{ "uniprot_canonical_ac": "P01877-2", "uniprot_ac": "P01877", "uniprot_id": "IGHA2_HUMAN", "mass": { "chemical_mass": 42334.0, "monoisotopic_mass": 42334.0 }, "refseq": {}, "gene_names": [ { "name": "IGHA2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01877", "id": "P01877" } ], "protein_names": [ { "name": "Immunoglobulin heavy constant alpha 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01877" }, { "name": "Ig alpha-2 chain C region BUT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01877" }, { "name": "Ig alpha-2 chain C region LAN", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01877" }, { "name": "Ig alpha-2 chain C region", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01877" } ], "function": [ { "annotation": "Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268). Ig alpha is the major immunoglobulin class in body secretions (PubMed:2241915).", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#function" }, { "database": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" }, { "database": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" }, { "database": "PubMed", "id": "2241915", "url": "https://glygen.org/publication/PubMed/2241915" }, { "database": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs781796008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781796008" }, { "id": "rs781796008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781796008" }, { "id": "rs781796008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781796008#frequency_tab" }, { "id": "rs781796008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781796008" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 133, "end_pos": 133, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLM).", "chr_id": "14", "chr_pos": "105587784", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T133", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781796008", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781796008" }, { "id": "rs781796008", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781796008" }, { "id": "rs781796008", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781796008#frequency_tab" }, { "id": "rs781796008", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781796008" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 133, "end_pos": 133, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLR).", "chr_id": "14", "chr_pos": "105587784", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T133", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555452936", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555452936" }, { "id": "rs1555452936", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555452936" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 141, "end_pos": 141, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "14", "chr_pos": "105587761", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782483239", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782483239" }, { "id": "rs782483239", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782483239" }, { "id": "rs782483239", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782483239#frequency_tab" }, { "id": "rs782483239", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782483239" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 14, "end_pos": 14, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "14", "chr_pos": "105588356", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D14", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782614117", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782614117" }, { "id": "rs782614117", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782614117" }, { "id": "rs782614117", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782614117" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 171, "end_pos": 171, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVS->NVS).", "chr_id": "14", "chr_pos": "105587670", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S171", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1245289134", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1245289134" }, { "id": "rs1245289134", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1245289134#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 188, "end_pos": 188, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TFT->NFT).", "chr_id": "14", "chr_pos": "105587619", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T188", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs558289293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs558289293" }, { "id": "rs558289293", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs558289293" }, { "id": "rs558289293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs558289293" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 205, "end_pos": 205, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->TIT).", "chr_id": "14", "chr_pos": "105587568", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N205", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555453155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555453155" }, { "id": "rs1555453155", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555453155" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 42, "end_pos": 42, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SES->NES).", "chr_id": "14", "chr_pos": "105588271", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S42", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781877710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781877710" }, { "id": "rs781877710", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781877710" }, { "id": "rs781877710", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781877710#frequency_tab" }, { "id": "rs781877710", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781877710" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 47, "end_pos": 47, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->DVT).", "chr_id": "14", "chr_pos": "105588257", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N47", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782791977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782791977" }, { "id": "rs782791977", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782791977" }, { "id": "rs782791977", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs782791977#frequency_tab" }, { "id": "rs782791977", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782791977" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 47, "end_pos": 47, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).", "chr_id": "14", "chr_pos": "105588256", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N47", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs782407114", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782407114" }, { "id": "rs782407114", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs782407114" }, { "id": "rs782407114", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs782407114" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 49, "end_pos": 49, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->NVI).", "chr_id": "14", "chr_pos": "105588250", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T49", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61984162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61984162" }, { "id": "rs61984162", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61984162" }, { "id": "rs61984162", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61984162" }, { "id": "rs61984162", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61984162#frequency_tab" }, { "id": "rs61984162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61984162" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 93, "end_pos": 93, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NPS).", "chr_id": "14", "chr_pos": "105588119", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.3572", "site_lbl": "S93", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1457550537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457550537" }, { "id": "rs1457550537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1457550537#frequency_tab" }, { "id": "rs1457550537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457550537" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 94, "end_pos": 94, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSR).", "chr_id": "14", "chr_pos": "105588114", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S94", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "83.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "80.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.55", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "75.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "84.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "83.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01877", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01877" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "common_name": "Human" } ], "gene": [ { "name": "IGHA2", "url": "https://www.uniprot.org/uniprot/P01877", "locus": { "chromosome": "HSCHR14_3_CTG1", "start_pos": 55245, "end_pos": 56751, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000276173", "url": "https://www.ensembl.org/id/ENSG00000276173" } ] } } ], "crossref": [ { "id": "ENSG00000211890", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211890", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04986", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04986", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05768", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05768", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IGHA2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHA2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "5479", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5479", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01877", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01877*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "147000", "url": "http://www.omim.org/entry/147000", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01877", "url": "https://www.nextprot.org/entry/NX_P01877", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QGDNFSC", "url": "https://omabrowser.org/oma/group/QGDNFSC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23411", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23411", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23411:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23411:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3CM9", "url": "https://www.rcsb.org/structure/3CM9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UE8", "url": "https://www.rcsb.org/structure/6UE8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UE9", "url": "https://www.rcsb.org/structure/6UE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UEA", "url": "https://www.rcsb.org/structure/6UEA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00047", "url": "http://pfam.xfam.org/family/PF00047", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07654", "url": "http://pfam.xfam.org/family/PF07654", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01877", "url": "https://pharos.nih.gov/targets/P01877", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000052413", "url": "https://proconsortium.org/app/entry/PR:000052413", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052414", "url": "https://proconsortium.org/app/entry/PR:000052414", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052415", "url": "https://proconsortium.org/app/entry/PR:000052415", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052416", "url": "https://proconsortium.org/app/entry/PR:000052416", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052417", "url": "https://proconsortium.org/app/entry/PR:000052417", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052418", "url": "https://proconsortium.org/app/entry/PR:000052418", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052419", "url": "https://proconsortium.org/app/entry/PR:000052419", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052420", "url": "https://proconsortium.org/app/entry/PR:000052420", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052421", "url": "https://proconsortium.org/app/entry/PR:000052421", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052422", "url": "https://proconsortium.org/app/entry/PR:000052422", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052423", "url": "https://proconsortium.org/app/entry/PR:000052423", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052424", "url": "https://proconsortium.org/app/entry/PR:000052424", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052425", "url": "https://proconsortium.org/app/entry/PR:000052425", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052426", "url": "https://proconsortium.org/app/entry/PR:000052426", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052427", "url": "https://proconsortium.org/app/entry/PR:000052427", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052428", "url": "https://proconsortium.org/app/entry/PR:000052428", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052429", "url": "https://proconsortium.org/app/entry/PR:000052429", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052430", "url": "https://proconsortium.org/app/entry/PR:000052430", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052431", "url": "https://proconsortium.org/app/entry/PR:000052431", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052432", "url": "https://proconsortium.org/app/entry/PR:000052432", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052433", "url": "https://proconsortium.org/app/entry/PR:000052433", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052434", "url": "https://proconsortium.org/app/entry/PR:000052434", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052435", "url": "https://proconsortium.org/app/entry/PR:000052435", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052436", "url": "https://proconsortium.org/app/entry/PR:000052436", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052437", "url": "https://proconsortium.org/app/entry/PR:000052437", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052438", "url": "https://proconsortium.org/app/entry/PR:000052438", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052439", "url": "https://proconsortium.org/app/entry/PR:000052439", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052440", "url": "https://proconsortium.org/app/entry/PR:000052440", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052441", "url": "https://proconsortium.org/app/entry/PR:000052441", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052442", "url": "https://proconsortium.org/app/entry/PR:000052442", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052443", "url": "https://proconsortium.org/app/entry/PR:000052443", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052444", "url": "https://proconsortium.org/app/entry/PR:000052444", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052445", "url": "https://proconsortium.org/app/entry/PR:000052445", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052446", "url": "https://proconsortium.org/app/entry/PR:000052446", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052447", "url": "https://proconsortium.org/app/entry/PR:000052447", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052448", "url": "https://proconsortium.org/app/entry/PR:000052448", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052449", "url": "https://proconsortium.org/app/entry/PR:000052449", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052450", "url": "https://proconsortium.org/app/entry/PR:000052450", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052451", "url": "https://proconsortium.org/app/entry/PR:000052451", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052452", "url": "https://proconsortium.org/app/entry/PR:000052452", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052453", "url": "https://proconsortium.org/app/entry/PR:000052453", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052454", "url": "https://proconsortium.org/app/entry/PR:000052454", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052455", "url": "https://proconsortium.org/app/entry/PR:000052455", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052456", "url": "https://proconsortium.org/app/entry/PR:000052456", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052457", "url": "https://proconsortium.org/app/entry/PR:000052457", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052458", "url": "https://proconsortium.org/app/entry/PR:000052458", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052459", "url": "https://proconsortium.org/app/entry/PR:000052459", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052460", "url": "https://proconsortium.org/app/entry/PR:000052460", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052461", "url": "https://proconsortium.org/app/entry/PR:000052461", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052462", "url": "https://proconsortium.org/app/entry/PR:000052462", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052463", "url": "https://proconsortium.org/app/entry/PR:000052463", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052464", "url": "https://proconsortium.org/app/entry/PR:000052464", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052465", "url": "https://proconsortium.org/app/entry/PR:000052465", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052466", "url": "https://proconsortium.org/app/entry/PR:000052466", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052467", "url": "https://proconsortium.org/app/entry/PR:000052467", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052468", "url": "https://proconsortium.org/app/entry/PR:000052468", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052469", "url": "https://proconsortium.org/app/entry/PR:000052469", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01877", "url": "http://purl.obolibrary.org/obo/PR_P01877", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "P01877", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01877-1", "url": "https://www.uniprot.org/uniprot/P01877-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01877-2", "url": "https://www.uniprot.org/uniprot/P01877-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSCMVGHEALPLAFTQKTIDRMAGSCCVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGKREGPQY", "length": 391, "header": "sp|P01877-2|IGHA2_HUMAN Isoform 2 of Immunoglobulin heavy constant alpha 2 OS=Homo sapiens OX=9606 GN=IGHA2 PE=1 SV=5 CANONICAL=P01877-2" }, "isoforms": [ { "isoform_ac": "P01877-1", "url": "", "sequence": { "sequence": "ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSCMVGHEALPLAFTQKTIDRMAGKPTHINVSVVMAEADGTCY", "length": 340, "header": "sp|P01877-1|IGHA2_HUMAN Isoform 1 of Immunoglobulin heavy constant alpha 2 OS=Homo sapiens OX=9606 GN=IGHA2 PE=1 SV=5 CANONICAL=P01877-2" }, "locus": { "chromosome": "14", "start_pos": 105588395, "end_pos": 105586940, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000390539.2", "url": "https://www.ensembl.org/id/ENST00000390539.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000374981.2", "url": "https://www.ensembl.org/id/ENSP00000374981.2" } ] } }, { "isoform_ac": "P01877-2", "url": "", "sequence": { "sequence": "ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSCMVGHEALPLAFTQKTIDRMAGSCCVADWQMPPPYVVLDLPQETLEEETPGANLWPTTITFLTLFLLSLFYSTALTVTSVRGPSGKREGPQY", "length": 391, "header": "sp|P01877-2|IGHA2_HUMAN Isoform 2 of Immunoglobulin heavy constant alpha 2 OS=Homo sapiens OX=9606 GN=IGHA2 PE=1 SV=5 CANONICAL=P01877-2" }, "locus": { "chromosome": "14", "start_pos": 105588395, "end_pos": 105584157, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000497872.4", "url": "https://www.ensembl.org/id/ENST00000497872.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000493086.1", "url": "https://www.ensembl.org/id/ENSP00000493086.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56284ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P01877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05850WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06853GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G14440NQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G49018RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G54845IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G61613II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G61627IG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G64275UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G65219TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G76613WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G86226EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24841998" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ] }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "glytoucan_ac": "G92129PT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" } ] }, { "glytoucan_ac": "G93683YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "P01877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15084671" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G18878GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G62595EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01877@N47", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N47" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G85582CB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P01877@N47", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N47" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "24766575", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877@N47", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N47" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "P01877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "30659065", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P01877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G04576KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G04791QM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G05850WN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G06209KS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G07392QY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G11535IB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G11637WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G12398HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G16276PY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G25140TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G33780DA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G41860WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" } ] }, { "glytoucan_ac": "G41917DR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G47681UP", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G50779LX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G52706RS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "4172099", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4172099" } ] }, { "glytoucan_ac": "G52880ZN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G55052CN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G59471TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G61334IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G64327YL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G65219TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G66665YI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G66937TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G71013KY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G72718TT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G81413UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G84852GW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G85767HW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G90725ZC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17050773" }, { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "2967", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2967" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ] }, { "glytoucan_ac": "G92129PT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20030399" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "The binding and transport of heme by hemopexin.", "journal": "Annals of clinical research", "date": "1976", "authors": "Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1008494", "url": "https://glygen.org/publication/PubMed/1008494" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "Identification of the haemoglobin scavenger receptor.", "journal": "Nature", "date": "2001", "authors": "Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11196644", "url": "https://glygen.org/publication/PubMed/11196644" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Nomenclature of the human immunoglobulin heavy (IGH) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "11340299", "url": "https://glygen.org/publication/PubMed/11340299" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties.", "journal": "Blood", "date": "2002", "authors": "Allhorn M, Berggard T, Nordberg J, Olsson ML, Akerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11877257", "url": "https://glygen.org/publication/PubMed/11877257" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "Kinetics of deoxyhemoglobin subunit dissociation determined by haptoglobin binding: estimation of the equilibrium constant from forward and reverse rates.", "journal": "Biochemistry", "date": "1976", "authors": "Ip SH, Johnson ML, Ackers GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1252417", "url": "https://glygen.org/publication/PubMed/1252417" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "[Isolation of the haptoglobin-hemoglobin complex in human blood in homogenous state. II].", "journal": "Bulletin de la Societe de chimie biologique", "date": "1956", "authors": "JAYLE MF, BOUSSIER G, TONNELAT J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13342742", "url": "https://glygen.org/publication/PubMed/13342742" } ] }, { "title": "The binding of haemoglobin by plasma proteins (haptoglobins); its bearing on the renal threshold for haemoglobin and the aetiology of haemoglobinuria.", "journal": "British medical journal", "date": "1957", "authors": "ALLISON AC, REES WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13472068", "url": "https://glygen.org/publication/PubMed/13472068" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "A proteomic analysis of human bile.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "15084671", "url": "https://glygen.org/publication/PubMed/15084671" } ] }, { "title": "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Madsen M, Moller HJ, Nielsen MJ, Jacobsen C, Graversen JH, van den Berg T, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15448162", "url": "https://glygen.org/publication/PubMed/15448162" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "The lipocalin alpha(1)-microglobulin binds heme in different species.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "Larsson J, Allhorn M, Kerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15542058", "url": "https://glygen.org/publication/PubMed/15542058" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "pH- and metal ion-linked stability of the hemopexin-heme complex.", "journal": "Biochemistry", "date": "2005", "authors": "Rosell FI, Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15697213", "url": "https://glygen.org/publication/PubMed/15697213" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Identification of the receptor scavenging hemopexin-heme complexes.", "journal": "Blood", "date": "2005", "authors": "Hvidberg V, Maniecki MB, Jacobsen C, Hojrup P, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15947085", "url": "https://glygen.org/publication/PubMed/15947085" } ] }, { "title": "Human high density lipoproteins are platforms for the assembly of multi-component innate immune complexes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shiflett AM, Bishop JR, Pahwa A, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16046400", "url": "https://glygen.org/publication/PubMed/16046400" } ] }, { "title": "CD163 is the macrophage scavenger receptor for native and chemically modified hemoglobins in the absence of haptoglobin.", "journal": "Blood", "date": "2006", "authors": "Schaer DJ, Schaer CA, Buehler PW, Boykins RA, Schoedon G, Alayash AI, Schaffner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16189277", "url": "https://glygen.org/publication/PubMed/16189277" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "The murine haemopexin receptor. Evidence that the haemopexin-binding site resides on a 20 kDa subunit and that receptor recycling is regulated by protein kinase C.", "journal": "The Biochemical journal", "date": "1991", "authors": "Smith A, Farooqui SM, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1646599", "url": "https://glygen.org/publication/PubMed/1646599" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein.", "journal": "Blood", "date": "2006", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Oxvig C, Rees D, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16778136", "url": "https://glygen.org/publication/PubMed/16778136" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "Constitutive endocytosis of CD163 mediates hemoglobin-heme uptake and determines the noninflammatory and protective transcriptional response of macrophages to hemoglobin.", "journal": "Circulation research", "date": "2006", "authors": "Schaer CA, Schoedon G, Imhof A, Kurrer MO, Schaer DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17008602", "url": "https://glygen.org/publication/PubMed/17008602" } ] }, { "title": "Differential glycosylation of polymeric and monomeric IgA: a possible role in glomerular inflammation in IgA nephropathy.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2006", "authors": "Oortwijn BD, Roos A, Royle L, van Gijlswijk-Janssen DJ, Faber-Krol MC, Eijgenraam JW, Dwek RA, Daha MR, Rudd PM, van Kooten C", "evidence": [ { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "reference": [ { "type": "PubMed", "id": "17050773", "url": "https://glygen.org/publication/PubMed/17050773" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "A unique loop extension in the serine protease domain of haptoglobin is essential for CD163 recognition of the haptoglobin-hemoglobin complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Thirup S, Enghild JJ, Graversen JH, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17102136", "url": "https://glygen.org/publication/PubMed/17102136" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "Immunoglobulin somatic hypermutation.", "journal": "Annual review of genetics", "date": "2007", "authors": "Teng Grace, Papavasiliou F Nina", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "Hemoglobin is a co-factor of human trypanosome lytic factor.", "journal": "PLoS pathogens", "date": "2007", "authors": "Widener J, Nielsen MJ, Shiflett A, Moestrup SK, Hajduk S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17845074", "url": "https://glygen.org/publication/PubMed/17845074" } ] }, { "title": "Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry.", "journal": "Journal of chromatography. B, Analytical technologies in the biomedical and life sciences", "date": "2008", "authors": "Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "18514042", "url": "https://glygen.org/publication/PubMed/18514042" } ] }, { "title": "Hemopexin prevents endothelial damage and liver congestion in a mouse model of heme overload.", "journal": "The American journal of pathology", "date": "2008", "authors": "Vinchi F, Gastaldi S, Silengo L, Altruda F, Tolosano E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "18556779", "url": "https://glygen.org/publication/PubMed/18556779" } ] }, { "title": "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.", "journal": "Proteomics", "date": "2008", "authors": "Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "18780401", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877#ptm_processing" }, { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Harrington JM, Howell S, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19324878", "url": "https://glygen.org/publication/PubMed/19324878" } ] }, { "title": "Heme scavenging and the other facets of hemopexin.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Tolosano E, Fagoonee S, Morello N, Vinchi F, Fiorito V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19650691", "url": "https://glygen.org/publication/PubMed/19650691" } ] }, { "title": "Gene segments encoding membrane domains of the human immunoglobulin gamma 3 and alpha chains.", "journal": "Immunogenetics", "date": "1990", "authors": "Bensmana M, Lefranc M P", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "1979064", "url": "https://glygen.org/publication/PubMed/1979064" } ] }, { "title": "GlycoSpectrumScan: fishing glycopeptides from MS spectra of protease digests of human colostrum sIgA.", "journal": "Journal of proteome research", "date": "2010", "authors": "Deshpande N, Jensen PH, Packer NH, Kolarich D", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "reference": [ { "type": "PubMed", "id": "20030399", "url": "https://glygen.org/publication/PubMed/20030399" } ] }, { "title": "Structure and function of immunoglobulins.", "journal": "The Journal of allergy and clinical immunology", "date": "2010-02", "authors": "Schroeder Harry W, Cavacini Lisa", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" } ] }, { "title": "Metal ions and electrolytes regulate the dissociation of heme from human hemopexin at physiological pH.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20430887", "url": "https://glygen.org/publication/PubMed/20430887" } ] }, { "title": "Signaling through LRP1: Protection from atherosclerosis and beyond.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Boucher P, Herz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20920479", "url": "https://glygen.org/publication/PubMed/20920479" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "Molecular programming of B cell memory.", "journal": "Nature reviews. Immunology", "date": "2011-12-09", "authors": "McHeyzer-Williams Michael, Okitsu Shinji, Wang Nathaniel, McHeyzer-Williams Louise", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" } ] }, { "title": "The structure and function of human IgA.", "journal": "The Biochemical journal", "date": "1990-10-15", "authors": "Kerr M A", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "2241915", "url": "https://glygen.org/publication/PubMed/2241915" } ] }, { "title": "Insertion of heme b into the structure of the Cys34-carbamidomethylated human lipocalin alpha(1)-microglobulin: formation of a [(heme)(2) (alpha(1)-Microglobulin)](3) complex.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2012", "authors": "Siebel JF, Kosinsky RL, Akerstrom B, Knipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22492620", "url": "https://glygen.org/publication/PubMed/22492620" } ] }, { "title": "Structure of the haptoglobin-haemoglobin complex.", "journal": "Nature", "date": "2012", "authors": "Andersen CB, Torvund-Jensen M, Nielsen MJ, de Oliveira CL, Hersleth HP, Andersen NH, Pedersen JS, Andersen GR, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22922649", "url": "https://glygen.org/publication/PubMed/22922649" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis.", "journal": "Journal of proteome research", "date": "2014", "authors": "Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P", "evidence": [ { "database": "UniCarbKB", "id": "P01877", "url": "" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "24766575", "url": "https://glygen.org/publication/PubMed/24766575" } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P01877", "url": "" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "24841998", "url": "https://glygen.org/publication/PubMed/24841998" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins.", "journal": "Journal of proteome research", "date": "2015", "authors": "Hong Q, Ruhaak LR, Stroble C, Parker E, Huang J, Maverakis E, Lebrilla CB", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "26510530", "url": "https://glygen.org/publication/PubMed/26510530" } ] }, { "title": "Serum proteins as mediators of hemin efflux from red cell membranes: specificity of hemopexin.", "journal": "FEBS letters", "date": "1989", "authors": "Solar I, Muller-Eberhard U, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2806549", "url": "https://glygen.org/publication/PubMed/2806549" } ] }, { "title": "Importance of ligand-induced conformational changes in hemopexin for receptor-mediated heme transport.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Smith A, Tatum FM, Muster P, Burch MK, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2833500", "url": "https://glygen.org/publication/PubMed/2833500" } ] }, { "title": "Structure of the A2m(1) allotype of human IgA--a recombinant molecule.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Tsuzukida Y, Wang CC, Putnam FW", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "286295", "url": "https://glygen.org/publication/PubMed/286295" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P01877", "url": "" }, { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Multi-isotype Glycoproteomic Characterization of Serum Antibody Heavy Chains Reveals Isotype- and Subclass-Specific N-Glycosylation Profiles.", "journal": "Molecular & cellular proteomics : MCP", "date": "2019", "authors": "Chandler KB, Mehta N, Leon DR, Suscovich TJ, Alter G, Costello CE", "evidence": [ { "database": "UniCarbKB", "id": "P01877", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30659065", "url": "https://glygen.org/publication/PubMed/30659065" } ] }, { "title": "Structure of the secretory immunoglobulin A core.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Kumar N, Arthur CP, Ciferri C, Matsumoto ML", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "32029686", "url": "https://glygen.org/publication/PubMed/32029686" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis.", "journal": "Nature methods", "date": "2021", "authors": "Kawahara R, Chernykh A, Alagesan K, Bern M, Cao W, Chalkley RJ, Cheng K, Choo MS, Edwards N, Goldman R, Hoffmann M, Hu Y, Huang Y, Kim JY, Kletter D, Liquet B, Liu M, Mechref Y, Meng B, Neelamegham S, Nguyen-Khuong T, Nilsson J, Pap A, Park GW, Parker BL, Pegg CL, Penninger JM, Phung TK, Pioch M, Rapp E, Sakalli E, Sanda M, Schulz BL, Scott NE, Sofronov G, Stadlmann J, Vakhrushev SY, Woo CM, Wu HY, Yang P, Ying W, Zhang H, Zhang Y, Zhao J, Zaia J, Haslam SM, Palmisano G, Yoo JS, Larson G, Khoo KH, Medzihradszky KF, Kolarich D, Packer NH, Thaysen-Andersen M", "evidence": [ { "database": "GlyConnect", "id": "647", "url": "https://glyconnect.expasy.org/browser/proteins/647" } ], "reference": [ { "type": "PubMed", "id": "34725484", "url": "https://glygen.org/publication/PubMed/34725484" } ] }, { "title": "Hemopexin-mediated heme transport to the liver. Evidence for a heme-binding protein in liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "3891754", "url": "https://glygen.org/publication/PubMed/3891754" } ] }, { "title": "Kinetics of hemoprotein reduction and interprotein heme transfer.", "journal": "Biochemistry", "date": "1985", "authors": "Pasternack RF, Gibbs EJ, Mauk AG, Reid LS, Wong NM, Kurokawa K, Hashim M, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4074707", "url": "https://glygen.org/publication/PubMed/4074707" } ] }, { "title": "Complete amino acid sequence of the alpha 2 heavy chain of a human IgA2 immunoglobulin of the A2m (2) allotype.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1978", "authors": "Tora\u00f1o A, Putnam F W", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "416441", "url": "https://glygen.org/publication/PubMed/416441" } ] }, { "title": "Investigations on the oligosaccharide units of an A myeloma globulin.", "journal": "The Biochemical journal", "date": "1968", "authors": "Dawson G, Clamp JR", "evidence": [ { "database": "GlyConnect", "id": "227", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "reference": [ { "type": "PubMed", "id": "4172099", "url": "https://glygen.org/publication/PubMed/4172099" } ] }, { "title": "Some spectral properties of the human hemoglobin-haptoglobin complex.", "journal": "Biochemistry", "date": "1971", "authors": "Hamaguchi H, Isomoto A, Miyake Y, Nakajima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4327491", "url": "https://glygen.org/publication/PubMed/4327491" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Haem transport to the liver by haemopexin. Receptor-mediated uptake with recycling of the protein.", "journal": "The Biochemical journal", "date": "1979", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "496916", "url": "https://glygen.org/publication/PubMed/496916" } ] }, { "title": "Studies on the structures of haptoglobin 1-1 and hemoglobin in the haptoglobin-hemoglobin complex.", "journal": "Biochemical and biophysical research communications", "date": "1971", "authors": "Waks M, Kahn PC, Beychok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "5135507", "url": "https://glygen.org/publication/PubMed/5135507" } ] }, { "title": "Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences.", "journal": "Cell", "date": "1984", "authors": "Flanagan JG, Lefranc MP, Rabbitts TH", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "reference": [ { "type": "PubMed", "id": "6421489", "url": "https://glygen.org/publication/PubMed/6421489" } ] }, { "title": "Hemopexin-mediated heme uptake by liver. Characterization of the interaction of heme-hemopexin with isolated rabbit liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6480598", "url": "https://glygen.org/publication/PubMed/6480598" } ] }, { "title": "Hemin binding to serum proteins and the catalysis of interprotein transfer.", "journal": "Biochemistry", "date": "1983", "authors": "Pasternack RF, Gibbs EJ, Hoeflin E, Kosar WP, Kubera G, Skowronek CA, Wong NM, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6849882", "url": "https://glygen.org/publication/PubMed/6849882" } ] }, { "title": "Haptoglobin-hemoglobin complex. Subunit interaction probed by cross-linking.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Greer J, Liao WD, Brown WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7263686", "url": "https://glygen.org/publication/PubMed/7263686" } ] }, { "title": "Hemopexin-mediated transport of heme into isolated rat hepatocytes.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7287740", "url": "https://glygen.org/publication/PubMed/7287740" } ] }, { "title": "Haemoglobin binding with haptoglobin. Unequivocal demonstration that the beta-chains of human haemoglobin bind to haptoglobin.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kazim AL, Atassi MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7378053", "url": "https://glygen.org/publication/PubMed/7378053" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "In vivo fate of hemopexin and heme-hemopexin complexes in the rat.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Potter D, Chroneos ZC, Baynes JW, Sinclair PR, Gorman N, Liem HH, Muller-Eberhard U, Thorpe SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8424694", "url": "https://glygen.org/publication/PubMed/8424694" } ] }, { "title": "Role of hemopexin in protection of low-density lipoprotein against hemoglobin-induced oxidation.", "journal": "Biochemistry", "date": "1996", "authors": "Miller YI, Smith A, Morgan WT, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8855948", "url": "https://glygen.org/publication/PubMed/8855948" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Transfer of heme from heme-albumin to hemopexin.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Morgan WT, Liem HH, Sutor RP, Muller-Ebergard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "971416", "url": "https://glygen.org/publication/PubMed/971416" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] } ], "pathway": [ { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-2168880", "name": "Scavenging of heme from plasma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "resource": "Reactome", "description": "Scavenging of heme from plasma" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0A6YXW6-1", "protein_name": "Immunoglobulin heavy constant alpha", "gene_name": "Igha", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSERQEPLSYVLLDQSEDILEEEAPGASLWPTTVTFLTLFLLSLFYSTALTVTTVRGPFGSKEVPQY", "length": 389 }, "evidence": [ { "id": "P01877", "url": "https://omabrowser.org/oma/group/P01877/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "immunoglobulin complex, circulating", "id": "GO:0042571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042571", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "monomeric IgA immunoglobulin complex", "id": "GO:0071748", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071748", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "secretory IgA immunoglobulin complex", "id": "GO:0071751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071751", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "secretory dimeric IgA immunoglobulin complex", "id": "GO:0071752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071752", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "IgA immunoglobulin complex", "id": "GO:0071745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071745", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "B cell receptor signaling pathway", "id": "GO:0050853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "glomerular filtration", "id": "GO:0003094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003094", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "complement activation, classical pathway", "id": "GO:0006958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" }, { "name": "positive regulation of respiratory burst", "id": "GO:0060267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060267", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "P01877", "url": "https://www.uniprot.org/uniprot/P01877" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 1 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-131 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01877-1, Asn-131, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052413", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052413" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 2 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-131 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G44211QA. Example: UniProtKB:P01877-1, Asn-131, MOD:00160~GNO:G44211QA. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052414", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052414" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 3 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-131 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01877-1, Asn-131, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052415", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052415" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 4 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-131 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G83646BJ. Example: UniProtKB:P01877-1, Asn-131, MOD:00160~GNO:G83646BJ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052416", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052416" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 5 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052417", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052417" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 6 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052418", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052418" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 7 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G06853GH. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G06853GH. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052419", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052419" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 8 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052420", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052420" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 9 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G12580WI. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G12580WI. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052421", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052421" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 10 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G14440NQ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G14440NQ. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052422", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052422" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 11 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G20956ZV. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G20956ZV. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052423", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052423" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 12 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G25987BV. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G25987BV. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052424", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052424" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 13 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G31986NC. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G31986NC. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052425", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052425" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 14 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G36670VW. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G36670VW. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052426", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052426" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 15 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G44953PJ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G44953PJ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052427", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052427" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 16 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G47737VJ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G47737VJ. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052428", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052428" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 17 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G49018RC. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G49018RC. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052429", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052429" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 18 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G54600FO. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G54600FO. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052430", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052430" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 19 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052431", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052431" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 20 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G59937CP. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G59937CP. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052432", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052432" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 21 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G61613II. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G61613II. [PRO:DNx, PMID:24766575, PMID:24841998]", "evidence": [ { "id": "PR:000052433", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052433" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 22 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G65184UU. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G65184UU. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052434", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052434" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 23 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G65681LR. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G65681LR. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052435", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052435" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 24 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G68318VE. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G68318VE. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:30659065]", "evidence": [ { "id": "PR:000052436", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052436" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 25 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G72790NZ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G72790NZ. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052437", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052437" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 26 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G72791KH. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G72791KH. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052438", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052438" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 27 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052439", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052439" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 28 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G83646BJ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G83646BJ. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052440", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052440" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 29 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052441", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052441" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 30 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580]", "evidence": [ { "id": "PR:000052442", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052442" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 31 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:24766575, PMID:24841998, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052443", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052443" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 32 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-205 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G88725PI. Example: UniProtKB:P01877-1, Asn-205, MOD:00160~GNO:G88725PI. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052444", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052444" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 33 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-327 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G05428EU. Example: UniProtKB:P01877-1, Asn-327, MOD:00160~GNO:G05428EU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052445", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052445" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 34 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-327 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G57776ZU. Example: UniProtKB:P01877-1, Asn-327, MOD:00160~GNO:G57776ZU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052446", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052446" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 35 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-327 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P01877-1, Asn-327, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052447", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052447" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 36 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052448", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052448" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 37 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052449", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052449" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 38 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:24766575, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052450", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052450" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 39 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G09528DL. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G09528DL. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052451", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052451" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 40 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G12580WI. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G12580WI. [PRO:DNx, PMID:24766575, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052452", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052452" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 41 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G15038BD. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G15038BD. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052453", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052453" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 42 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G20956ZV. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G20956ZV. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052454", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052454" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 43 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G36670VW. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G36670VW. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052455", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052455" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 44 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G44953PJ. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G44953PJ. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052456", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052456" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 45 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052457", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052457" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 46 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G62595EF. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G62595EF. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052458", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052458" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 47 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052459", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052459" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 48 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G85582CB. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G85582CB. [PRO:DNx, PMID:24766575]", "evidence": [ { "id": "PR:000052460", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052460" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 49 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052461", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052461" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 50 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-47 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01877-1, Asn-47, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:24766575, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052462", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052462" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 51 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052463", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052463" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 52 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G12580WI. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G12580WI. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052464", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052464" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 53 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G36670VW. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G36670VW. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052465", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052465" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 54 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G68318VE. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G68318VE. [PRO:DNx, PMID:30659065]", "evidence": [ { "id": "PR:000052466", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052466" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 55 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000052467", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052467" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 56 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G85740DB. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G85740DB. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052468", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052468" } ] }, { "name": "immunoglobulin heavy constant alpha 2 N-glycosylated 57 (human)", "definition": "An immunoglobulin heavy constant alpha 2 (human) that has been N-glycosylated at the residue equivalent to Asn-92 of the amino acid sequence represented by UniProtKB:P01877-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P01877-1, Asn-92, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580, PMID:30659065]", "evidence": [ { "id": "PR:000052469", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052469" } ] } ], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" }, { "start_pos": 47, "end_pos": 49, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 47, 92, 131, 205 ], "o_linked_sites": [], "snv_sites": [ 14, 42, 47, 49, 93, 94, 133, 141, 171, 188, 205 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 205, "end_pos": 207 }, { "start_pos": 47, "end_pos": 49 }, { "start_pos": 92, "end_pos": 94 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 249 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 160 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 245 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 160 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 129 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }