors": "Wang J, Shi C, Xu Q, Yin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33479219", "url": "https://glygen.org/publication/PubMed/33479219" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production.", "journal": "Science bulletin", "date": "2021", "authors": "Luo L, Li Z, Zhao T, Ju X, Ma P, Jin B, Zhou Y, He S, Huang J, Xu X, Zou Y, Li P, Liang A, Liu J, Chi T, Huang X, Ding Q, Jin Z, Huang C, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33495715", "url": "https://glygen.org/publication/PubMed/33495715" } ] }, { "title": "SARS-CoV-2 triggers an MDA-5-dependent interferon response which is unable to control replication in lung epithelial cells.", "journal": "Journal of virology", "date": "2021", "authors": "Rebendenne A, Valadao ALC, Tauziet M, Maarifi G, Bonaventure B, McKellar J, Planes R, Nisole S, Arnaud-Arnould M, Moncorge O, Goujon C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33514628", "url": "https://glygen.org/publication/PubMed/33514628" } ] }, { "title": "SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO.", "journal": "Cell reports", "date": "2021", "authors": "Wu J, Shi Y, Pan X, Wu S, Hou R, Zhang Y, Zhong T, Tang H, Du W, Wang L, Wo J, Mu J, Qiu Y, Yang K, Zhang LK, Ye BC, Qi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33567255", "url": "https://glygen.org/publication/PubMed/33567255" } ] }, { "title": "SARS-CoV-2, SARS-CoV-1, and HIV-1 derived ssRNA sequences activate the NLRP3 inflammasome in human macrophages through a non-classical pathway.", "journal": "iScience", "date": "2021", "authors": "Campbell GR, To RK, Hanna J, Spector SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33718825", "url": "https://glygen.org/publication/PubMed/33718825" } ] }, { "title": "Unique and complementary suppression of cGAS-STING and RNA sensing- triggered innate immune responses by SARS-CoV-2 proteins.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Rui Y, Su J, Shen S, Hu Y, Huang D, Zheng W, Lou M, Shi Y, Wang M, Chen S, Zhao N, Dong Q, Cai Y, Xu R, Zheng S, Yu XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723219", "url": "https://glygen.org/publication/PubMed/33723219" } ] }, { "title": "ORF8 contributes to cytokine storm during SARS-CoV-2 infection by activating IL-17 pathway.", "journal": "iScience", "date": "2021", "authors": "Lin X, Fu B, Yin S, Li Z, Liu H, Zhang H, Xing N, Wang Y, Xue W, Xiong Y, Zhang S, Zhao Q, Xu S, Zhang J, Wang P, Nian W, Wang X, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723527", "url": "https://glygen.org/publication/PubMed/33723527" } ] }, { "title": "ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity.", "journal": "Nature microbiology", "date": "2021", "authors": "Liu G, Lee JH, Parker ZM, Acharya D, Chiang JJ, van Gent M, Riedl W, Davis-Gardner ME, Wies E, Chiang C, Gack MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33727702", "url": "https://glygen.org/publication/PubMed/33727702" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Targets RIG-I-Like Receptor Pathways to Inhibit the Induction of Interferon Response.", "journal": "Cells", "date": "2021", "authors": "Oh SJ, Shin OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33801464", "url": "https://glygen.org/publication/PubMed/33801464" } ] }, { "title": "CNBP Binds and Unfolds In Vitro G-Quadruplexes Formed in the SARS-CoV-2 Positive and Negative Genome Strands.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Bezzi G, Piga EJ, Binolfi A, Armas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33807682", "url": "https://glygen.org/publication/PubMed/33807682" } ] }, { "title": "SARS-CoV-2 ORF6 Disrupts Bidirectional Nucleocytoplasmic Transport through Interactions with Rae1 and Nup98.", "journal": "mBio", "date": "2021", "authors": "Addetia A, Lieberman NAP, Phung Q, Hsiang TY, Xie H, Roychoudhury P, Shrestha L, Loprieno MA, Huang ML, Gale M Jr, Jerome KR, Greninger AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "title": "RNA-induced liquid phase separation of SARS-CoV-2 nucleocapsid protein facilitates NF-kappaB hyper-activation and inflammation.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Wu Y, Ma L, Cai S, Zhuang Z, Zhao Z, Jin S, Xie W, Zhou L, Zhang L, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33895773", "url": "https://glygen.org/publication/PubMed/33895773" } ] }, { "title": "TLR2 senses the SARS-CoV-2 envelope protein to produce inflammatory cytokines.", "journal": "Nature immunology", "date": "2021", "authors": "Zheng M, Karki R, Williams EP, Yang D, Fitzpatrick E, Vogel P, Jonsson CB, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33963333", "url": "https://glygen.org/publication/PubMed/33963333" } ] }, { "title": "The SARS-CoV-2 RNA interactome.", "journal": "Molecular cell", "date": "2021", "authors": "Lee S, Lee YS, Choi Y, Son A, Park Y, Lee KM, Kim J, Kim JS, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33989516", "url": "https://glygen.org/publication/PubMed/33989516" } ] }, { "title": "Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions.", "journal": "Nature communications", "date": "2021", "authors": "Gao X, Zhu K, Qin B, Olieric V, Wang M, Cui S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33990585", "url": "https://glygen.org/publication/PubMed/33990585" } ] }, { "title": "The ORF8 protein of SARS-CoV-2 mediates immune evasion through down-regulating MHC-Iota.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang Y, Chen Y, Li Y, Huang F, Luo B, Yuan Y, Xia B, Ma X, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Yan S, Wu L, Pan T, Zhang X, Li R, Huang W, He X, Xiao F, Zhang J, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34021074", "url": "https://glygen.org/publication/PubMed/34021074" } ] }, { "title": "Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Hsieh MH, Beirag N, Murugaiah V, Chou YC, Kuo WS, Kao HF, Madan T, Kishore U, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34054808", "url": "https://glygen.org/publication/PubMed/34054808" } ] }, { "title": "SARS-CoV-2 Membrane Protein Inhibits Type I Interferon Production Through Ubiquitin-Mediated Degradation of TBK1.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Sui L, Zhao Y, Wang W, Wu P, Wang Z, Yu Y, Hou Z, Tan G, Liu Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34084167", "url": "https://glygen.org/publication/PubMed/34084167" } ] }, { "title": "Conformational Dynamics in the Interaction of SARS-CoV-2 Papain-like Protease with Human Interferon-Stimulated Gene 15 Protein.", "journal": "The journal of physical chemistry letters", "date": "2021", "authors": "Leite WC, Weiss KL, Phillips G, Zhang Q, Qian S, Tsutakawa SE, Coates L, O'Neill H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34110168", "url": "https://glygen.org/publication/PubMed/34110168" } ] }, { "title": "SARS-CoV-2 viral proteins NSP1 and NSP13 inhibit interferon activation through distinct mechanisms.", "journal": "PloS one", "date": "2021", "authors": "Vazquez C, Swanson SE, Negatu SG, Dittmar M, Miller J, Ramage HR, Cherry S, Jurado KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34166398", "url": "https://glygen.org/publication/PubMed/34166398" } ] }, { "title": "HLA-E-restricted HIV-1-specific CD8+ T cell responses in natural infection.", "journal": "The Journal of clinical investigation", "date": "2021-08-16", "authors": "Bansal Anju, Gehre Mika N, Qin Kai, Sterrett Sarah, Ali Ayub, Dang Ying, Abraham Sojan, Costanzo Margaret C, Venegas Leon A, Tang Jianming, Manjunath N, Brockman Mark A, Yang Otto O, Kan-Mitchell June, Goepfert Paul A", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "34228645", "url": "https://glygen.org/publication/PubMed/34228645" } ] }, { "title": "Targeting liquid-liquid phase separation of SARS-CoV-2 nucleocapsid protein promotes innate antiviral immunity by elevating MAVS activity.", "journal": "Nature cell biology", "date": "2021", "authors": "Wang S, Dai T, Qin Z, Pan T, Chu F, Lou L, Zhang L, Yang B, Huang H, Lu H, Zhou F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34239064", "url": "https://glygen.org/publication/PubMed/34239064" } ] }, { "title": "Lectin Pathway Mediates Complement Activation by SARS-CoV-2 Proteins.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Ali YM, Ferrari M, Lynch NJ, Yaseen S, Dudler T, Gragerov S, Demopulos G, Heeney JL, Schwaeble WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34290717", "url": "https://glygen.org/publication/PubMed/34290717" } ] }, { "title": "SARS-CoV-2 N protein promotes NLRP3 inflammasome activation to induce hyperinflammation.", "journal": "Nature communications", "date": "2021", "authors": "Pan P, Shen M, Yu Z, Ge W, Chen K, Tian M, Xiao F, Wang Z, Wang J, Jia Y, Wang W, Wan P, Zhang J, Chen W, Lei Z, Chen X, Luo Z, Zhang Q, Xu M, Li G, Li Y, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34341353", "url": "https://glygen.org/publication/PubMed/34341353" } ] }, { "title": "SARS-CoV-2-associated ssRNAs activate inflammation and immunity via TLR7/8.", "journal": "JCI insight", "date": "2021", "authors": "Salvi V, Nguyen HO, Sozio F, Schioppa T, Gaudenzi C, Laffranchi M, Scapini P, Passari M, Barbazza I, Tiberio L, Tamassia N, Garlanda C, Del Prete A, Cassatella MA, Mantovani A, Sozzani S, Bosisio D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34375313", "url": "https://glygen.org/publication/PubMed/34375313" } ] }, { "title": "Molecular determinants for regulation of G3BP1/2 phase separation by the SARS-CoV-2 nucleocapsid protein.", "journal": "Cell discovery", "date": "2021", "authors": "Huang W, Ju X, Tian M, Li X, Yu Y, Sun Q, Ding Q, Jia D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34400613", "url": "https://glygen.org/publication/PubMed/34400613" } ] }, { "title": "Full-Length Recombinant hSP-D Binds and Inhibits SARS-CoV-2.", "journal": "Biomolecules", "date": "2021", "authors": "Arroyo R, Grant SN, Colombo M, Salvioni L, Corsi F, Truffi M, Ottolina D, Hurst B, Salzberg M, Prosperi D, Kingma PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34439781", "url": "https://glygen.org/publication/PubMed/34439781" } ] }, { "title": "SARS-CoV-2 N Protein Targets TRIM25-Mediated RIG-I Activation to Suppress Innate Immunity.", "journal": "Viruses", "date": "2021", "authors": "Gori Savellini G, Anichini G, Gandolfo C, Cusi MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34452305", "url": "https://glygen.org/publication/PubMed/34452305" } ] }, { "title": "A dual-role of SARS-CoV-2 nucleocapsid protein in regulating innate immune response.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao Y, Sui L, Wu P, Wang W, Wang Z, Yu Y, Hou Z, Tan G, Liu Q, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34471099", "url": "https://glygen.org/publication/PubMed/34471099" } ] }, { "title": "Phosphorylation of SARS-CoV-2 Orf9b Regulates Its Targeting to Two Binding Sites in TOM70 and Recruitment of Hsp90.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Brandherm L, Kobas AM, Klohn M, Bruggemann Y, Pfaender S, Rassow J, Kreimendahl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34502139", "url": "https://glygen.org/publication/PubMed/34502139" } ] }, { "title": "The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation.", "journal": "PLoS pathogens", "date": "2021", "authors": "Meyers JM, Ramanathan M, Shanderson RL, Beck A, Donohue L, Ferguson I, Guo MG, Rao DS, Miao W, Reynolds D, Yang X, Zhao Y, Yang YY, Blish C, Wang Y, Khavari PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34597346", "url": "https://glygen.org/publication/PubMed/34597346" } ] }, { "title": "Absence of polymorphism between HLA-B27 genomic exon sequences isolated from normal donors and ankylosing spondylitis patients.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Coppin HL, McDevitt HO", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "3489755", "url": "https://glygen.org/publication/PubMed/3489755" } ] }, { "title": "Binding of SARS-CoV-2 protein ORF9b to mitochondrial translocase TOM70 prevents its interaction with chaperone HSP90.", "journal": "Biochimie", "date": "2022-09", "authors": "Ayinde Kehinde S, Pinheiro Glaucia M S, Ramos Carlos H I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "35643212", "url": "https://glygen.org/publication/PubMed/35643212" } ] }, { "title": "Detection of the HLA-B*15:01:74 allele, an HLA-B*15 variant discovered in a Japanese individual.", "journal": "HLA", "date": "2022", "authors": "Khor Seik-Soon, Omae Yosuke, Tokunaga Katsushi", "evidence": [ { "database": "UniProtKB", "id": "D9J307", "url": "https://www.uniprot.org/uniprot/D9J307" } ], "reference": [ { "type": "PubMed", "id": "35644930", "url": "https://glygen.org/publication/PubMed/35644930" } ] }, { "title": "Structural mechanism of tapasin-mediated MHC-I peptide loading in antigen presentation.", "journal": "Nat. Commun.", "date": "2022", "authors": "Jiang Jiansheng, Taylor Daniel K, Kim Ellen J, Boyd Lisa F, Ahmad Javeed, Mage Michael G, Truong Hau V, Woodward Claire H, Sgourakis Nikolaos G, Cresswell Peter, Margulies David H, Natarajan Kannan", "evidence": [ { "database": "UniProtKB", "id": "D5H3J5", "url": "https://www.uniprot.org/uniprot/D5H3J5" } ], "reference": [ { "type": "PubMed", "id": "36115831", "url": "https://glygen.org/publication/PubMed/36115831" } ] }, { "title": "Parallel T Cell Immunogenic Regions in Influenza B and A Viruses with Distinct Nuclear Export Signal Functions: The Balance between Viral Life Cycle and Immune Escape.", "journal": "J. Immunol.", "date": "2023", "authors": "Zhao Yingze, Xiao Wenling, Wu Yanan, Fan Wenhui, Li Lei, Yue Can, Zhang Qingxu, Zhang Danni, Yuan Xiaoju, Yao Sijia, Liu Sai, Li Min, Wang Pengyan, Zhang Hangjie, Zhang Jie, Zhao Min, Zheng Xiaoqun, Liu Wenjun, Gao George F, Liu William J", "evidence": [ { "database": "UniProtKB", "id": "D9J307", "url": "https://www.uniprot.org/uniprot/D9J307" } ], "reference": [ { "type": "PubMed", "id": "36897229", "url": "https://glygen.org/publication/PubMed/36897229" } ] }, { "title": "HLA class I signal peptide polymorphism determines the level of CD94/NKG2-HLA-E-mediated regulation of effector cell responses.", "journal": "Nat. Immunol.", "date": "2023", "authors": "Lin Zhansong, Bashirova Arman A, Viard Mathias, Garner Lee, Quastel Max, Beiersdorfer Maya, Kasprzak Wojciech K, Akdag Marjan, Yuki Yuko, Ojeda Pedro, Das Sudipto, Andresson Thorkell, Naranbhai Vivek, Horowitz Amir, McMichael Andrew J, Hoelzemer Angelique, Gillespie Geraldine M, Garcia-Beltran Wilfredo F, Carrington Mary", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "37264229", "url": "https://glygen.org/publication/PubMed/37264229" } ] }, { "title": "Accurate identification of HLA-B*15:02 allele by two-dimensional polymerase chain reaction.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "2024-01-01", "authors": "Zhu Xueting, Yu Yang, Zhang Jun, Zhan Yuxia, Luo Guanghua, Zheng Lu", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ], "reference": [ { "type": "PubMed", "id": "37972805", "url": "https://glygen.org/publication/PubMed/37972805" } ] }, { "title": "HLA-B27 did not protect against COVID-19 in patients with axial spondyloarthritis - data from the ReumaCov-Brasil Registry.", "journal": "Advances in rheumatology (London, England)", "date": "2023-11-29", "authors": "Mota G D, Marques C L, Ribeiro S L, Albuquerque C, Castro G, Fernandino D, Omura F, Ranzolin A, Resende G, Silva N, Souza M, Studart S, Xavier R, Yazbek M, Pinheiro Marcelo M", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ], "reference": [ { "type": "PubMed", "id": "38031143", "url": "https://glygen.org/publication/PubMed/38031143" } ] }, { "title": "[Multi-sequence relation attention network for diagnosing HLA-B27-negative axial spondyloarthritis].", "journal": "Nan fang yi ke da xue xue bao = Journal of Southern Medical University", "date": "2023-11-20", "authors": "Zou Q, Wang M, Lu Z, Zhao Y, Feng Q", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ], "reference": [ { "type": "PubMed", "id": "38081615", "url": "https://glygen.org/publication/PubMed/38081615" } ] }, { "title": "The HLA-B*57:01 allele corresponds to a very large MHC haploblock likely explaining its massive effect for HIV-1 elite control.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Rahmouni Myriam, De Marco Lorenzo, Spadoni Jean-Louis, Tison Maxime, Medina-Santos Raissa, Labib Taoufik, Noirel Josselin, Tamouza Ryad, Limou Sophie, Delaneau Olivier, Fellay Jacques, Bensussan Armand, Le Clerc Sigrid, McLaren Paul J, Zagury Jean-Fran\u00e7ois", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ], "reference": [ { "type": "PubMed", "id": "38146367", "url": "https://glygen.org/publication/PubMed/38146367" } ] }, { "title": "[Genetic analysis of a Chinese pedigree with an allele dropout at the HLA-B locus].", "journal": "Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics", "date": "2024-01-10", "authors": "He Liumei, Quan Zhanrou, Zhong Yanping, Zou Hongyan", "evidence": [ { "database": "RefSeq", "id": "NP_005505", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005505" } ], "reference": [ { "type": "PubMed", "id": "38171559", "url": "https://glygen.org/publication/PubMed/38171559" } ] }, { "title": "Complete amino acid sequence of a papain-solubilized human histocompatibility antigen, HLA-B7. 2. Sequence determination and search for homologies.", "journal": "Biochemistry", "date": "1979", "authors": "Orr HT, Lopez de Castro JA, Lancet D, Strominger JL", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "518865", "url": "https://glygen.org/publication/PubMed/518865" } ] }, { "title": "Interferon action--sequence specificity of the ppp(A2'p)nA-dependent ribonuclease.", "journal": "Nature", "date": "1981", "authors": "Wreschner DH, McCauley JW, Skehel JJ, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6162102", "url": "https://glygen.org/publication/PubMed/6162102" } ] }, { "title": "HLA-A2 and HLA-B7 antigens are phosphorylated in vitro by rous sarcoma virus kinase (pp60v-src) at a tyrosine residue encoded in a highly conserved exon of the intracellular domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Guild BC, Erikson RL, Strominger JL", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" } ], "reference": [ { "type": "PubMed", "id": "6304688", "url": "https://glygen.org/publication/PubMed/6304688" } ] }, { "title": "Human and murine class I MHC antigens share conserved serine 335, the site of HLA phosphorylation in vivo.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Guild BC, Strominger JL", "evidence": [ { "database": "iPTMnet", "id": "P01889", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01889" } ], "reference": [ { "type": "PubMed", "id": "6430898", "url": "https://glygen.org/publication/PubMed/6430898" } ] }, { "title": "Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.", "journal": "Cell", "date": "1984", "authors": "Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "6548414", "url": "https://glygen.org/publication/PubMed/6548414" } ] }, { "title": "Interferon-associated, dsRNA-dependent enzyme activities in a mutant 3T6 cell engaged in the semiconstitutive synthesis of interferon.", "journal": "Cell", "date": "1978-08", "authors": "Jarvis A P, White C, Ball A, Gupta S L, Ratner L, Sen G C, Colby C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "688397", "url": "https://glygen.org/publication/PubMed/688397" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Igarashi K, Garotta G, Ozmen L, Ziemiecki A, Wilks AF, Harpur AG, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7514165", "url": "https://glygen.org/publication/PubMed/7514165" } ] }, { "title": "HLA-B67: a member of the HLA-B16 family that expresses the ME1 epitope.", "journal": "Tissue antigens", "date": "1994", "authors": "Little AM, Domena JD, Hildebrand WH, Shen SY, Barber LD, Marsh SG, Bias WB, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7517584", "url": "https://glygen.org/publication/PubMed/7517584" } ] }, { "title": "HLA-B73: an atypical HLA-B molecule carrying a Bw6-epitope motif variant and a B pocket identical to HLA-B27.", "journal": "Immunogenetics", "date": "1994", "authors": "Vilches C, de Pablo R, Herrero MJ, Moreno ME, Kreisler M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7517915", "url": "https://glygen.org/publication/PubMed/7517915" } ] }, { "title": "HLA-B15: a widespread and diverse family of HLA-B alleles.", "journal": "Tissue antigens", "date": "1994", "authors": "Hildebrand WH, Domena JD, Shen SY, Lau M, Terasaki PI, Bunce M, Marsh SG, Guttridge MG, Bias WB, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7521976", "url": "https://glygen.org/publication/PubMed/7521976" } ] }, { "title": "The HLA-B73 antigen has a most unusual structure that defines a second lineage of HLA-B alleles.", "journal": "Tissue antigens", "date": "1994", "authors": "Parham P, Arnett KL, Adams EJ, Barber LD, Domena JD, Stewart D, Hildebrand WH, Little AM", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7524186", "url": "https://glygen.org/publication/PubMed/7524186" } ] }, { "title": "Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7526154", "url": "https://glygen.org/publication/PubMed/7526154" } ] }, { "title": "Cytokine-induced expression of vascular cell adhesion molecule-1 (VCAM-1) by astrocytes and astrocytoma cell lines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Rosenman SJ, Shrikant P, Dubb L, Benveniste EN, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7530745", "url": "https://glygen.org/publication/PubMed/7530745" } ] }, { "title": "Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.", "journal": "Nature", "date": "1995", "authors": "Jones EY, Harlos K, Bottomley MJ, Robinson RC, Driscoll PC, Edwards RM, Clements JM, Dudgeon TJ, Stuart DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7531291", "url": "https://glygen.org/publication/PubMed/7531291" } ] }, { "title": "Tyrosine-phosphorylated Stat1 and Stat2 plus a 48-kDa protein all contact DNA in forming interferon-stimulated-gene factor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Qureshi SA, Salditt-Georgieff M, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7537377", "url": "https://glygen.org/publication/PubMed/7537377" } ] }, { "title": "Transcription factors in interferon signaling.", "journal": "Pharmacology & therapeutics", "date": "1995", "authors": "David M", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "7540766", "url": "https://glygen.org/publication/PubMed/7540766" } ] }, { "title": "CD1-restricted T cell recognition of microbial lipoglycan antigens.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Sieling PA, Chatterjee D, Porcelli SA, Prigozy TI, Mazzaccaro RJ, Soriano T, Bloom BR, Brenner MB, Kronenberg M, Brennan PJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7542404", "url": "https://glygen.org/publication/PubMed/7542404" } ] }, { "title": "Both HLA-B*1301 and B*1302 exist in Asian populations and are associated with different haplotypes.", "journal": "Human immunology", "date": "1995", "authors": "Lin L, Tokunaga K, Nakajima F, Ishikawa Y, Kashiwase K, Tanaka H, Kuwata S, Sideltseva EW, Akaza T, Tadokoro K, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7558929", "url": "https://glygen.org/publication/PubMed/7558929" } ] }, { "title": "The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Sakatsume M, Igarashi K, Winestock KD, Garotta G, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7615558", "url": "https://glygen.org/publication/PubMed/7615558" } ] }, { "title": "Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor.", "journal": "Nature", "date": "1995", "authors": "Walter MR, Windsor WT, Nagabhushan TL, Lundell DJ, Lunn CA, Zauodny PJ, Narula SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7617032", "url": "https://glygen.org/publication/PubMed/7617032" } ] }, { "title": "Calnexin influences folding of human class I histocompatibility proteins but not their assembly with beta 2-microglobulin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Tector M, Salter RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "7642652", "url": "https://glygen.org/publication/PubMed/7642652" } ] }, { "title": "Phosphorylation and activation of the DNA binding activity of purified Stat1 by the Janus protein-tyrosine kinases and the epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Quelle FW, Thierfelder W, Witthuhn BA, Tang B, Cohen S, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7657660", "url": "https://glygen.org/publication/PubMed/7657660" } ] }, { "title": "Interaction between the components of the interferon gamma receptor complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kotenko SV, Izotova LS, Pollack BP, Mariano TM, Donnelly RJ, Muthukumaran G, Cook JR, Garotta G, Silvennoinen O, Ihle JN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7673114", "url": "https://glygen.org/publication/PubMed/7673114" } ] }, { "title": "A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Shuai K, Stark GR, Kerr IM, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7690989", "url": "https://glygen.org/publication/PubMed/7690989" } ] }, { "title": "HLA-B16 antigens: sequence of the ST-16 antigen, further definition of two B38 subtypes and evidence for convergent evolution of B*3902.", "journal": "Tissue antigens", "date": "1995", "authors": "Adams EJ, Martinez-Naves E, Arnett KL, Little AM, Tyan DB, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7725307", "url": "https://glygen.org/publication/PubMed/7725307" } ] }, { "title": "Overlap in the repertoires of peptides bound in vivo by a group of related class I HLA-B allotypes.", "journal": "Current biology : CB", "date": "1995-02-01", "authors": "Barber L D, Gillece-Castro B, Percival L, Li X, Clayberger C, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "7743181", "url": "https://glygen.org/publication/PubMed/7743181" } ] }, { "title": "Stat recruitment by tyrosine-phosphorylated cytokine receptors: an ordered reversible affinity-driven process.", "journal": "Immunity", "date": "1995", "authors": "Greenlund AC, Morales MO, Viviano BL, Yan H, Krolewski J, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7796299", "url": "https://glygen.org/publication/PubMed/7796299" } ] }, { "title": "The molecular chaperone calnexin binds Glc1Man9GlcNAc2 oligosaccharide as an initial step in recognizing unfolded glycoproteins.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Ware FE, Vassilakos A, Peterson PA, Jackson MR, Lehrman MA, Williams DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "7876241", "url": "https://glygen.org/publication/PubMed/7876241" } ] }, { "title": "Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).", "journal": "The EMBO journal", "date": "1994", "authors": "Greenlund AC, Farrar MA, Viviano BL, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8156998", "url": "https://glygen.org/publication/PubMed/8156998" } ] }, { "title": "IFN-gamma up-regulates platelet-activating factor receptor gene expression in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Ouellet S, Muller E, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8176225", "url": "https://glygen.org/publication/PubMed/8176225" } ] }, { "title": "Gene for familial psoriasis susceptibility mapped to the distal end of human chromosome 17q.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Tomfohrde J, Silverman A, Barnes R, Fernandez-Vina MA, Young M, Lory D, Morris L, Wuepper KD, Stastny P, Menter A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8178173", "url": "https://glygen.org/publication/PubMed/8178173" } ] }, { "title": "Transcription factor ISGF-3 formation requires phosphorylated Stat91 protein, but Stat113 protein is phosphorylated independently of Stat91 protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Improta T, Schindler C, Horvath CM, Kerr IM, Stark GR, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8197134", "url": "https://glygen.org/publication/PubMed/8197134" } ] }, { "title": "The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.", "journal": "Nature", "date": "1993", "authors": "Muller M, Briscoe J, Laxton C, Guschin D, Ziemiecki A, Silvennoinen O, Harpur AG, Barbieri G, Witthuhn BA, Schindler C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8232552", "url": "https://glygen.org/publication/PubMed/8232552" } ] }, { "title": "Selective and ATP-dependent translocation of peptides by the MHC-encoded transporter.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Neefjes JJ, Momburg F, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "8342042", "url": "https://glygen.org/publication/PubMed/8342042" } ] }, { "title": "Primary structure shows HLA-B59 to be a hybrid of HLA-B55 and HLA-B51, and not a subtype of HLA-B8.", "journal": "Tissue antigens", "date": "1993", "authors": "Hildebrand WH, Domena JD, Parham P", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8362411", "url": "https://glygen.org/publication/PubMed/8362411" } ] }, { "title": "Molecular analysis of HLA-B39 subtypes.", "journal": "Immunogenetics", "date": "1993", "authors": "Kato N, Karaki S, Kashiwase K, Muller C, Akaza T, Juji T, Kano K, Takiguchi M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8420828", "url": "https://glygen.org/publication/PubMed/8420828" } ] }, { "title": "Allelic variations clustered in the antigen binding sites of HLA-Bw62 molecules.", "journal": "Immunogenetics", "date": "1993", "authors": "Choo SY, Fan LA, Hansen JA", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8423049", "url": "https://glygen.org/publication/PubMed/8423049" } ] }, { "title": "Interferon gamma-induced transcription of the high-affinity Fc receptor for IgG requires assembly of a complex that includes the 91-kDa subunit of transcription factor ISGF3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Pearse RN, Feinman R, Shuai K, Darnell JE Jr, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8483949", "url": "https://glygen.org/publication/PubMed/8483949" } ] }, { "title": "Transcriptional regulation of the human intercellular adhesion molecule-1 gene: a short overview.", "journal": "Immunobiology", "date": "1995", "authors": "Stratowa C, Audette M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8530158", "url": "https://glygen.org/publication/PubMed/8530158" } ] }, { "title": "Antigenic characteristics and cDNA sequences of HLA-B73.", "journal": "European journal of immunogenetics : official journal of the British Society for Histocompatibility and Immunogenetics", "date": "1995", "authors": "Hoffmann HJ, Kristensen TJ, Jensen TG, Graugaard B, Lamm LU", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8547229", "url": "https://glygen.org/publication/PubMed/8547229" } ] }, { "title": "Identification of an interferon-gamma receptor alpha chain sequence required for JAK-1 binding.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kaplan DH, Greenlund AC, Tanner JW, Shaw AS, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8550631", "url": "https://glygen.org/publication/PubMed/8550631" } ] }, { "title": "Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.", "journal": "The EMBO journal", "date": "1996", "authors": "Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8605876", "url": "https://glygen.org/publication/PubMed/8605876" } ] }, { "title": "Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li X, Leung S, Qureshi S, Darnell JE Jr, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8621447", "url": "https://glygen.org/publication/PubMed/8621447" } ] }, { "title": "Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.", "journal": "The EMBO journal", "date": "1996", "authors": "Briscoe J, Rogers NC, Witthuhn BA, Watling D, Harpur AG, Wilks AF, Stark GR, Ihle JN, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8631301", "url": "https://glygen.org/publication/PubMed/8631301" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gauzzi MC, Velazquez L, McKendry R, Mogensen KE, Fellous M, Pellegrini S", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "8702790", "url": "https://glygen.org/publication/PubMed/8702790" } ] }, { "title": "Novel HLA-B alleles, B*8201, B*3515 and B*5106, add to the complexity of serologic identification of HLA types.", "journal": "Tissue antigens", "date": "1996", "authors": "Hurley CK, Steiner N, Hoyer RJ, Menchaca E, Mitton W, Simonis T, Hartzman RJ, Johnson AH, Ng J", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8740766", "url": "https://glygen.org/publication/PubMed/8740766" } ] }, { "title": "Further molecular diversity in the HLA-B15 group.", "journal": "Tissue antigens", "date": "1996", "authors": "Lin L, Tokunaga K, Tanaka H, Nakajima F, Imanishi T, Kashiwase K, Bannai M, Mizuno S, Akaza T, Tadokoro K, Shibata Y, Juji T", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8773315", "url": "https://glygen.org/publication/PubMed/8773315" } ] }, { "title": "Three new HLA-B alleles found in Mexican-Americans.", "journal": "Tissue Antigens", "date": "1995", "authors": "Adams E J, Little A M, Arnett K L, McAuley J E, Williams R C, Parham P", "evidence": [ { "database": "UniProtKB", "id": "Q2L6G2", "url": "https://www.uniprot.org/uniprot/Q2L6G2" } ], "reference": [ { "type": "PubMed", "id": "8838356", "url": "https://glygen.org/publication/PubMed/8838356" } ] }, { "title": "Nucleotide sequence analysis of HLA-B*1523 and B*8101. Dominant alpha-helical motifs produce complex serologic recognition patterns for the HLA-B`DT` and HLA-B`NM5` antigens.", "journal": "Human immunology", "date": "1995", "authors": "Ellexson ME, Zhang G, Stewart D, Lau M, Teresi G, Terasaki P, Roe B, Hildebrand W", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8847228", "url": "https://glygen.org/publication/PubMed/8847228" } ] }, { "title": "Molecular characterization of the new alleles HLA-B*8101 and B*4407.", "journal": "Tissue antigens", "date": "1996", "authors": "Vilches C, Sanz L, de Pablo R, Moreno ME, Puente S, Kreisler M", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8851728", "url": "https://glygen.org/publication/PubMed/8851728" } ] }, { "title": "A p70 killer cell inhibitory receptor specific for several HLA-B allotypes discriminates among peptides bound to HLA-B*2705.", "journal": "The Journal of experimental medicine", "date": "1996-10-01", "authors": "Peruzzi M, Wagtmann N, Long E O", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "8879234", "url": "https://glygen.org/publication/PubMed/8879234" } ] }, { "title": "cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizuno T, Yoshihara Y, Inazawa J, Kagamiyama H, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8995416", "url": "https://glygen.org/publication/PubMed/8995416" } ] }, { "title": "Prominence of beta 2-microglobulin, class I heavy chain conformation, and tapasin in the interactions of class I heavy chain with calreticulin and the transporter associated with antigen processing.", "journal": "J. Immunol.", "date": "1997", "authors": "Solheim JC, Harris MR, Kindle CS, Hansen TH", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "9036970", "url": "https://glygen.org/publication/PubMed/9036970" } ] }, { "title": "A double-stranded RNA-activated protein kinase-dependent pathway mediating stress-induced apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Der SD, Yang YL, Weissmann C, Williams BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9096384", "url": "https://glygen.org/publication/PubMed/9096384" } ] }, { "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9111318", "url": "https://glygen.org/publication/PubMed/9111318" } ] }, { "title": "Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li X, Leung S, Kerr IM, Stark GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9121453", "url": "https://glygen.org/publication/PubMed/9121453" } ] }, { "title": "Cellular responses to interferon-gamma.", "journal": "Annual review of immunology", "date": "1997", "authors": "Boehm U, Klamp T, Groot M, Howard JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9143706", "url": "https://glygen.org/publication/PubMed/9143706" } ] }, { "title": "Nucleotide sequence analysis of the HLA class I region spanning the 237-kb segment around the HLA-B and -C genes.", "journal": "Genomics", "date": "1997", "authors": "Mizuki N, Ando H, Kimura M, Ohno S, Miyata S, Yamazaki M, Tashiro H, Watanabe K, Ono A, Taguchi S, Sugawara C, Fukuzumi Y, Okumura K, Goto K, Ishihara M, Nakamura S, Yonemoto J, Kikuti Y Y, Shiina T, Chen L, Ando A, Ikemura T, Inoko H", "evidence": [ { "database": "UniProtKB", "id": "Q5SS57", "url": "https://www.uniprot.org/uniprot/Q5SS57" } ], "reference": [ { "type": "PubMed", "id": "9177776", "url": "https://glygen.org/publication/PubMed/9177776" } ] }, { "title": "Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Martinez-Moczygemba M, Gutch MJ, French DL, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9242679", "url": "https://glygen.org/publication/PubMed/9242679" } ] }, { "title": "LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes.", "journal": "Immunity", "date": "1997", "authors": "Meyaard L, Adema GJ, Chang C, Woollatt E, Sutherland GR, Lanier LL, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9285412", "url": "https://glygen.org/publication/PubMed/9285412" } ] }, { "title": "p46, a novel natural killer cell-specific surface molecule that mediates cell activation.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Sivori S, Vitale M, Morelli L, Sanseverino L, Augugliaro R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9314561", "url": "https://glygen.org/publication/PubMed/9314561" } ] }, { "title": "A region of the beta subunit of the interferon alpha receptor different from box 1 interacts with Jak1 and is sufficient to activate the Jak-Stat pathway and induce an antiviral state.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Domanski P, Fish E, Nadeau OW, Witte M, Platanias LC, Yan H, Krolewski J, Pitha P, Colamonici OR", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9334213", "url": "https://glygen.org/publication/PubMed/9334213" } ] }, { "title": "Immunoreceptor DAP12 bearing a tyrosine-based activation motif is involved in activating NK cells.", "journal": "Nature", "date": "1998", "authors": "Lanier LL, Corliss BC, Wu J, Leong C, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "9490415", "url": "https://glygen.org/publication/PubMed/9490415" } ] }, { "title": "Calreticulin and calnexin interact with different protein and glycan determinants during the assembly of MHC class I.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Harris MR, Yu YY, Kindle CS, Hansen TH, Solheim JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170" } ], "reference": [ { "type": "PubMed", "id": "9605141", "url": "https://glygen.org/publication/PubMed/9605141" } ] }, { "title": "HLA-B27-restricted antigen presentation in the absence of tapasin reveals polymorphism in mechanisms of HLA class I peptide loading.", "journal": "Immunity", "date": "1998-05", "authors": "Peh C A, Burrows S R, Barnden M, Khanna R, Cresswell P, Moss D J, McCluskey J", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "reference": [ { "type": "PubMed", "id": "9620674", "url": "https://glygen.org/publication/PubMed/9620674" } ] }, { "title": "NKp44, a novel triggering surface molecule specifically expressed by activated natural killer cells, is involved in non-major histocompatibility complex-restricted tumor cell lysis.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Vitale M, Bottino C, Sivori S, Sanseverino L, Castriconi R, Marcenaro E, Augugliaro R, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "9625766", "url": "https://glygen.org/publication/PubMed/9625766" } ] }, { "title": "Association of DAP12 with activating CD94/NKG2C NK cell receptors.", "journal": "Immunity", "date": "1998", "authors": "Lanier LL, Corliss B, Wu J, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2172127", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127" } ], "reference": [ { "type": "PubMed", "id": "9655483", "url": "https://glygen.org/publication/PubMed/9655483" } ] }, { "title": "RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Martinand C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9660177", "url": "https://glygen.org/publication/PubMed/9660177" } ] }, { "title": "Structural specializations of immunoglobulin superfamily members for adhesion to integrins and viruses.", "journal": "Immunological reviews", "date": "1998", "authors": "Wang J, Springer TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9700512", "url": "https://glygen.org/publication/PubMed/9700512" } ] }, { "title": "Molecular cloning of NKp46: a novel member of the immunoglobulin superfamily involved in triggering of natural cytotoxicity.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Pessino A, Sivori S, Bottino C, Malaspina A, Morelli L, Moretta L, Biassoni R, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9730896", "url": "https://glygen.org/publication/PubMed/9730896" } ] }, { "title": "RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.", "journal": "Journal of virology", "date": "1999", "authors": "Martinand C, Montavon C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9847332", "url": "https://glygen.org/publication/PubMed/9847332" } ] }, { "title": "Identification of genes differentially regulated by interferon alpha, beta, or gamma using oligonucleotide arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Der SD, Zhou A, Williams BR, Silverman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-909733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733" } ], "reference": [ { "type": "PubMed", "id": "9861020", "url": "https://glygen.org/publication/PubMed/9861020" } ] } ], "pathway": [ { "id": "hsa:3106", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3106", "resource": "KEGG Pathway" }, { "id": "R-HSA-1236974", "name": "ER-Phagosome pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "description": "ER-Phagosome pathway" }, { "id": "R-HSA-1236977", "name": "Endosomal/Vacuolar pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236977", "resource": "Reactome", "description": "Endosomal/Vacuolar pathway" }, { "id": "R-HSA-198933", "name": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" }, { "id": "R-HSA-2172127", "name": "DAP12 interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2172127", "resource": "Reactome", "description": "DAP12 interactions" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-877300", "name": "Interferon gamma signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "resource": "Reactome", "description": "Interferon gamma signaling" }, { "id": "R-HSA-909733", "name": "Interferon alpha/beta signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-909733", "resource": "Reactome", "description": "Interferon alpha/beta signaling" }, { "id": "R-HSA-9705671", "name": "SARS-CoV-2 activates/modulates innate and adaptive immune responses", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "resource": "Reactome", "description": "SARS-CoV-2 activates/modulates innate and adaptive immune responses" }, { "id": "R-HSA-983170", "name": "Antigen Presentation: Folding, assembly and peptide loading of class I MHC", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983170", "resource": "Reactome", "description": "Antigen Presentation: Folding, assembly and peptide loading of class I MHC" } ], "orthologs": [ { "uniprot_canonical_ac": "A7VMS3-1", "protein_name": "MHC classIb protein M5", "gene_name": "H2-M5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRSPALSTLLSLLLTGALALTLVRAGIHSLQFFATTMTQPGLREHSFIFVVFVDDTQFLCYNNKGKNQRMEPRALWVKQMGPEYWEQQTRTVKVIEKIALVNLQEAMDIYNHSKDGSHVFQCVYGCEVGPDGLFLRGHEKHAYDGRDYLTLSPDLHSWVAGDTAAQITLRRWEKSGVSEQRQSFLKGECVESLRTYLEIGKETLLRTDPPKAHVTHHPRPEGEVTLRCWALGFYPANIILTWQWDEEDLTQDMDLIETRPAGDGTFQKWASVVVPSGEEQRYTCHVQHEGLTQPLVLKWDPSKHTIPIMGITVGLLLFGVVFTGAVVAIVMRKRKGFQIIILKTFLKG", "length": 348 }, "evidence": [ { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "F1MAR7-1", "protein_name": "RT1 class Ib, locus M5", "gene_name": "RT1-M5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSSVFSVLLPLLLSRAWALNQVGAGIHSLQFFATAVTQPSSREHSFIFVGFVDDTQFLCYNNQGESQRMEPRALWVKNMGPGYWERQTRMVKDISKNSLVNLREAMSVYNHSEDGTHVFQCVSGCDVGPDGLFLRGHEQHAYDGRDYLALNKDLHSWTAGDTAAQITRRKWEEAGVAEQRRTYLKGECVESLRTYLEIGKETLLGADPPKAHVTHHPSPEGDNTLRCWALGFYPSDITLTWQRDGEDLTQDMELVETRPGGDGTFQKWAAVVVPSGEEHRYTCCVEHEGLTEPLLLKWDPSKHTIPIMGITAGLVFLGVAFTGAVVAIAMRKQRGCRVLTPSKAHLERSDKYLTWT", "length": 357 }, "evidence": [ { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "F7CXU4-1", "protein_name": "Histocompatibility 2, M region locus 1", "gene_name": "H2-M1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKNFESQTLLLLLMITLAITKHPNGSHTLRYVYTLLSWPGPLEPQLIFLGYVDDTQIMGFNSISENLGVESRAPWMYETEEFWEKTTDNVVREHYILKEIMRSVLHIYNYSIIGYHTIQKTYGCQVMHRRYFSHGFFKLAFNLHDYITLNEDLKTWRGVGKAGEMLKEMWEKIKYANQVKSFLQITCVNLLHRFLAFGKKSLLRTDTPKIHMTHKIRPDRKTTLRCWAFNFYPPEITLTWQRDGSNQTQDMEMIETRPSGDGTFQKWAAVVVSTGEEHIYTCHVNHEGLSEPITIRWTKHEPPEPTIPFLAIVIALVLGALLMGAVMTFLIWKRRTRGKKGSWS", "length": 344 }, "evidence": [ { "id": "45918380", "url": "http://www.informatics.jax.org/homology/45918380", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "G3UXE9-1", "protein_name": "Predicted gene 8909", "gene_name": "H2-T26", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPRTLLLLLAAALILTETRAATEGPGRRSGSHREPPPGPHSMRYFTTAVSRPGPHSMRYFETAVSRPGLGEPWFISVGYVDDTQFVRFDGDAENPRMEPRAPWMEQEGPEYWERETQIAKGHEQGFQGSLRNLLHYYNQSAGGSHTFQRMYGCDLGSDGRLLRGYWQFAYDGSDYIALNQDLKTWTAADLAAQITRRRWEQGGVAETLRAYLEDPCLEWLRRYLELGKETLLRTDPPKVHVTHHPRSEDDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPRPSRDSNMVIIAVLVVLGVVIIIGAMVPFVLKSRRKIGGKEENYALAGGSNSVQGSALFLEAFSHPS", "length": 396 }, "evidence": [ { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O19441-1", "protein_name": "Histocompatibility 2, Q region locus 1", "gene_name": "H2-Q1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALGRLLLLLAAALTLTKTGAGSHSLRYFETSVSRPGFGKPRFISVGYVDDTQFVRFDSDAKNPRYEPRAPWMEQEGPEYWERNTRRVKGSEKRFQESLSTLLSYYNQSKGGIHTFQKLSGCDLGSDGRLQSGYLQFAYDGLDYIALNEDLETWTAADVAAQETRRKWEQAGAAEKHRTYLEGKCLMWLHRYLELGKEMLLRTDPPKAHVTHHPRSQGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPYTVSNMVIIAVLVVLGAVIVIGAVVIIGVMVSFVMKRRRNKGGQGEDCALAPSRDSAQSSDISLLDCKA", "length": 368 }, "evidence": [ { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O19442-1", "protein_name": "MHC class Ib antigen", "gene_name": "H2-M9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKNFESQPLLLLFMVTLVIAKHPNGSHTLRFVSTFLSWPRHLELQFIFLIYVDETQIMGFNSISESQRMESRVPWLNELNAEFWELATQDVLKEKSFVTGIMNKLLHIYNDSMTGYHIIQETYGCQVKQRTYFSHAFMELLFDTHDYITLNEDLQTWRAVGKAAEIVKEEWEKINLVKSSKSFLLGACVEGLLQYLNFGKKYLLRTDTPKIHMTYKIRPDRKITLRCWAFNFYPPEITLTWQRDGSNQTQDMEVIEIRPSGDGTFQKWAAVVVSSGEEHRYTCHVNHEGLSEPVTLRWDPPEPTIPFLPMIIALVLGALLMGSVMTFLIWKRRTRGKKGSWS", "length": 342 }, "evidence": [ { "id": "45918373", "url": "http://www.informatics.jax.org/homology/45918373", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O19443-1", "protein_name": "MHC class Ib antigen", "gene_name": "H2-M10.1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNTGPCTLLLLLMVALDLNHYCAGSHWLQTFNIVILEPGMLEPRFIQVSYVDSIQYQGFDSKDPSAGMQPRAAWIELEPPEYWEKETSRVLELSQVERQVLRLMVKKNGHKMDGYHTLQEVYGCNVANDGSFLGGHYRLTYYGYDYLTLNEDLSSWTAEGKGAQHAKSRWEDAGEAKRRKTYLQGECVQRLLRYLDLGKETLLCSDAPQTHVTHHVRPEGNVTLRCWALGFYPADITMTWKRDGNNLTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPPHTIPIIAILIGLVLGTLVVGTVVIFLVWRK", "length": 331 }, "evidence": [ { "id": "45918389", "url": "http://www.informatics.jax.org/homology/45918389", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01898-1", "protein_name": "H-2 class I histocompatibility antigen, Q10 alpha chain", "gene_name": "H2-Q10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGAMAPRTLLLLLAAALAPTQTQAGSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGSEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPSTDSIMSHIADLLWPSLKLWWYL", "length": 325 }, "evidence": [ { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P01901-1", "protein_name": "H-2 class I histocompatibility antigen, K-B alpha chain", "gene_name": "H2-K1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA", "length": 369 }, "evidence": [ { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV", "length": 365 }, "evidence": [ { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" }, { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" }, { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" }, { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" }, { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" }, { "id": "45918394", "url": "http://www.informatics.jax.org/homology/45918394", "database": "MGI" }, { "id": "45918392", "url": "http://www.informatics.jax.org/homology/45918392", "database": "MGI" }, { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" }, { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" }, { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA", "length": 366 }, "evidence": [ { "id": "45917228", "url": "http://www.informatics.jax.org/homology/45917228", "database": "MGI" }, { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" }, { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" }, { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" }, { "id": "45918380", "url": "http://www.informatics.jax.org/homology/45918380", "database": "MGI" }, { "id": "45918382", "url": "http://www.informatics.jax.org/homology/45918382", "database": "MGI" }, { "id": "45918383", "url": "http://www.informatics.jax.org/homology/45918383", "database": "MGI" }, { "id": "45918388", "url": "http://www.informatics.jax.org/homology/45918388", "database": "MGI" }, { "id": "45918389", "url": "http://www.informatics.jax.org/homology/45918389", "database": "MGI" }, { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" }, { "id": "45918367", "url": "http://www.informatics.jax.org/homology/45918367", "database": "MGI" }, { "id": "45918364", "url": "http://www.informatics.jax.org/homology/45918364", "database": "MGI" }, { "id": "45918368", "url": "http://www.informatics.jax.org/homology/45918368", "database": "MGI" }, { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" }, { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" }, { "id": "45918394", "url": "http://www.informatics.jax.org/homology/45918394", "database": "MGI" }, { "id": "45918393", "url": "http://www.informatics.jax.org/homology/45918393", "database": "MGI" }, { "id": "45918392", "url": "http://www.informatics.jax.org/homology/45918392", "database": "MGI" }, { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" }, { "id": "45918370", "url": "http://www.informatics.jax.org/homology/45918370", "database": "MGI" }, { "id": "45918373", "url": "http://www.informatics.jax.org/homology/45918373", "database": "MGI" }, { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" }, { "id": "45918375", "url": "http://www.informatics.jax.org/homology/45918375", "database": "MGI" }, { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" }, { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" }, { "id": "45917227", "url": "http://www.informatics.jax.org/homology/45917227", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL", "length": 358 }, "evidence": [ { "id": "45917228", "url": "http://www.informatics.jax.org/homology/45917228", "database": "MGI" }, { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" }, { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" }, { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" }, { "id": "45918380", "url": "http://www.informatics.jax.org/homology/45918380", "database": "MGI" }, { "id": "45918382", "url": "http://www.informatics.jax.org/homology/45918382", "database": "MGI" }, { "id": "45918383", "url": "http://www.informatics.jax.org/homology/45918383", "database": "MGI" }, { "id": "45918388", "url": "http://www.informatics.jax.org/homology/45918388", "database": "MGI" }, { "id": "45918389", "url": "http://www.informatics.jax.org/homology/45918389", "database": "MGI" }, { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" }, { "id": "45918367", "url": "http://www.informatics.jax.org/homology/45918367", "database": "MGI" }, { "id": "45918364", "url": "http://www.informatics.jax.org/homology/45918364", "database": "MGI" }, { "id": "45918368", "url": "http://www.informatics.jax.org/homology/45918368", "database": "MGI" }, { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" }, { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" }, { "id": "45918394", "url": "http://www.informatics.jax.org/homology/45918394", "database": "MGI" }, { "id": "45918393", "url": "http://www.informatics.jax.org/homology/45918393", "database": "MGI" }, { "id": "45918392", "url": "http://www.informatics.jax.org/homology/45918392", "database": "MGI" }, { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" }, { "id": "45918370", "url": "http://www.informatics.jax.org/homology/45918370", "database": "MGI" }, { "id": "45918373", "url": "http://www.informatics.jax.org/homology/45918373", "database": "MGI" }, { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" }, { "id": "45918375", "url": "http://www.informatics.jax.org/homology/45918375", "database": "MGI" }, { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" }, { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" }, { "id": "45917227", "url": "http://www.informatics.jax.org/homology/45917227", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P14427-1", "protein_name": "H-2 class I histocompatibility antigen, D-P alpha chain", "gene_name": "H2-D1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPRTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGKPRYMEVGYVDNTEFVRFDSDAENPRMKPRVRWMEQEGPEYWEQETQNAKDHEQSFRVSLRNLLGYYNQSKGGSHTIQGMRGCDVGSDWRLLRGYEQFAYDGPDYIALNEDLKTWTAADMAAQITRRKWEQAGAAETLRAYLEGACVEWLRRYLELGNATLLCTDPPKAHVTHHPRSEGKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAALVVPLGKEQNYTCHVEHEGLPEPLTLRWEPPPSTDSYMVIVAVLVVLGAVFIIGAVVAFVMMMRRNTGGKGGDYTLAPGSQSSEMSLRDCKVMVHDSHSLA", "length": 368 }, "evidence": [ { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P14429-1", "protein_name": "H-2 class I histocompatibility antigen, Q7 alpha chain", "gene_name": "H2-Q7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSDAENPRMEPRARWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMYGCDMGSDGRLLRGYLQFAYEGRDYIALNEDLKTWTAVDMAAQITRRKWEQAGIAEKDQAYLEGTCMQSLRRYLQLGKETLLRTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWGRWEPPPYTVSNMATIAVVVDLGAVAIIGAVVAFVMNRR", "length": 334 }, "evidence": [ { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P14432-1", "protein_name": "H-2 class I histocompatibility antigen, TLA(B) alpha chain", "gene_name": "H2-T3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRMGTPVPGTLLILLAASQGQTQTCPGSHSLRYFYTALSRPAISEPWYIAVGYLDDTQFVRFNSSGETATYKLSAPWVEQEGPEYWARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHTIQVMYGCEVEFFGSLFRAYEQHGYDGPDYIALNEDLKTWTAADTAAEITRSKWEQAGYTELRRTYLEGPCKDSLLRYLENRKKTQECTDPPKTHVTHHPRPEGYVTLRCWALRFYPADITLTWQLNGEELIQDTELVETRPAGDGTFQKWAAVVVPLGKEQKYTCHVYHEGLPEPLTLRWEPPQTSMPNRTTVRALLGAMIILGFMSGSVMMWMRKNNGGNGDDNTAAYQNEREHLSLDPRAESEALGVEAGMKDLPSAPPLVS", "length": 384 }, "evidence": [ { "id": "45918370", "url": "http://www.informatics.jax.org/homology/45918370", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD", "length": 338 }, "evidence": [ { "id": "45917228", "url": "http://www.informatics.jax.org/homology/45917228", "database": "MGI" }, { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" }, { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" }, { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" }, { "id": "45918382", "url": "http://www.informatics.jax.org/homology/45918382", "database": "MGI" }, { "id": "45918389", "url": "http://www.informatics.jax.org/homology/45918389", "database": "MGI" }, { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" }, { "id": "45918367", "url": "http://www.informatics.jax.org/homology/45918367", "database": "MGI" }, { "id": "45918364", "url": "http://www.informatics.jax.org/homology/45918364", "database": "MGI" }, { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" }, { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" }, { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" }, { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" }, { "id": "45918375", "url": "http://www.informatics.jax.org/homology/45918375", "database": "MGI" }, { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" }, { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV", "length": 346 }, "evidence": [ { "id": "45917228", "url": "http://www.informatics.jax.org/homology/45917228", "database": "MGI" }, { "id": "45918384", "url": "http://www.informatics.jax.org/homology/45918384", "database": "MGI" }, { "id": "45918385", "url": "http://www.informatics.jax.org/homology/45918385", "database": "MGI" }, { "id": "45918387", "url": "http://www.informatics.jax.org/homology/45918387", "database": "MGI" }, { "id": "45918382", "url": "http://www.informatics.jax.org/homology/45918382", "database": "MGI" }, { "id": "45918389", "url": "http://www.informatics.jax.org/homology/45918389", "database": "MGI" }, { "id": "45918366", "url": "http://www.informatics.jax.org/homology/45918366", "database": "MGI" }, { "id": "45918367", "url": "http://www.informatics.jax.org/homology/45918367", "database": "MGI" }, { "id": "45918364", "url": "http://www.informatics.jax.org/homology/45918364", "database": "MGI" }, { "id": "45918368", "url": "http://www.informatics.jax.org/homology/45918368", "database": "MGI" }, { "id": "45918369", "url": "http://www.informatics.jax.org/homology/45918369", "database": "MGI" }, { "id": "45918395", "url": "http://www.informatics.jax.org/homology/45918395", "database": "MGI" }, { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" }, { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" }, { "id": "45918375", "url": "http://www.informatics.jax.org/homology/45918375", "database": "MGI" }, { "id": "45918374", "url": "http://www.informatics.jax.org/homology/45918374", "database": "MGI" }, { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P79568-1", "protein_name": "Histocompatibility 2, Q region locus 6", "gene_name": "H2-Q6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALTTLLLLVAAALTLIETRAGPHSLRYFHTAVSWPGLVEPRFIIVGYVDNKQFVRFDSDAENPRMEPRARWMEQEGPEYWERETQKAKGHEESFRVSLRTAQRYYNQSKGGSHTLQWMYGCDVGSDERLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITLHKWEQAGIAERDRAYLEGACVQSLRRYLQLRKETLLCTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWEPPPSTVSNMANVAILVVLVAWPSLELWWIL", "length": 326 }, "evidence": [ { "id": "45918372", "url": "http://www.informatics.jax.org/homology/45918372", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q0WXH6-1", "protein_name": "MHC class Ib T9", "gene_name": "H2-T25", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGTLTSCPLLLLLLATALAPTRAGKSSHSLRYFATAMSRPGLGEPRFTAVGYVDDTQFMRFDSDSENPRAEPCKPWVEQMEPEYWEQETRKFKEHTQNFRTCLYNLLHLYNQSQDGPHTIQDMHGCYVGPDGQFLHGHYQHAYDGHDYITLNEDLSSWTAADAVAQITQHKWEEAGVAEEYKAYLEGTCVETLHRLLEEAQQHSDPPNTHVTRHPRPEGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPFGEEPRYTCHVYH", "length": 285 }, "evidence": [ { "id": "45918368", "url": "http://www.informatics.jax.org/homology/45918368", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q31615-1", "protein_name": "Histocompatibility 2, T region locus 22", "gene_name": "H2-T22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSWVLRAAVVCALLLQLDARPSWTRIPLGSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWEPAWYQKPWIWIVAMVFILFIICLCVVCICMKKNAGGRGRRDTQEAGRDSPQDSSKTVVDDEEMGVCFWKIKSCKTCLGHSPGTSVGESLLSP", "length": 379 }, "evidence": [ { "id": "45917228", "url": "http://www.informatics.jax.org/homology/45917228", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q4KN81-1", "protein_name": "Histocompatibility 2, Q region locus 2", "gene_name": "H2-Q2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALRRLLLLLVAALKLTETRAGSHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRAPWMEQEGPEYWERNTQVSKENEQSFRVSLGTALSYYNQSKGGSHTLQWLVGCDLGPDGSLLRGYEQSAYDGRDYLALNEDLITWTAADLAALKTRSKLEQAGLAEKRRAYLEVDCLTWLRRYLELGKETLLHTDPPKAHVTHHPSSQGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPSGDGTFQKWASVMVPFGEEPRYTCHVEHEGLPEPLTLRWEPPPSTDSYMVIIAVLVVLGAVIIIGAVVAFVMKRGRNTGGKVRDYAQDPGRDSPQSSDISLLEL", "length": 360 }, "evidence": [ { "id": "45918391", "url": "http://www.informatics.jax.org/homology/45918391", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6W9J5-1", "protein_name": "MHC class Ib antigen", "gene_name": "RT1-M2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "METSAILTLHLLLSASLALTQSFKGSHSLRYFDIAVSRPGLEETHYMTLGYVDDTEFVHFNNEAVNPRFEPRVPWMEQMGQKYWDDQTRIAKVAEQQIRVYFQKLRGYYNQSQNSSHTIQRMTGCYIGPDGHLLHAYRQFGYDGQDYLTLNEDLSTWTAADSAAEITHREWKATNEAEFWRVYLEGPCMVWLFKYLTVGNETLLRADPPKVYVTHHPRPEGDITLRCWALGFYPSDITLIWQRDGEDLTQDMDVIETRPAGDGTFQKWAAVVVPSGKEQNYTCYVEHEGLPEPLTLRWSRPPQSFIPTIVVAVGLVLLGASVVTLVIWKKSSGGGRGSLRFLSN", "length": 344 }, "evidence": [ { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6W9L1-1", "protein_name": "MHC class Ib antigen", "gene_name": "H2-M2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METSAFFTLLFTLYLLLGASLALAQTFKGSHSLRYFDIAVSRPGLEETHYMTVGYVDDTEFVHFDNEAENPRFEPRVPWMEQMGQKYWDDQTRIAKAAEQQIRVYFQKLRDYYNQSQNSSHTIQRMTGCYIGPDGHLLHAYRQFGYDGQDYLTLNEDLSTWTAADAAAEITRREWEATNVAEFWRVYLEGPCMVWLFKYLTVGNETLLRTEPPKAYVTHHPRPEGDVTLRCWALGFYPSDIIMIWQRDGEDQTQDMDVIETRPAGDGTFQKWVAVVVPSGKEQNYTCHVAHEGLPEPLTLRWSRPPQSFIFIIIVAVGLVLLGASVATLVMWKKSSGGERGSL", "length": 343 }, "evidence": [ { "id": "45918377", "url": "http://www.informatics.jax.org/homology/45918377", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q85ZW5-1", "protein_name": "Histocompatibility 2, M region locus 10.6", "gene_name": "H2-M10.6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRKPGPWDLLLLLMAIDLTQYCAGSHWLQIFNIVILEPGMLEARFIQVGYVDSIQFQGFDSKEPNARMQPRAAWMKQEPPEYWEKETAKALSFSLSGRRILKYMMSANKDKNNGYHTLQEVYGCNVANDGSFLEGHYRLTYYGYDSLILNEDLNSWTAEGEVGEKFKTYQEQGGMTESWRTYLLGECVERLLRCLDLGKKTLLHSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITMTWKRDGKNHTQDMELPDTRPAGDGTFQKWAAVVVPPGEELRYTCHVNHEGLPGPLTLKWEPPHTIPIIAILIGLVLGALVVGTVVIFLVWKN", "length": 330 }, "evidence": [ { "id": "45918364", "url": "http://www.informatics.jax.org/homology/45918364", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q85ZW6-1", "protein_name": "Histocompatibility 2, M region locus 10.3", "gene_name": "H2-M10.3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNPGCCTLLLLLVAMDLNQYCAGSHWLQTFNIAFLEPGMINSRFIHIGYVDSIQYQGFDSKEPMAILKPRAAWMEQELPKYWNVETTKILLLSQIERRILYFMIEKYEHRMNDYHTLQEVYGCNVATDGRFLHGHFRLTYYGYDYLTLNEDLSSWTAEGKGAEYMKNRWENMSEAERWKTYLRGECVQRLLRYLDLGKETLLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITLTWKRDGNNLTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPPQTIPIIAILIGLVLGTLVVGTVVIFLVWKK", "length": 330 }, "evidence": [ { "id": "45918383", "url": "http://www.informatics.jax.org/homology/45918383", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q85ZW7-1", "protein_name": "Histocompatibility 2, M region locus 10.5", "gene_name": "H2-M10.5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNPGCCTLLLLLVAMDLIQYCAGSHWLQTFNAVILEPGMVNSRFVHIGYVDSIEYQRYDSKEPIAVLLPRVAWMEQVPMTYWTSETASVAELSQLDRRILHFMVNKNEQRMDDYHTLQEVYGCNVANDGSFLGGHFRLTYYGYDDLYLNENLSSWIAHGNAAEYVKSRWDGEGDAERWKTYLQGVCVERLLRYMVLGKEALLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITMTWKRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHKGLPEPLKLKWEPPHTIPIIAILIGLVLGTLVVGTVVIFLVWKK", "length": 330 }, "evidence": [ { "id": "45918393", "url": "http://www.informatics.jax.org/homology/45918393", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q85ZW8-1", "protein_name": "Histocompatibility 2, M region locus 10.4", "gene_name": "H2-M10.4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRNPGHFAILCLLLVTIDRPQYCEGSHWLKTFRIVIMEPGILEPRFIQVSYVDSIQYQGFDSRSETAGMQPRAAWMKQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQEVFGCNVAHDGSFLGGHYGLTYYGYDYIILNEDLNSWTTEGKVGGKFNPDRTQGSVTEGWRTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVTPEGNVTLRCWALGFYPADITLTWKRDGKNHTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPLTLKWGPPQTIPIIAILIGLVLVALVVGTVVIFLVWRK", "length": 331 }, "evidence": [ { "id": "45918375", "url": "http://www.informatics.jax.org/homology/45918375", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q85ZW9-1", "protein_name": "Histocompatibility 2, M region locus 10.2", "gene_name": "H2-M10.2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNPGPCNFLLLLVALDLTQYCAGSHWLQTFNTVILKHGTLEPRIIQVGYVDSIQYQGFDSKEPTARMQPRAAWMEQEPPEYWEKETAQVLRLSLTNERLLRYMMIYNEQSNEEYHTLQEVFGCNVDNDGSFLGGLYRLTYYGYEFINLNEDLSSWTAQGEAAGFLKTDLVNVGAAEGWRTYLLGECTERLLRCLDLGKETLLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITLTWKRDGKNYTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPPQTIPIIAILIGLVLGTFLVGTVVVFLVWKK", "length": 329 }, "evidence": [ { "id": "45918367", "url": "http://www.informatics.jax.org/homology/45918367", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8HWB2-1", "protein_name": "Histocompatibility 2, Q region locus 4", "gene_name": "H2-Q4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASTMLLLLVAVAQTLIEIRAAPRPAPLPARSPAGGPGRSSGSHRALPPGPHLLSYFYTSVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGNEQIFRVNLRTLLSYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQFAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQAGATEKSKAYLEGACVQSLRRYLELGKETLLRTDPPKAHVTCHHRSDGDVTLRCWALGFYPANIILTWQLNGEELTQDMELVETRPSGDGTFQKWASVVVPLGKEQNYTCHVHHEGLPEPLTLRWEPPPSTVSNMANVAVLVVLGAWPSLQLWWLL", "length": 354 }, "evidence": [ { "id": "45918392", "url": "http://www.informatics.jax.org/homology/45918392", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 16, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "ER to Golgi transport vesicle membrane", "id": "GO:0012507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012507", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "phagocytic vesicle membrane", "id": "GO:0030670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030670", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "recycling endosome membrane", "id": "GO:0055038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055038", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "lumenal side of endoplasmic reticulum membrane", "id": "GO:0098553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098553", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "secretory granule membrane", "id": "GO:0030667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030667", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "MHC class I protein complex", "id": "GO:0042612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042612", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "antigen processing and presentation", "id": "GO:0019882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019882", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "antigen processing and presentation of endogenous peptide antigen via MHC class Ib", "id": "GO:0002476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002476", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "defense response", "id": "GO:0006952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006952", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent", "id": "GO:0002486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002486", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "detection of bacterium", "id": "GO:0016045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016045", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "protection from natural killer cell mediated cytotoxicity", "id": "GO:0042270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042270", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "regulation of T cell anergy", "id": "GO:0002667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002667", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "regulation of interleukin-12 production", "id": "GO:0032655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032655", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "regulation of interleukin-6 production", "id": "GO:0032675", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032675", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "regulation of dendritic cell differentiation", "id": "GO:2001198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001198", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "positive regulation of T cell mediated cytotoxicity", "id": "GO:0001916", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001916", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "peptide antigen binding", "id": "GO:0042605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042605", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" }, { "name": "TAP binding", "id": "GO:0046977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046977", "evidence": [ { "database": "UniProtKB", "id": "P01889", "url": "https://www.uniprot.org/uniprot/P01889" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "HLA class I histocompatibility antigen, B-7 alpha chain O-glycosylated 1 (human)", "definition": "An HLA class I histocompatibility antigen, B-7 alpha chain (human) that has been O-glycosylated at the residue equivalent to Thr-158 of the amino acid sequence represented by UniProtKB:P01889-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P01889-1, Thr-158, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000052473", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052473" } ] } ], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 110 ], "o_linked_sites": [ 158 ], "snv_sites": [ 33, 110, 112, 138, 158, 204, 335, 350, 357 ], "glycation_sites": [], "phosphorylation_sites": [ 123, 227, 344, 350, 359, 361 ], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 413 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }