{ "uniprot_canonical_ac": "P01764-1", "uniprot_ac": "P01764", "uniprot_id": "HV323_HUMAN", "mass": { "chemical_mass": 12582.0, "monoisotopic_mass": 12582.0 }, "refseq": {}, "gene_names": [ { "name": "IGHV3-23", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01764", "id": "P01764" } ], "protein_names": [ { "name": "Immunoglobulin heavy variable 3-23", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region LAY", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region POM", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region TEI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region TIL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region TUR", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region VH26", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region WAS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" }, { "name": "Ig heavy chain V-III region ZAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01764" } ], "function": [ { "annotation": "V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:20176268, PubMed:17576170).", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764#function" }, { "database": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" }, { "database": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" }, { "database": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" }, { "database": "PubMed", "id": "24600447", "url": "https://glygen.org/publication/PubMed/24600447" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P01764", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01764" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 97, "end_pos": 97, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "14", "chr_pos": "106268669", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T97", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "73.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "60.57", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "72.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "76.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "72.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "73.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "81.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "77.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "88.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01764" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "common_name": "Human" } ], "gene": [ { "name": "IGHV3-23", "url": "https://www.uniprot.org/uniprot/P01764", "locus": { "chromosome": "HSCHR14_3_CTG1", "start_pos": 736375, "end_pos": 736909, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000281962", "url": "https://www.ensembl.org/id/ENSG00000281962" } ] } } ], "crossref": [ { "id": "ENSG00000211949", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000211949", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01764", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01764", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd04981", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04981", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IGHV3-23", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IGHV3-23", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5588", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5588", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01764", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01764*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P01764", "url": "https://www.nextprot.org/entry/NX_P01764", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "WIARITN", "url": "https://omabrowser.org/oma/group/WIARITN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266:SF372", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266:SF372", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1OHQ", "url": "https://www.rcsb.org/structure/1OHQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3BN9", "url": "https://www.rcsb.org/structure/3BN9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3UPC", "url": "https://www.rcsb.org/structure/3UPC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZHD", "url": "https://www.rcsb.org/structure/3ZHD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZHK", "url": "https://www.rcsb.org/structure/3ZHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZHL", "url": "https://www.rcsb.org/structure/3ZHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KFZ", "url": "https://www.rcsb.org/structure/4KFZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01764", "url": "https://pharos.nih.gov/targets/P01764", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01764", "url": "http://purl.obolibrary.org/obo/PR_P01764", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9664422", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01764-1", "url": "https://www.uniprot.org/uniprot/P01764-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK", "length": 117, "header": "sp|P01764-1|HV323_HUMAN Isoform 1 of Immunoglobulin heavy variable 3-23 OS=Homo sapiens OX=9606 GN=IGHV3-23 PE=1 SV=2 CANONICAL=P01764-1" }, "isoforms": [ { "isoform_ac": "P01764-1", "url": "", "sequence": { "sequence": "MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK", "length": 117, "header": "sp|P01764-1|HV323_HUMAN Isoform 1 of Immunoglobulin heavy variable 3-23 OS=Homo sapiens OX=9606 GN=IGHV3-23 PE=1 SV=2 CANONICAL=P01764-1" }, "locus": { "chromosome": "14", "start_pos": 106269061, "end_pos": 106268608, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000390609.3", "url": "https://www.ensembl.org/id/ENST00000390609.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000375018.2", "url": "https://www.ensembl.org/id/ENSP00000375018.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gross BS, Lee JR, Clements JL, Turner M, Tybulewicz VL, Findell PR, Koretzky GA, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10026222", "url": "https://glygen.org/publication/PubMed/10026222" } ] }, { "title": "In situ detection of activated Bruton's tyrosine kinase in the Ig signaling complex by phosphopeptide-specific monoclonal antibodies.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Nisitani S, Kato RM, Rawlings DJ, Witte ON, Wahl MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10051622", "url": "https://glygen.org/publication/PubMed/10051622" } ] }, { "title": "Gab-family adapter proteins act downstream of cytokine and growth factor receptors and T- and B-cell antigen receptors.", "journal": "Blood", "date": "1999", "authors": "Nishida K, Yoshida Y, Itoh M, Fukada T, Ohtani T, Shirogane T, Atsumi T, Takahashi-Tezuka M, Ishihara K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "10068651", "url": "https://glygen.org/publication/PubMed/10068651" } ] }, { "title": "Cutting edge: a role for the adaptor protein LAT in human NK cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Jevremovic D, Billadeau DD, Schoon RA, Dick CJ, Irvin BJ, Zhang W, Samelson LE, Abraham RT, Leibson PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "10072481", "url": "https://glygen.org/publication/PubMed/10072481" } ] }, { "title": "The binding and transport of heme by hemopexin.", "journal": "Annals of clinical research", "date": "1976", "authors": "Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1008494", "url": "https://glygen.org/publication/PubMed/1008494" } ] }, { "title": "Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1999", "authors": "Ganapathy ME, Prasad PD, Huang W, Seth P, Leibach FH, Ganapathy V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "10087012", "url": "https://glygen.org/publication/PubMed/10087012" } ] }, { "title": "The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.", "journal": "Cell", "date": "1999", "authors": "Rohatgi R, Ma L, Miki H, Lopez M, Kirchhausen T, Takenawa T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10219243", "url": "https://glygen.org/publication/PubMed/10219243" } ] }, { "title": "Phospholipases and phagocytosis: the role of phospholipid-derived second messengers in phagocytosis.", "journal": "The international journal of biochemistry & cell biology", "date": "1999", "authors": "Lennartz MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10224668", "url": "https://glygen.org/publication/PubMed/10224668" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "Tyrosine phosphorylation of Vav stimulates IL-6 production in mast cells by a Rac/c-Jun N-terminal kinase-dependent pathway.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Song JS, Haleem-Smith H, Arudchandran R, Gomez J, Scott PM, Mill JF, Tan TH, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10395673", "url": "https://glygen.org/publication/PubMed/10395673" } ] }, { "title": "DAPP1: a dual adaptor for phosphotyrosine and 3-phosphoinositides.", "journal": "The Biochemical journal", "date": "1999", "authors": "Dowler S, Currie RA, Downes CP, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10432293", "url": "https://glygen.org/publication/PubMed/10432293" } ] }, { "title": "Localization of p21-activated kinase 1 (PAK1) to pseudopodia, membrane ruffles, and phagocytic cups in activated human neutrophils.", "journal": "Journal of leukocyte biology", "date": "1999", "authors": "Dharmawardhane S, Brownson D, Lennartz M, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10496324", "url": "https://glygen.org/publication/PubMed/10496324" } ] }, { "title": "Identification of the SH2 domain binding protein of Bruton's tyrosine kinase as BLNK--functional significance of Btk-SH2 domain in B-cell antigen receptor-coupled calcium signaling.", "journal": "Blood", "date": "1999", "authors": "Hashimoto S, Iwamatsu A, Ishiai M, Okawa K, Yamadori T, Matsushita M, Baba Y, Kishimoto T, Kurosaki T, Tsukada S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10498607", "url": "https://glygen.org/publication/PubMed/10498607" } ] }, { "title": "Identification and molecular cloning of p75/AIRM1, a novel member of the sialoadhesin family that functions as an inhibitory receptor in human natural killer cells.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Falco M, Biassoni R, Bottino C, Vitale M, Sivori S, Augugliaro R, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10499918", "url": "https://glygen.org/publication/PubMed/10499918" } ] }, { "title": "Phosphorylation of Shc by Src family kinases is necessary for stem cell factor receptor/c-kit mediated activation of the Ras/MAP kinase pathway and c-fos induction.", "journal": "Oncogene", "date": "1999", "authors": "Lennartsson J, Blume-Jensen P, Hermanson M, Ponten E, Carlberg M, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "10523831", "url": "https://glygen.org/publication/PubMed/10523831" } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "Interaction of SLP adaptors with the SH2 domain of Tec family kinases.", "journal": "European journal of immunology", "date": "1999", "authors": "Su YW, Zhang Y, Schweikert J, Koretzky GA, Reth M, Wienands J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10556826", "url": "https://glygen.org/publication/PubMed/10556826" } ] }, { "title": "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.", "journal": "Nature cell biology", "date": "1999", "authors": "Edwards DC, Sanders LC, Bokoch GM, Gill GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10559936", "url": "https://glygen.org/publication/PubMed/10559936" } ] }, { "title": "Phospholipase C-gamma as a signal-transducing element.", "journal": "Experimental cell research", "date": "1999", "authors": "Carpenter G, Ji Qs", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "10579907", "url": "https://glygen.org/publication/PubMed/10579907" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "Purification and characterization of human Syk produced using a baculovirus expression system.", "journal": "Protein expression and purification", "date": "2000", "authors": "Baldock D, Graham B, Akhlaq M, Graff P, Jones CE, Menear K", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10648173", "url": "https://glygen.org/publication/PubMed/10648173" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Systematic analysis of the role of CD19 cytoplasmic tyrosines in enhancement of activation in Daudi human B cells: clustering of phospholipase C and Vav and of Grb2 and Sos with different CD19 tyrosines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Brooks SR, Li X, Volanakis EJ, Carter RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10706702", "url": "https://glygen.org/publication/PubMed/10706702" } ] }, { "title": "Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein.", "journal": "Nature", "date": "2000", "authors": "Kim AS, Kakalis LT, Abdul-Manan N, Liu GA, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10724160", "url": "https://glygen.org/publication/PubMed/10724160" } ] }, { "title": "The CMRF-35H gene structure predicts for an independently expressed member of an ITIM/ITAM pair of molecules localized to human chromosome 17.", "journal": "Tissue antigens", "date": "2000", "authors": "Clark GJ, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "10746781", "url": "https://glygen.org/publication/PubMed/10746781" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "A novel B lymphocyte-associated adaptor protein, Bam32, regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Marshall AJ, Niiro H, Lerner CG, Yun TJ, Thomas S, Disteche CM, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10770799", "url": "https://glygen.org/publication/PubMed/10770799" } ] }, { "title": "GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Carlier MF, Nioche P, Broutin-L'Hermite I, Boujemaa R, Le Clainche C, Egile C, Garbay C, Ducruix A, Sansonetti P, Pantaloni D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10781580", "url": "https://glygen.org/publication/PubMed/10781580" } ] }, { "title": "Surface markers of human lymphocytes.", "journal": "The Johns Hopkins medical journal", "date": "1975", "authors": "Kunkel HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1081164", "url": "https://glygen.org/publication/PubMed/1081164" } ] }, { "title": "Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.", "journal": "FEBS letters", "date": "2000", "authors": "Sakurai H, Miyoshi H, Mizukami J, Sugita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10838074", "url": "https://glygen.org/publication/PubMed/10838074" } ] }, { "title": "A second calcineurin binding site on the NFAT regulatory domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Park S, Uesugi M, Verdine GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "10860980", "url": "https://glygen.org/publication/PubMed/10860980" } ] }, { "title": "Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Suzuki T, Kono H, Hirose N, Okada M, Yamamoto T, Yamamoto K, Honda Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "10861086", "url": "https://glygen.org/publication/PubMed/10861086" } ] }, { "title": "A complex of N-WASP and WIP integrates signalling cascades that lead to actin polymerization.", "journal": "Nature cell biology", "date": "2000", "authors": "Moreau V, Frischknecht F, Reckmann I, Vincentelli R, Rabut G, Stewart D, Way M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10878810", "url": "https://glygen.org/publication/PubMed/10878810" } ] }, { "title": "Phosphoinositide 3-kinase-dependent phosphorylation of the dual adaptor for phosphotyrosine and 3-phosphoinositides by the Src family of tyrosine kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Dowler S, Montalvo L, Cantrell D, Morrice N, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10880360", "url": "https://glygen.org/publication/PubMed/10880360" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "Structure of the Fc fragment of human IgE bound to its high-affinity receptor Fc epsilonRI alpha.", "journal": "Nature", "date": "2000", "authors": "Garman SC, Wurzburg BA, Tarchevskaya SS, Kinet JP, Jardetzky TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "10917520", "url": "https://glygen.org/publication/PubMed/10917520" } ] }, { "title": "Distinct pathways of mannan-binding lectin (MBL)- and C1-complex autoactivation revealed by reconstitution of MBL with recombinant MBL-associated serine protease-2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Vorup-Jensen T, Petersen SV, Hansen AG, Poulsen K, Schwaeble W, Sim RB, Reid KB, Davis SJ, Thiel S, Jensenius JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "10925294", "url": "https://glygen.org/publication/PubMed/10925294" } ] }, { "title": "Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.", "journal": "Molecular cell", "date": "2000", "authors": "Ferguson KM, Kavran JM, Sankaran VG, Fournier E, Isakoff SJ, Skolnik EY, Lemmon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "10983984", "url": "https://glygen.org/publication/PubMed/10983984" } ] }, { "title": "Activation by Cdc42 and PIP(2) of Wiskott-Aldrich syndrome protein (WASp) stimulates actin nucleation by Arp2/3 complex.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "10995437", "url": "https://glygen.org/publication/PubMed/10995437" } ] }, { "title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.", "journal": "Cell", "date": "2000", "authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11007481", "url": "https://glygen.org/publication/PubMed/11007481" } ] }, { "title": "Calcineurin: form and function.", "journal": "Physiological reviews", "date": "2000", "authors": "Rusnak F, Mertz P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11015619", "url": "https://glygen.org/publication/PubMed/11015619" } ] }, { "title": "Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.", "journal": "Molecular cell", "date": "2000", "authors": "Okamura H, Aramburu J, Garcia-Rodriguez C, Viola JP, Raghavan A, Tahiliani M, Zhang X, Qin J, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11030334", "url": "https://glygen.org/publication/PubMed/11030334" } ] }, { "title": "Cd19-dependent activation of Akt kinase in B-lymphocytes.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Otero DC, Omori SA, Rickert RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11042164", "url": "https://glygen.org/publication/PubMed/11042164" } ] }, { "title": "Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Watanabe S, Take H, Takeda K, Yu ZX, Iwata N, Kajigaya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11071869", "url": "https://glygen.org/publication/PubMed/11071869" } ] }, { "title": "Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.", "journal": "Molecular cell", "date": "2000", "authors": "Uren AG, O'Rourke K, Aravind LA, Pisabarro MT, Seshagiri S, Koonin EV, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11090634", "url": "https://glygen.org/publication/PubMed/11090634" } ] }, { "title": "A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Fukuoka M, Suetsugu S, Miki H, Fukami K, Endo T, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11157975", "url": "https://glygen.org/publication/PubMed/11157975" } ] }, { "title": "Identification of the haemoglobin scavenger receptor.", "journal": "Nature", "date": "2001", "authors": "Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11196644", "url": "https://glygen.org/publication/PubMed/11196644" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "BLNK mediates Syk-dependent Btk activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Baba Y, Hashimoto S, Matsushita M, Watanabe D, Kishimoto T, Kurosaki T, Tsukada S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11226282", "url": "https://glygen.org/publication/PubMed/11226282" } ] }, { "title": "The Arp2/3 complex nucleates actin filament branches from the sides of pre-existing filaments.", "journal": "Nature cell biology", "date": "2001", "authors": "Amann KJ, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11231582", "url": "https://glygen.org/publication/PubMed/11231582" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Identification of NKp80, a novel triggering molecule expressed by human NK cells.", "journal": "European journal of immunology", "date": "2001", "authors": "Vitale M, Falco M, Castriconi R, Parolini S, Zambello R, Semenzato G, Biassoni R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11265639", "url": "https://glygen.org/publication/PubMed/11265639" } ] }, { "title": "Phosphorylation of cofilin by LIM-kinase is necessary for semaphorin 3A-induced growth cone collapse.", "journal": "Nature neuroscience", "date": "2001", "authors": "Aizawa H, Wakatsuki S, Ishii A, Moriyama K, Sasaki Y, Ohashi K, Sekine-Aizawa Y, Sehara-Fujisawa A, Mizuno K, Goshima Y, Yahara I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11276226", "url": "https://glygen.org/publication/PubMed/11276226" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.", "journal": "Cancer research", "date": "2001", "authors": "Kim HL, Vander Griend DJ, Yang X, Benson DA, Dubauskas Z, Yoshida BA, Chekmareva MA, Ichikawa Y, Sokoloff MH, Zhan P, Karrison T, Lin A, Stadler WM, Ichikawa T, Rubin MA, Rinker-Schaeffer CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11306453", "url": "https://glygen.org/publication/PubMed/11306453" } ] }, { "title": "Persistent activation of NF-kappa B by the tax transforming protein involves chronic phosphorylation of IkappaB kinase subunits IKKbeta and IKKgamma.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Carter RS, Geyer BC, Xie M, Acevedo-Suarez CA, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11325957", "url": "https://glygen.org/publication/PubMed/11325957" } ] }, { "title": "WASP and WAVE family proteins: key molecules for rapid rearrangement of cortical actin filaments and cell movement.", "journal": "Journal of cell science", "date": "2001", "authors": "Takenawa T, Miki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11329366", "url": "https://glygen.org/publication/PubMed/11329366" } ] }, { "title": "Nck and phosphatidylinositol 4,5-bisphosphate synergistically activate actin polymerization through the N-WASP-Arp2/3 pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rohatgi R, Nollau P, Ho HY, Kirschner MW, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11340081", "url": "https://glygen.org/publication/PubMed/11340081" } ] }, { "title": "Vav1 regulates phospholipase cgamma activation and calcium responses in mast cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Manetz TS, Gonzalez-Espinosa C, Arudchandran R, Xirasagar S, Tybulewicz V, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11340169", "url": "https://glygen.org/publication/PubMed/11340169" } ] }, { "title": "Nomenclature of the human immunoglobulin heavy (IGH) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "11340299", "url": "https://glygen.org/publication/PubMed/11340299" } ] }, { "title": "Mapping the Zap-70 phosphorylation sites on LAT (linker for activation of T cells) required for recruitment and activation of signalling proteins in T cells.", "journal": "The Biochemical journal", "date": "2001", "authors": "Paz PE, Wang S, Clarke H, Lu X, Stokoe D, Abo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "11368773", "url": "https://glygen.org/publication/PubMed/11368773" } ] }, { "title": "Regulation of phosphoinositide-specific phospholipase C.", "journal": "Annual review of biochemistry", "date": "2001", "authors": "Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "11395409", "url": "https://glygen.org/publication/PubMed/11395409" } ] }, { "title": "Restricted accumulation of phosphatidylinositol 3-kinase products in a plasmalemmal subdomain during Fc gamma receptor-mediated phagocytosis.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Marshall JG, Booth JW, Stambolic V, Mak T, Balla T, Schreiber AD, Meyer T, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11425868", "url": "https://glygen.org/publication/PubMed/11425868" } ] }, { "title": "Association of SLP-65/BLNK with the B cell antigen receptor through a non-ITAM tyrosine of Ig-alpha.", "journal": "European journal of immunology", "date": "2001", "authors": "Engels N, Wollscheid B, Wienands J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11449366", "url": "https://glygen.org/publication/PubMed/11449366" } ] }, { "title": "TAK1 is a ubiquitin-dependent kinase of MKK and IKK.", "journal": "Nature", "date": "2001", "authors": "Wang C, Deng L, Hong M, Akkaraju GR, Inoue J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11460167", "url": "https://glygen.org/publication/PubMed/11460167" } ] }, { "title": "NTB-A [correction of GNTB-A], a novel SH2D1A-associated surface molecule contributing to the inability of natural killer cells to kill Epstein-Barr virus-infected B cells in X-linked lymphoproliferative disease.", "journal": "The Journal of experimental medicine", "date": "2001", "authors": "Bottino C, Falco M, Parolini S, Marcenaro E, Augugliaro R, Sivori S, Landi E, Biassoni R, Notarangelo LD, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11489943", "url": "https://glygen.org/publication/PubMed/11489943" } ] }, { "title": "Structural basis of MHC class I recognition by natural killer cell receptors.", "journal": "Immunological reviews", "date": "2001", "authors": "Sawicki MW, Dimasi N, Natarajan K, Wang J, Margulies DH, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11513152", "url": "https://glygen.org/publication/PubMed/11513152" } ] }, { "title": "CR16 forms a complex with N-WASP in brain and is a novel member of a conserved proline-rich actin-binding protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Ho HY, Rohatgi R, Ma L, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11553796", "url": "https://glygen.org/publication/PubMed/11553796" } ] }, { "title": "The gene encoding the immunoregulatory signaling molecule CMRF-35A localized to human chromosome 17 in close proximity to other members of the CMRF-35 family.", "journal": "Tissue antigens", "date": "2001", "authors": "Clark GJ, Cooper B, Fitzpatrick S, Green BJ, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11556966", "url": "https://glygen.org/publication/PubMed/11556966" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Tyrosine residues in phospholipase Cgamma 2 essential for the enzyme function in B-cell signaling.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rodriguez R, Matsuda M, Perisic O, Bravo J, Paul A, Jones NP, Light Y, Swann K, Williams RL, Katan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11606584", "url": "https://glygen.org/publication/PubMed/11606584" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "Structure-function analysis of Lyn kinase association with lipid rafts and initiation of early signaling events after Fcepsilon receptor I aggregation.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Kovarova M, Tolar P, Arudchandran R, Draberova L, Rivera J, Draber P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "11713268", "url": "https://glygen.org/publication/PubMed/11713268" } ] }, { "title": "Different WASP family proteins stimulate different Arp2/3 complex-dependent actin-nucleating activities.", "journal": "Current biology : CB", "date": "2001", "authors": "Zalevsky J, Lempert L, Kranitz H, Mullins RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11747816", "url": "https://glygen.org/publication/PubMed/11747816" } ] }, { "title": "Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions.", "journal": "Chemical reviews", "date": "2001", "authors": "Newton AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "11749377", "url": "https://glygen.org/publication/PubMed/11749377" } ] }, { "title": "Phosphorylation of the protein kinase C-theta activation loop and hydrophobic motif regulates its kinase activity, but only activation loop phosphorylation is critical to in vivo nuclear-factor-kappaB induction.", "journal": "The Biochemical journal", "date": "2002", "authors": "Liu Y, Graham C, Li A, Fisher RJ, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "11772397", "url": "https://glygen.org/publication/PubMed/11772397" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "A reassessment of the MAdCAM-1 structure and its role in integrin recognition.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Dando J, Wilkinson KW, Ortlepp S, King DJ, Brady RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11807247", "url": "https://glygen.org/publication/PubMed/11807247" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "WICH, a novel verprolin homology domain-containing protein that functions cooperatively with N-WASP in actin-microspike formation.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Kato M, Miki H, Kurita S, Endo T, Nakagawa H, Miyamoto S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11829459", "url": "https://glygen.org/publication/PubMed/11829459" } ] }, { "title": "Dynamics of cytoskeletal proteins during Fcgamma receptor-mediated phagocytosis in macrophages.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Diakonova M, Bokoch G, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "11854399", "url": "https://glygen.org/publication/PubMed/11854399" } ] }, { "title": "Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.", "journal": "Medicinal research reviews", "date": "2002", "authors": "Yusuf-Makagiansar H, Anderson ME, Yakovleva TV, Murray JS, Siahaan TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11857637", "url": "https://glygen.org/publication/PubMed/11857637" } ] }, { "title": "Structure and function of major histocompatibility complex (MHC) class I specific receptors expressed on human natural killer (NK) cells.", "journal": "Molecular immunology", "date": "2002", "authors": "Borrego F, Kabat J, Kim DK, Lieto L, Maasho K, Pena J, Solana R, Coligan JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11858820", "url": "https://glygen.org/publication/PubMed/11858820" } ] }, { "title": "KIR: diverse, rapidly evolving receptors of innate and adaptive immunity.", "journal": "Annual review of immunology", "date": "2002", "authors": "Vilches C, Parham P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11861603", "url": "https://glygen.org/publication/PubMed/11861603" } ] }, { "title": "Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties.", "journal": "Blood", "date": "2002", "authors": "Allhorn M, Berggard T, Nordberg J, Olsson ML, Akerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "11877257", "url": "https://glygen.org/publication/PubMed/11877257" } ] }, { "title": "Transient receptor potential 1 regulates capacitative Ca(2+) entry and Ca(2+) release from endoplasmic reticulum in B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Mori Y, Wakamori M, Miyakawa T, Hermosura M, Hara Y, Nishida M, Hirose K, Mizushima A, Kurosaki M, Mori E, Gotoh K, Okada T, Fleig A, Penner R, Iino M, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11901194", "url": "https://glygen.org/publication/PubMed/11901194" } ] }, { "title": "The direct recruitment of BLNK to immunoglobulin alpha couples the B-cell antigen receptor to distal signaling pathways.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kabak S, Skaggs BJ, Gold MR, Affolter M, West KL, Foster MS, Siemasko K, Chan AC, Aebersold R, Clark MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "11909947", "url": "https://glygen.org/publication/PubMed/11909947" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "A structural perspective on MHC class I recognition by killer cell immunoglobulin-like receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Boyington JC, Sun PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955593", "url": "https://glygen.org/publication/PubMed/11955593" } ] }, { "title": "Asymmetric ligand recognition by the activating natural killer cell receptor NKG2D, a symmetric homodimer.", "journal": "Molecular immunology", "date": "2002", "authors": "Strong RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955595", "url": "https://glygen.org/publication/PubMed/11955595" } ] }, { "title": "Recognition of immunoglobulins by Fcgamma receptors.", "journal": "Molecular immunology", "date": "2002", "authors": "Radaev S, Sun P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "11955599", "url": "https://glygen.org/publication/PubMed/11955599" } ] }, { "title": "Sialic acid binding domains of CD22 are required for negative regulation of B cell receptor signaling.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Jin L, McLean PA, Neel BG, Wortis HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "11994425", "url": "https://glygen.org/publication/PubMed/11994425" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Myosin X is a downstream effector of PI(3)K during phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Cox D, Berg JS, Cammer M, Chinegwundoh JO, Dale BM, Cheney RE, Greenberg S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12055636", "url": "https://glygen.org/publication/PubMed/12055636" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "May the force be with you: Myosin-X in phagocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12105426", "url": "https://glygen.org/publication/PubMed/12105426" } ] }, { "title": "Opsonization modulates Rac-1 activation during cell entry by Leishmania amazonensis.", "journal": "Infection and immunity", "date": "2002", "authors": "Morehead J, Coppens I, Andrews NW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12117970", "url": "https://glygen.org/publication/PubMed/12117970" } ] }, { "title": "Activation of phospholipase Cgamma2 by tyrosine phosphorylation.", "journal": "Molecular pharmacology", "date": "2002", "authors": "Ozdener F, Dangelmaier C, Ashby B, Kunapuli SP, Daniel JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "12181444", "url": "https://glygen.org/publication/PubMed/12181444" } ] }, { "title": "Rapid association of cytoskeletal remodeling proteins with the developing phagosomes of human neutrophils.", "journal": "Histochemistry and cell biology", "date": "2002", "authors": "Robinson JM, Badwey JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12189515", "url": "https://glygen.org/publication/PubMed/12189515" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor.", "journal": "Experimental cell research", "date": "2002", "authors": "Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12213210", "url": "https://glygen.org/publication/PubMed/12213210" } ] }, { "title": "CS1, a novel member of the CD2 family, is homophilic and regulates NK cell function.", "journal": "Molecular immunology", "date": "2002", "authors": "Kumaresan PR, Lai WC, Chuang SS, Bennett M, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12213321", "url": "https://glygen.org/publication/PubMed/12213321" } ] }, { "title": "Lipid rafts in mast cell signaling.", "journal": "Molecular immunology", "date": "2002", "authors": "Draber P, Draberova L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "12217391", "url": "https://glygen.org/publication/PubMed/12217391" } ] }, { "title": "Phosphorylation of tyrosine 291 enhances the ability of WASp to stimulate actin polymerization and filopodium formation. Wiskott-Aldrich Syndrome protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cory GO, Garg R, Cramer R, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12235133", "url": "https://glygen.org/publication/PubMed/12235133" } ] }, { "title": "The biological functions of MBL-associated serine proteases (MASPs).", "journal": "Immunobiology", "date": "2002", "authors": "Hajela K, Kojima M, Ambrus G, Wong KH, Moffatt BE, Ferluga J, Hajela S, Gal P, Sim RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "12396008", "url": "https://glygen.org/publication/PubMed/12396008" } ] }, { "title": "Phosphorylation of Tyr342 in the linker region of Syk is critical for Fc epsilon RI signaling in mast cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Zhang J, Berenstein E, Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12417718", "url": "https://glygen.org/publication/PubMed/12417718" } ] }, { "title": "Amplification of B cell antigen receptor signaling by a Syk/ITAM positive feedback loop.", "journal": "Molecular cell", "date": "2002", "authors": "Rolli V, Gallwitz M, Wossning T, Flemming A, Schamel WW, Zurn C, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "12453414", "url": "https://glygen.org/publication/PubMed/12453414" } ] }, { "title": "BLNK: molecular scaffolding through 'cis'-mediated organization of signaling proteins.", "journal": "The EMBO journal", "date": "2002", "authors": "Chiu CW, Dalton M, Ishiai M, Kurosaki T, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "12456653", "url": "https://glygen.org/publication/PubMed/12456653" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.", "journal": "Human genetics", "date": "2003", "authors": "Speckman RA, Wright Daw JA, Helms C, Duan S, Cao L, Taillon-Miller P, Kwok PY, Menter A, Bowcock AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12483297", "url": "https://glygen.org/publication/PubMed/12483297" } ] }, { "title": "Activation of C1r by proteolytic cleavage.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Ziccardi RJ, Cooper NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623" } ], "reference": [ { "type": "PubMed", "id": "1249422", "url": "https://glygen.org/publication/PubMed/1249422" } ] }, { "title": "Kinetics of deoxyhemoglobin subunit dissociation determined by haptoglobin binding: estimation of the equilibrium constant from forward and reverse rates.", "journal": "Biochemistry", "date": "1976", "authors": "Ip SH, Johnson ML, Ackers GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1252417", "url": "https://glygen.org/publication/PubMed/1252417" } ] }, { "title": "Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Nore BF, Mattsson PT, Antonsson P, Backesjo CM, Westlund A, Lennartsson J, Hansson H, Low P, Ronnstrand L, Smith CI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "12573241", "url": "https://glygen.org/publication/PubMed/12573241" } ] }, { "title": "Expression of potential lymphocyte trafficking mediator molecules in the mammary gland.", "journal": "Veterinary research", "date": "2003", "authors": "Nishimura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "12588680", "url": "https://glygen.org/publication/PubMed/12588680" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Vav1: a key signal transducer downstream of the TCR.", "journal": "Immunological reviews", "date": "2003", "authors": "Tybulewicz VL, Ardouin L, Prisco A, Reynolds LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "12670394", "url": "https://glygen.org/publication/PubMed/12670394" } ] }, { "title": "A lipid raft environment enhances Lyn kinase activity by protecting the active site tyrosine from dephosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Young RM, Holowka D, Baird B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "12670955", "url": "https://glygen.org/publication/PubMed/12670955" } ] }, { "title": "ATP hydrolysis on actin-related protein 2/3 complex causes debranching of dendritic actin arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Le Clainche C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "12743368", "url": "https://glygen.org/publication/PubMed/12743368" } ] }, { "title": "Interleukin-10 therapy--review of a new approach.", "journal": "Pharmacological reviews", "date": "2003", "authors": "Asadullah K, Sterry W, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "12773629", "url": "https://glygen.org/publication/PubMed/12773629" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Class I phosphoinositide 3-kinase p110beta is required for apoptotic cell and Fcgamma receptor-mediated phagocytosis by macrophages.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Leverrier Y, Okkenhaug K, Sawyer C, Bilancio A, Vanhaesebroeck B, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "12869549", "url": "https://glygen.org/publication/PubMed/12869549" } ] }, { "title": "Transcriptional regulation by calcium, calcineurin, and NFAT.", "journal": "Genes & development", "date": "2003", "authors": "Hogan PG, Chen L, Nardone J, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "12975316", "url": "https://glygen.org/publication/PubMed/12975316" } ] }, { "title": "Signal transduction by Fc gamma RIII (CD16) is mediated through the gamma chain.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Wirthmueller U, Kurosaki T, Murakami MS, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1314888", "url": "https://glygen.org/publication/PubMed/1314888" } ] }, { "title": "[Isolation of the haptoglobin-hemoglobin complex in human blood in homogenous state. II].", "journal": "Bulletin de la Societe de chimie biologique", "date": "1956", "authors": "JAYLE MF, BOUSSIER G, TONNELAT J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13342742", "url": "https://glygen.org/publication/PubMed/13342742" } ] }, { "title": "The binding of haemoglobin by plasma proteins (haptoglobins); its bearing on the renal threshold for haemoglobin and the aetiology of haemoglobinuria.", "journal": "British medical journal", "date": "1957", "authors": "ALLISON AC, REES WA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "13472068", "url": "https://glygen.org/publication/PubMed/13472068" } ] }, { "title": "Activation of Fc gamma RII induces tyrosine phosphorylation of multiple proteins including Fc gamma RII.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Huang MM, Indik Z, Brass LF, Hoxie JA, Schreiber AD, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "1372004", "url": "https://glygen.org/publication/PubMed/1372004" } ] }, { "title": "Membrane Ig cross-linking regulates phosphatidylinositol 3-kinase in B lymphocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "Gold MR, Chan VW, Turck CW, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1372019", "url": "https://glygen.org/publication/PubMed/1372019" } ] }, { "title": "Generation of phosphatidic acid and diacylglycerols following ligation of surface immunoglobulin in human B lymphocytes: potential role in PKC activation.", "journal": "Cellular immunology", "date": "1992", "authors": "Valentine MA, Bursten SL, Harris WE, Draves KE, Pollok BA, Ostrowski J, Bomsztyk K, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1374290", "url": "https://glygen.org/publication/PubMed/1374290" } ] }, { "title": "Comparison of human B cell antigen receptor complexes: membrane-expressed forms of immunoglobulin (Ig)M, IgD, and IgG are associated with structurally related heterodimers.", "journal": "The Journal of experimental medicine", "date": "1992", "authors": "Van Noesel CJ, Brouns GS, van Schijndel GM, Bende RJ, Mason DY, Borst J, van Lier RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1375264", "url": "https://glygen.org/publication/PubMed/1375264" } ] }, { "title": "Predominant expression and activation-induced tyrosine phosphorylation of phospholipase C-gamma 2 in B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Coggeshall KM, McHugh JC, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1376928", "url": "https://glygen.org/publication/PubMed/1376928" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "C'1 ESTERASE EFFECT ON ACTIVITY AND PHYSICOCHEMICAL PROPERTIES OF THE FOURTH COMPONENT OF COMPLEMENT.", "journal": "The Journal of experimental medicine", "date": "1965", "authors": "MUELLER-EBERHARD HJ, LEPOW IH", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "14280442", "url": "https://glygen.org/publication/PubMed/14280442" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "Mast cell signal transduction from the high-affinity IgE receptor.", "journal": "Current opinion in immunology", "date": "2003", "authors": "Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "14630197", "url": "https://glygen.org/publication/PubMed/14630197" } ] }, { "title": "Focal adhesion kinase regulation of N-WASP subcellular localization and function.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wu X, Suetsugu S, Cooper LA, Takenawa T, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "14676198", "url": "https://glygen.org/publication/PubMed/14676198" } ] }, { "title": "Signaling by the CD19/CD21 complex on B cells.", "journal": "Current directions in autoimmunity", "date": "2004", "authors": "Carter RH, Barrington RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14719373", "url": "https://glygen.org/publication/PubMed/14719373" } ] }, { "title": "Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Shiratori I, Ogasawara K, Saito T, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "14970179", "url": "https://glygen.org/publication/PubMed/14970179" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "Fcgamma RI-triggered generation of arachidonic acid and eicosanoids requires iPLA2 but not cPLA2 in human monocytic cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tay HK, Melendez AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15007079", "url": "https://glygen.org/publication/PubMed/15007079" } ] }, { "title": "NTAL phosphorylation is a pivotal link between the signaling cascades leading to human mast cell degranulation following Kit activation and Fc epsilon RI aggregation.", "journal": "Blood", "date": "2004", "authors": "Tkaczyk C, Horejsi V, Iwaki S, Draber P, Samelson LE, Satterthwaite AB, Nahm DH, Metcalfe DD, Gilfillan AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "15010370", "url": "https://glygen.org/publication/PubMed/15010370" } ] }, { "title": "Crystal structure of HEL4, a soluble, refoldable human V(H) single domain with a germ-line scaffold.", "journal": "J. Mol. Biol.", "date": "2004", "authors": "Jespers Laurent, Schon Oliver, James Leo C, Veprintsev Dmitri, Winter Greg", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "15033359", "url": "https://glygen.org/publication/PubMed/15033359" } ] }, { "title": "Cutting edge: CD96 (tactile) promotes NK cell-target cell adhesion by interacting with the poliovirus receptor (CD155).", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fuchs A, Cella M, Giurisato E, Shaw AS, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15034010", "url": "https://glygen.org/publication/PubMed/15034010" } ] }, { "title": "Signalling to actin assembly via the WASP (Wiskott-Aldrich syndrome protein)-family proteins and the Arp2/3 complex.", "journal": "The Biochemical journal", "date": "2004", "authors": "Millard TH, Sharp SJ, Machesky LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15040784", "url": "https://glygen.org/publication/PubMed/15040784" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "Crystal structure of the human T cell receptor CD3 epsilon gamma heterodimer complexed to the therapeutic mAb OKT3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Kjer-Nielsen L, Dunstone MA, Kostenko L, Ely LK, Beddoe T, Mifsud NA, Purcell AW, Brooks AG, McCluskey J, Rossjohn J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15136729", "url": "https://glygen.org/publication/PubMed/15136729" } ] }, { "title": "OSCAR is an FcRgamma-associated receptor that is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells.", "journal": "Blood", "date": "2004", "authors": "Merck E, Gaillard C, Gorman DM, Montero-Julian F, Durand I, Zurawski SM, Menetrier-Caux C, Carra G, Lebecque S, Trinchieri G, Bates EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15155468", "url": "https://glygen.org/publication/PubMed/15155468" } ] }, { "title": "Mechanism of tyrosine phosphorylation and activation of phospholipase C-gamma 1. Tyrosine 783 phosphorylation is not sufficient for lipase activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sekiya F, Poulin B, Kim YJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15161916", "url": "https://glygen.org/publication/PubMed/15161916" } ] }, { "title": "Binding of cytoplasmic proteins to the CD19 intracellular domain is high affinity, competitive, and multimeric.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Brooks SR, Kirkham PM, Freeberg L, Carter RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "15187135", "url": "https://glygen.org/publication/PubMed/15187135" } ] }, { "title": "CD200 is a ligand for all members of the CD200R family of immunoregulatory molecules.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Gorczynski R, Chen Z, Kai Y, Lee L, Wong S, Marsden PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15187158", "url": "https://glygen.org/publication/PubMed/15187158" } ] }, { "title": "The lectin-complement pathway--its role in innate immunity and evolution.", "journal": "Immunological reviews", "date": "2004", "authors": "Fujita T, Matsushita M, Endo Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "15199963", "url": "https://glygen.org/publication/PubMed/15199963" } ] }, { "title": "Phospholipases D1 and D2 coordinately regulate macrophage phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Iyer SS, Barton JA, Bourgoin S, Kusner DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15294978", "url": "https://glygen.org/publication/PubMed/15294978" } ] }, { "title": "The LILR family: modulators of innate and adaptive immune pathways in health and disease.", "journal": "Tissue antigens", "date": "2004", "authors": "Brown D, Trowsdale J, Allen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15304001", "url": "https://glygen.org/publication/PubMed/15304001" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Madsen M, Moller HJ, Nielsen MJ, Jacobsen C, Graversen JH, van den Berg T, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15448162", "url": "https://glygen.org/publication/PubMed/15448162" } ] }, { "title": "Regulation of WASP/WAVE proteins: making a long story short.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Bompard G, Caron E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15452139", "url": "https://glygen.org/publication/PubMed/15452139" } ] }, { "title": "Phospholipase C-gamma 1 and phospholipase C-gamma 2 are substrates of the B cell antigen receptor associated protein tyrosine kinase.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Roifman CM, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1550550", "url": "https://glygen.org/publication/PubMed/1550550" } ] }, { "title": "Mechanism of B-cell receptor-induced phosphorylation and activation of phospholipase C-gamma2.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kim YJ, Sekiya F, Poulin B, Bae YS, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "15509800", "url": "https://glygen.org/publication/PubMed/15509800" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Arnett KL, Harrison SC, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15534202", "url": "https://glygen.org/publication/PubMed/15534202" } ] }, { "title": "Molecular basis for a direct interaction between the Syk protein-tyrosine kinase and phosphoinositide 3-kinase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Moon KD, Post CB, Durden DL, Zhou Q, De P, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15536084", "url": "https://glygen.org/publication/PubMed/15536084" } ] }, { "title": "The SAP family of adaptors in immune regulation.", "journal": "Seminars in immunology", "date": "2004", "authors": "Latour S, Veillette A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15541655", "url": "https://glygen.org/publication/PubMed/15541655" } ] }, { "title": "The lipocalin alpha(1)-microglobulin binds heme in different species.", "journal": "Archives of biochemistry and biophysics", "date": "2004", "authors": "Larsson J, Allhorn M, Kerstrom B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15542058", "url": "https://glygen.org/publication/PubMed/15542058" } ] }, { "title": "PAK and other Rho-associated kinases--effectors with surprisingly diverse mechanisms of regulation.", "journal": "The Biochemical journal", "date": "2005", "authors": "Zhao ZS, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "15548136", "url": "https://glygen.org/publication/PubMed/15548136" } ] }, { "title": "The KIR gene family: life in the fast lane of evolution.", "journal": "European journal of immunology", "date": "2005", "authors": "Uhrberg M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15580655", "url": "https://glygen.org/publication/PubMed/15580655" } ] }, { "title": "PVR (CD155) and Nectin-2 (CD112) as ligands of the human DNAM-1 (CD226) activating receptor: involvement in tumor cell lysis.", "journal": "Molecular immunology", "date": "2005", "authors": "Pende D, Bottino C, Castriconi R, Cantoni C, Marcenaro S, Rivera P, Spaggiari GM, Dondero A, Carnemolla B, Reymond N, Mingari MC, Lopez M, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15607800", "url": "https://glygen.org/publication/PubMed/15607800" } ] }, { "title": "Abelson-interactor-1 promotes WAVE2 membrane translocation and Abelson-mediated tyrosine phosphorylation required for WAVE2 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Leng Y, Zhang J, Badour K, Arpaia E, Freeman S, Cheung P, Siu M, Siminovitch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "15657136", "url": "https://glygen.org/publication/PubMed/15657136" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "Omalizumab (Xolair) for treatment of asthma.", "journal": "American family physician", "date": "2005", "authors": "Davydov L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "15686303", "url": "https://glygen.org/publication/PubMed/15686303" } ] }, { "title": "pH- and metal ion-linked stability of the hemopexin-heme complex.", "journal": "Biochemistry", "date": "2005", "authors": "Rosell FI, Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15697213", "url": "https://glygen.org/publication/PubMed/15697213" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "CD19 function in central and peripheral B-cell development.", "journal": "Immunologic research", "date": "2005", "authors": "Del Nagro CJ, Otero DC, Anzelon AN, Omori SA, Kolla RV, Rickert RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15778510", "url": "https://glygen.org/publication/PubMed/15778510" } ] }, { "title": "Nectin-like protein 2 defines a subset of T-cell zone dendritic cells and is a ligand for class-I-restricted T-cell-associated molecule.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Galibert L, Diemer GS, Liu Z, Johnson RS, Smith JL, Walzer T, Comeau MR, Rauch CT, Wolfson MF, Sorensen RA, Van der Vuurst de Vries AR, Branstetter DG, Koelling RM, Scholler J, Fanslow WC, Baum PR, Derry JM, Yan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15781451", "url": "https://glygen.org/publication/PubMed/15781451" } ] }, { "title": "Neutrophil migration across tight junctions is mediated by adhesive interactions between epithelial coxsackie and adenovirus receptor and a junctional adhesion molecule-like protein on neutrophils.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Zen K, Liu Y, McCall IC, Wu T, Lee W, Babbin BA, Nusrat A, Parkos CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15800062", "url": "https://glygen.org/publication/PubMed/15800062" } ] }, { "title": "Phosphatidylinositol-4,5-bisphosphate hydrolysis directs actin remodeling during phagocytosis.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Scott CC, Dobson W, Botelho RJ, Coady-Osberg N, Chavrier P, Knecht DA, Heath C, Stahl P, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "15809313", "url": "https://glygen.org/publication/PubMed/15809313" } ] }, { "title": "Anti-alpha4 integrin therapy for multiple sclerosis: mechanisms and rationale.", "journal": "Neurology", "date": "2005", "authors": "Rice GP, Hartung HP, Calabresi PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15851719", "url": "https://glygen.org/publication/PubMed/15851719" } ] }, { "title": "Anatomy of CD1-lipid antigen complexes.", "journal": "Nature reviews. Immunology", "date": "2005", "authors": "Moody DB, Zajonc DM, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "15864273", "url": "https://glygen.org/publication/PubMed/15864273" } ] }, { "title": "Control of infection with Leishmania major in susceptible BALB/c mice lacking the common gamma-chain for FcR is associated with reduced production of IL-10 and TGF-beta by parasitized cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Padigel UM, Farrell JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "15879134", "url": "https://glygen.org/publication/PubMed/15879134" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Identification of the receptor scavenging hemopexin-heme complexes.", "journal": "Blood", "date": "2005", "authors": "Hvidberg V, Maniecki MB, Jacobsen C, Hojrup P, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "15947085", "url": "https://glygen.org/publication/PubMed/15947085" } ] }, { "title": "Relationships between the degree of cross-linking of surface immunoglobulin and the associated inositol 1,4,5-trisphosphate and Ca2+ signals in human B cells.", "journal": "The Biochemical journal", "date": "1992", "authors": "McConnell FM, Shears SB, Lane PJ, Scheibel MS, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1599430", "url": "https://glygen.org/publication/PubMed/1599430" } ] }, { "title": "Siglecs--the major subfamily of I-type lectins.", "journal": "Glycobiology", "date": "2006", "authors": "Varki A, Angata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16014749", "url": "https://glygen.org/publication/PubMed/16014749" } ] }, { "title": "Human high density lipoproteins are platforms for the assembly of multi-component innate immune complexes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Shiflett AM, Bishop JR, Pahwa A, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16046400", "url": "https://glygen.org/publication/PubMed/16046400" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Heterotypic interaction of CRTAM with Necl2 induces cell adhesion on activated NK cells and CD8+ T cells.", "journal": "International immunology", "date": "2005", "authors": "Arase N, Takeuchi A, Unno M, Hirano S, Yokosuka T, Arase H, Saito T", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16091383", "url": "https://glygen.org/publication/PubMed/16091383" } ] }, { "title": "Chloroquine is a potent inhibitor of SARS coronavirus infection and spread.", "journal": "Virology journal", "date": "2005", "authors": "Vincent MJ, Bergeron E, Benjannet S, Erickson BR, Rollin PE, Ksiazek TG, Seidah NG, Nichol ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16115318", "url": "https://glygen.org/publication/PubMed/16115318" } ] }, { "title": "HLA class I/NK cell receptor interaction in early human decidua basalis: possible functional consequences.", "journal": "Chemical immunology and allergy", "date": "2005", "authors": "Rabot M, Tabiasco J, Polgar B, Aguerre-Girr M, Berrebi A, Bensussan A, Strbo N, Rukavina D, Le Bouteiller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16129954", "url": "https://glygen.org/publication/PubMed/16129954" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "CD163 is the macrophage scavenger receptor for native and chemically modified hemoglobins in the absence of haptoglobin.", "journal": "Blood", "date": "2006", "authors": "Schaer DJ, Schaer CA, Buehler PW, Boykins RA, Schoedon G, Alayash AI, Schaffner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16189277", "url": "https://glygen.org/publication/PubMed/16189277" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Critical role of novel Thr-219 autophosphorylation for the cellular function of PKCtheta in T lymphocytes.", "journal": "The EMBO journal", "date": "2005", "authors": "Thuille N, Heit I, Fresser F, Krumbock N, Bauer B, Leuthaeusser S, Dammeier S, Graham C, Copeland TD, Shaw S, Baier G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16252004", "url": "https://glygen.org/publication/PubMed/16252004" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Mechanism of filament nucleation and branch stability revealed by the structure of the Arp2/3 complex at actin branch junctions.", "journal": "PLoS biology", "date": "2005", "authors": "Egile C, Rouiller I, Xu XP, Volkmann N, Li R, Hanein D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16262445", "url": "https://glygen.org/publication/PubMed/16262445" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "Cutting edge: lectin-like transcript-1 is a ligand for the inhibitory human NKR-P1A receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Rosen DB, Bettadapura J, Alsharifi M, Mathew PA, Warren HS, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16339513", "url": "https://glygen.org/publication/PubMed/16339513" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of CARMA1 plays a critical role in T Cell receptor-mediated NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Matsumoto R, Wang D, Blonska M, Li H, Kobayashi M, Pappu B, Chen Y, Wang D, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16356856", "url": "https://glygen.org/publication/PubMed/16356856" } ] }, { "title": "A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Hernandez-Caselles T, Martinez-Esparza M, Perez-Oliva AB, Quintanilla-Cecconi AM, Garcia-Alonso A, Alvarez-Lopez DM, Garcia-Penarrubia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16380601", "url": "https://glygen.org/publication/PubMed/16380601" } ] }, { "title": "Homomultimeric complexes of CD22 in B cells revealed by protein-glycan cross-linking.", "journal": "Nature chemical biology", "date": "2005", "authors": "Han S, Collins BE, Bengtson P, Paulson JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "16408005", "url": "https://glygen.org/publication/PubMed/16408005" } ] }, { "title": "Scaffolding adapter Grb2-associated binder 2 requires Syk to transmit signals from FcepsilonRI.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Yu M, Lowell CA, Neel BG, Gu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "16456001", "url": "https://glygen.org/publication/PubMed/16456001" } ] }, { "title": "The murine haemopexin receptor. Evidence that the haemopexin-binding site resides on a 20 kDa subunit and that receptor recycling is regulated by protein kinase C.", "journal": "The Biochemical journal", "date": "1991", "authors": "Smith A, Farooqui SM, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "1646599", "url": "https://glygen.org/publication/PubMed/1646599" } ] }, { "title": "Dynamics and function of phospholipase D and phosphatidic acid during phagocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Corrotte M, Chasserot-Golaz S, Huang P, Du G, Ktistakis NT, Frohman MA, Vitale N, Bader MF, Grant NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16497229", "url": "https://glygen.org/publication/PubMed/16497229" } ] }, { "title": "Chronic antidepressants potentiate via sigma-1 receptors the brain-derived neurotrophic factor-induced signaling for glutamate release.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yagasaki Y, Numakawa T, Kumamaru E, Hayashi T, Su TP, Kunugi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "16522641", "url": "https://glygen.org/publication/PubMed/16522641" } ] }, { "title": "Requirements for Vav guanine nucleotide exchange factors and Rho GTPases in FcgammaR- and complement-mediated phagocytosis.", "journal": "Immunity", "date": "2006", "authors": "Hall AB, Gakidis MA, Glogauer M, Wilsbacher JL, Gao S, Swat W, Brugge JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16546099", "url": "https://glygen.org/publication/PubMed/16546099" } ] }, { "title": "How TCRs bind MHCs, peptides, and coreceptors.", "journal": "Annual review of immunology", "date": "2006", "authors": "Rudolph MG, Stanfield RL, Wilson IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16551255", "url": "https://glygen.org/publication/PubMed/16551255" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "Hsp90 increases LIM kinase activity by promoting its homo-dimerization.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Li R, Soosairajah J, Harari D, Citri A, Price J, Ng HL, Morton CJ, Parker MW, Yarden Y, Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16641196", "url": "https://glygen.org/publication/PubMed/16641196" } ] }, { "title": "PKD at the crossroads of DAG and PKC signaling.", "journal": "Trends in pharmacological sciences", "date": "2006", "authors": "Wang QJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "16678913", "url": "https://glygen.org/publication/PubMed/16678913" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16702231", "url": "https://glygen.org/publication/PubMed/16702231" } ] }, { "title": "Structural basis for recognition of MHC and MHC-like ligands by natural killer cell receptors.", "journal": "Seminars in immunology", "date": "2006", "authors": "Deng L, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16737824", "url": "https://glygen.org/publication/PubMed/16737824" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Collagens are functional, high affinity ligands for the inhibitory immune receptor LAIR-1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Lebbink RJ, de Ruiter T, Adelmeijer J, Brenkman AB, van Helvoort JM, Koch M, Farndale RW, Lisman T, Sonnenberg A, Lenting PJ, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16754721", "url": "https://glygen.org/publication/PubMed/16754721" } ] }, { "title": "Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein.", "journal": "Blood", "date": "2006", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Oxvig C, Rees D, Moller HJ, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "16778136", "url": "https://glygen.org/publication/PubMed/16778136" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "The IRAK-1-BCL10-MALT1-TRAF6-TAK1 cascade mediates signaling to NF-kappaB from Toll-like receptor 4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dong W, Liu Y, Peng J, Chen L, Zou T, Xiao H, Liu Z, Li W, Bu Y, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16831874", "url": "https://glygen.org/publication/PubMed/16831874" } ] }, { "title": "Kinetics of B cell receptor signaling in human B cell subsets mapped by phosphospecific flow cytometry.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Irish JM, Czerwinski DK, Nolan GP, Levy R", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "16849466", "url": "https://glygen.org/publication/PubMed/16849466" } ] }, { "title": "Arp2/3 ATP hydrolysis: to branch or to debranch?", "journal": "Nature cell biology", "date": "2006", "authors": "Kovar DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "16880808", "url": "https://glygen.org/publication/PubMed/16880808" } ] }, { "title": "CD40/CD40L dyad in the inflammatory and immune responses in the central nervous system.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Chen K, Huang J, Gong W, Zhang L, Yu P, Wang JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16893496", "url": "https://glygen.org/publication/PubMed/16893496" } ] }, { "title": "The role of NK cell recognition of nectin and nectin-like proteins in tumor immunosurveillance.", "journal": "Seminars in cancer biology", "date": "2006", "authors": "Fuchs A, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16904340", "url": "https://glygen.org/publication/PubMed/16904340" } ] }, { "title": "STIM1 carboxyl-terminus activates native SOC, I(crac) and TRPC1 channels.", "journal": "Nature cell biology", "date": "2006", "authors": "Huang GN, Zeng W, Kim JY, Yuan JP, Han L, Muallem S, Worley PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "16906149", "url": "https://glygen.org/publication/PubMed/16906149" } ] }, { "title": "Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.", "journal": "Journal of leukocyte biology", "date": "2006", "authors": "Huang ZY, Barreda DR, Worth RG, Indik ZK, Kim MK, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "16921024", "url": "https://glygen.org/publication/PubMed/16921024" } ] }, { "title": "Is the CD200/CD200 receptor interaction more than just a myeloid cell inhibitory signal?", "journal": "Critical reviews in immunology", "date": "2006", "authors": "Minas K, Liversidge J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "16928187", "url": "https://glygen.org/publication/PubMed/16928187" } ] }, { "title": "Evidence of LAT as a dual substrate for Lck and Syk in T lymphocytes.", "journal": "Leukemia research", "date": "2007", "authors": "Jiang Y, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "16938345", "url": "https://glygen.org/publication/PubMed/16938345" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "Constitutive endocytosis of CD163 mediates hemoglobin-heme uptake and determines the noninflammatory and protective transcriptional response of macrophages to hemoglobin.", "journal": "Circulation research", "date": "2006", "authors": "Schaer CA, Schoedon G, Imhof A, Kurrer MO, Schaer DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17008602", "url": "https://glygen.org/publication/PubMed/17008602" } ] }, { "title": "Association of B cell antigen receptor with protein tyrosine kinase Lyn.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Yamanashi Y, Kakiuchi T, Mizuguchi J, Yamamoto T, Toyoshima K", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1702903", "url": "https://glygen.org/publication/PubMed/1702903" } ] }, { "title": "NTB-A receptor crystal structure: insights into homophilic interactions in the signaling lymphocytic activation molecule receptor family.", "journal": "Immunity", "date": "2006", "authors": "Cao E, Ramagopal UA, Fedorov A, Fedorov E, Yan Q, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17045824", "url": "https://glygen.org/publication/PubMed/17045824" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Activation of phospholipase C in human B cells is dependent on tyrosine phosphorylation.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Padeh S, Levitzki A, Gazit A, Mills GB, Roifman CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "1705565", "url": "https://glygen.org/publication/PubMed/1705565" } ] }, { "title": "Mutual activation of natural killer cells and monocytes mediated by NKp80-AICL interaction.", "journal": "Nature immunology", "date": "2006", "authors": "Welte S, Kuttruff S, Waldhauer I, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17057721", "url": "https://glygen.org/publication/PubMed/17057721" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "A unique loop extension in the serine protease domain of haptoglobin is essential for CD163 recognition of the haptoglobin-hemoglobin complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Nielsen MJ, Petersen SV, Jacobsen C, Thirup S, Enghild JJ, Graversen JH, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17102136", "url": "https://glygen.org/publication/PubMed/17102136" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "TAK1-dependent signaling requires functional interaction with TAB2/TAB3.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Besse A, Lamothe B, Campos AD, Webster WK, Maddineni U, Lin SC, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17158449", "url": "https://glygen.org/publication/PubMed/17158449" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "Lim kinases, regulators of actin dynamics.", "journal": "The international journal of biochemistry & cell biology", "date": "2007", "authors": "Bernard O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17188549", "url": "https://glygen.org/publication/PubMed/17188549" } ] }, { "title": "Effect of WAVE2 phosphorylation on activation of the Arp2/3 complex.", "journal": "Journal of biochemistry", "date": "2007", "authors": "Nakanishi O, Suetsugu S, Yamazaki D, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17202194", "url": "https://glygen.org/publication/PubMed/17202194" } ] }, { "title": "Dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in store-operated calcium influx. Evidence for similarities in store-operated and calcium release-activated calcium channel components.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Ong HL, Cheng KT, Liu X, Bandyopadhyay BC, Paria BC, Soboloff J, Pani B, Gwack Y, Srikanth S, Singh BB, Gill DL, Ambudkar IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "17224452", "url": "https://glygen.org/publication/PubMed/17224452" } ] }, { "title": "A soluble form of the MHC class I-specific CD160 receptor is released from human activated NK lymphocytes and inhibits cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Giustiniani J, Marie-Cardine A, Bensussan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17237375", "url": "https://glygen.org/publication/PubMed/17237375" } ] }, { "title": "Role of CrkII in Fcgamma receptor-mediated phagocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee WL, Cosio G, Ireton K, Grinstein S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "17308335", "url": "https://glygen.org/publication/PubMed/17308335" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Complement-mediated activation of the adaptive immune responses: role of C3d in linking the innate and adaptive immunity.", "journal": "Immunologic research", "date": "2006", "authors": "Toapanta FR, Ross TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "17337780", "url": "https://glygen.org/publication/PubMed/17337780" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "CARMA1 coiled-coil domain is involved in the oligomerization and subcellular localization of CARMA1 and is required for T cell receptor-induced NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Tanner MJ, Hanel W, Gaffen SL, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17428801", "url": "https://glygen.org/publication/PubMed/17428801" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "Calcium inhibition and calcium potentiation of Orai1, Orai2, and Orai3 calcium release-activated calcium channels.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "DeHaven WI, Smyth JT, Boyles RR, Putney JW Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "17452328", "url": "https://glygen.org/publication/PubMed/17452328" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "STIM1 heteromultimerizes TRPC channels to determine their function as store-operated channels.", "journal": "Nature cell biology", "date": "2007", "authors": "Yuan JP, Zeng W, Huang GN, Worley PF, Muallem S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "17486119", "url": "https://glygen.org/publication/PubMed/17486119" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Insights into immunoglobulin E receptor signaling from structurally defined ligands.", "journal": "Immunological reviews", "date": "2007", "authors": "Holowka D, Sil D, Torigoe C, Baird B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "17498065", "url": "https://glygen.org/publication/PubMed/17498065" } ] }, { "title": "Structure of the calcineurin-NFAT complex: defining a T cell activation switch using solution NMR and crystal coordinates.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Takeuchi K, Roehrl MH, Sun ZY, Wagner G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "17502104", "url": "https://glygen.org/publication/PubMed/17502104" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "GEFs and GAPs: critical elements in the control of small G proteins.", "journal": "Cell", "date": "2007", "authors": "Bos JL, Rehmann H, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "17540168", "url": "https://glygen.org/publication/PubMed/17540168" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "Immunoglobulin somatic hypermutation.", "journal": "Annual review of genetics", "date": "2007", "authors": "Teng Grace, Papavasiliou F Nina", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "17576170", "url": "https://glygen.org/publication/PubMed/17576170" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase.", "journal": "Gene", "date": "2007", "authors": "Takeuchi M, Harigai M, Momohara S, Ball E, Abe J, Furuichi K, Kamatani N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "17590538", "url": "https://glygen.org/publication/PubMed/17590538" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "High occupancy of sigma-1 receptors in the human brain after single oral administration of fluvoxamine: a positron emission tomography study using [11C]SA4503.", "journal": "Biological psychiatry", "date": "2007", "authors": "Ishikawa M, Ishiwata K, Ishii K, Kimura Y, Sakata M, Naganawa M, Oda K, Miyatake R, Fujisaki M, Shimizu E, Shirayama Y, Iyo M, Hashimoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "17662961", "url": "https://glygen.org/publication/PubMed/17662961" } ] }, { "title": "Hemoglobin is a co-factor of human trypanosome lytic factor.", "journal": "PLoS pathogens", "date": "2007", "authors": "Widener J, Nielsen MJ, Shiflett A, Moestrup SK, Hajduk S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "17845074", "url": "https://glygen.org/publication/PubMed/17845074" } ] }, { "title": "Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.", "journal": "The EMBO journal", "date": "2007", "authors": "Oeckinghaus A, Wegener E, Welteke V, Ferch U, Arslan SC, Ruland J, Scheidereit C, Krappmann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "17948050", "url": "https://glygen.org/publication/PubMed/17948050" } ] }, { "title": "Kit- and Fc epsilonRI-induced differential phosphorylation of the transmembrane adaptor molecule NTAL/LAB/LAT2 allows flexibility in its scaffolding function in mast cells.", "journal": "Cellular signalling", "date": "2008", "authors": "Iwaki S, Spicka J, Tkaczyk C, Jensen BM, Furumoto Y, Charles N, Kovarova M, Rivera J, Horejsi V, Metcalfe DD, Gilfillan AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "17993265", "url": "https://glygen.org/publication/PubMed/17993265" } ] }, { "title": "SYK-dependent tonic B-cell receptor signaling is a rational treatment target in diffuse large B-cell lymphoma.", "journal": "Blood", "date": "2008", "authors": "Chen L, Monti S, Juszczynski P, Daley J, Chen W, Witzig TE, Habermann TM, Kutok JL, Shipp MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18006696", "url": "https://glygen.org/publication/PubMed/18006696" } ] }, { "title": "Regulation of B-cell development by BCAP and CD19 through their binding to phosphoinositide 3-kinase.", "journal": "Blood", "date": "2008", "authors": "Aiba Y, Kameyama M, Yamazaki T, Tedder TF, Kurosaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18025150", "url": "https://glygen.org/publication/PubMed/18025150" } ] }, { "title": "Homotypic interactions mediated by Slamf1 and Slamf6 receptors control NKT cell lineage development.", "journal": "Immunity", "date": "2007", "authors": "Griewank K, Borowski C, Rietdijk S, Wang N, Julien A, Wei DG, Mamchak AA, Terhorst C, Bendelac A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18031695", "url": "https://glygen.org/publication/PubMed/18031695" } ] }, { "title": "CD1 antigen presentation: how it works.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Barral DC, Brenner MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18037897", "url": "https://glygen.org/publication/PubMed/18037897" } ] }, { "title": "Steady state kinetics of spleen tyrosine kinase investigated by a real time fluorescence assay.", "journal": "Biochemistry", "date": "2007", "authors": "Papp E, Tse JK, Ho H, Wang S, Shaw D, Lee S, Barnett J, Swinney DC, Bradshaw JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18052078", "url": "https://glygen.org/publication/PubMed/18052078" } ] }, { "title": "Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells.", "journal": "Immunity", "date": "2007", "authors": "Pogge von Strandmann E, Simhadri VR, von Tresckow B, Sasse S, Reiners KS, Hansen HP, Rothe A, Boll B, Simhadri VL, Borchmann P, McKinnon PJ, Hallek M, Engert A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18055229", "url": "https://glygen.org/publication/PubMed/18055229" } ] }, { "title": "FcgammaRIII mediates immunoglobulin G-induced interleukin-10 and is required for chronic Leishmania mexicana lesions.", "journal": "Infection and immunity", "date": "2008", "authors": "Thomas BN, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "18070890", "url": "https://glygen.org/publication/PubMed/18070890" } ] }, { "title": "Dynamic coupling of the putative coiled-coil domain of ORAI1 with STIM1 mediates ORAI1 channel activation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Muik M, Frischauf I, Derler I, Fahrner M, Bergsmann J, Eder P, Schindl R, Hesch C, Polzinger B, Fritsch R, Kahr H, Madl J, Gruber H, Groschner K, Romanin C", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18187424", "url": "https://glygen.org/publication/PubMed/18187424" } ] }, { "title": "The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Lebbink RJ, van den Berg MC, de Ruiter T, Raynal N, van Roon JA, Lenting PJ, Jin B, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18209062", "url": "https://glygen.org/publication/PubMed/18209062" } ] }, { "title": "Biophysical characterization of O-glycosylated CD99 recognition by paired Ig-like type 2 receptors.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tabata S, Kuroki K, Wang J, Kajikawa M, Shiratori I, Kohda D, Arase H, Maenaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18234675", "url": "https://glygen.org/publication/PubMed/18234675" } ] }, { "title": "The secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shen X, Li H, Ou Y, Tao W, Dong A, Kong J, Ji C, Yu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "18296442", "url": "https://glygen.org/publication/PubMed/18296442" } ] }, { "title": "Functional requirement for Orai1 in store-operated TRPC1-STIM1 channels.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng KT, Liu X, Ong HL, Ambudkar IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18326500", "url": "https://glygen.org/publication/PubMed/18326500" } ] }, { "title": "Regulation of actin assembly associated with protrusion and adhesion in cell migration.", "journal": "Physiological reviews", "date": "2008", "authors": "Le Clainche C, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "18391171", "url": "https://glygen.org/publication/PubMed/18391171" } ] }, { "title": "STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts.", "journal": "Cell calcium", "date": "2008", "authors": "Alicia S, Angelica Z, Carlos S, Alfonso S, Vaca L", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18420269", "url": "https://glygen.org/publication/PubMed/18420269" } ] }, { "title": "Hemopexin prevents endothelial damage and liver congestion in a mouse model of heme overload.", "journal": "The American journal of pathology", "date": "2008", "authors": "Vinchi F, Gastaldi S, Silengo L, Altruda F, Tolosano E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "18556779", "url": "https://glygen.org/publication/PubMed/18556779" } ] }, { "title": "Structural and functional aspects of lipid binding by CD1 molecules.", "journal": "Annual review of cell and developmental biology", "date": "2008", "authors": "Silk JD, Salio M, Brown J, Jones EY, Cerundolo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "18593354", "url": "https://glygen.org/publication/PubMed/18593354" } ] }, { "title": "Oligomerization of STIM1 couples ER calcium depletion to CRAC channel activation.", "journal": "Nature", "date": "2008", "authors": "Luik RM, Wang B, Prakriya M, Wu MM, Lewis RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18596693", "url": "https://glygen.org/publication/PubMed/18596693" } ] }, { "title": "TRAF6 specifically contributes to FcepsilonRI-mediated cytokine production but not mast cell degranulation.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Yang YJ, Chen W, Carrigan SO, Chen WM, Roth K, Akiyama T, Inoue J, Marshall JS, Berman JN, Lin TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "18772140", "url": "https://glygen.org/publication/PubMed/18772140" } ] }, { "title": "Molecular mechanism of the Syk activation switch.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tsang E, Giannetti AM, Shaw D, Dinh M, Tse JK, Gandhi S, Ho H, Wang S, Papp E, Bradshaw JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "18818202", "url": "https://glygen.org/publication/PubMed/18818202" } ] }, { "title": "Role of lipid rafts in the interaction between hTRPC1, Orai1 and STIM1.", "journal": "Channels (Austin, Tex.)", "date": "2008", "authors": "Jardin I, Salido GM, Rosado JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18843204", "url": "https://glygen.org/publication/PubMed/18843204" } ] }, { "title": "STIM1 gates TRPC channels, but not Orai1, by electrostatic interaction.", "journal": "Molecular cell", "date": "2008", "authors": "Zeng W, Yuan JP, Kim MS, Choi YJ, Huang GN, Worley PF, Muallem S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "18995841", "url": "https://glygen.org/publication/PubMed/18995841" } ] }, { "title": "p21-activated kinase regulates mast cell degranulation via effects on calcium mobilization and cytoskeletal dynamics.", "journal": "Blood", "date": "2009", "authors": "Allen JD, Jaffer ZM, Park SJ, Burgin S, Hofmann C, Sells MA, Chen S, Derr-Yellin E, Michels EG, McDaniel A, Bessler WK, Ingram DA, Atkinson SJ, Travers JB, Chernoff J, Clapp DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19124833", "url": "https://glygen.org/publication/PubMed/19124833" } ] }, { "title": "Triggering Receptor Expressed on Myeloid Cells (TREM) family and the application of its antagonists.", "journal": "Recent patents on anti-infective drug discovery", "date": "2009", "authors": "Molloy EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19149696", "url": "https://glygen.org/publication/PubMed/19149696" } ] }, { "title": "Activation loop phosphorylation modulates Bruton's tyrosine kinase (Btk) kinase domain activity.", "journal": "Biochemistry", "date": "2009", "authors": "Lin L, Czerwinski R, Kelleher K, Siegel MM, Wu P, Kriz R, Aulabaugh A, Stahl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "19206206", "url": "https://glygen.org/publication/PubMed/19206206" } ] }, { "title": "STIM1 clusters and activates CRAC channels via direct binding of a cytosolic domain to Orai1.", "journal": "Cell", "date": "2009", "authors": "Park CY, Hoover PJ, Mullins FM, Bachhawat P, Covington ED, Raunser S, Walz T, Garcia KC, Dolmetsch RE, Lewis RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "19249086", "url": "https://glygen.org/publication/PubMed/19249086" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Harrington JM, Howell S, Hajduk SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19324878", "url": "https://glygen.org/publication/PubMed/19324878" } ] }, { "title": "The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.", "journal": "Trends in immunology", "date": "2009", "authors": "Clark GJ, Ju X, Tate C, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19359216", "url": "https://glygen.org/publication/PubMed/19359216" } ] }, { "title": "SLP-65 phosphorylation dynamics reveals a functional basis for signal integration by receptor-proximal adaptor proteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Oellerich T, Gronborg M, Neumann K, Hsiao HH, Urlaub H, Wienands J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "19372136", "url": "https://glygen.org/publication/PubMed/19372136" } ] }, { "title": "Dissecting activation of the PAK1 kinase at protrusions in living cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parrini MC, Camonis J, Matsuda M, de Gunzburg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19574218", "url": "https://glygen.org/publication/PubMed/19574218" } ] }, { "title": "The CD300 molecules regulate monocyte and dendritic cell functions.", "journal": "Immunobiology", "date": "2009", "authors": "Clark GJ, Ju X, Azlan M, Tate C, Ding Y, Hart DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "19592130", "url": "https://glygen.org/publication/PubMed/19592130" } ] }, { "title": "SLP-76 couples Syk to the osteoclast cytoskeleton.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Reeve JL, Zou W, Liu Y, Maltzman JS, Ross FP, Teitelbaum SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19592646", "url": "https://glygen.org/publication/PubMed/19592646" } ] }, { "title": "Heme scavenging and the other facets of hemopexin.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Tolosano E, Fagoonee S, Morello N, Vinchi F, Fiorito V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "19650691", "url": "https://glygen.org/publication/PubMed/19650691" } ] }, { "title": "Cdc42 regulates Fc gamma receptor-mediated phagocytosis through the activation and phosphorylation of Wiskott-Aldrich syndrome protein (WASP) and neural-WASP.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Park H, Cox D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19741094", "url": "https://glygen.org/publication/PubMed/19741094" } ] }, { "title": "Adapters in the organization of mast cell signaling.", "journal": "Immunological reviews", "date": "2009", "authors": "Alvarez-Errico D, Lessmann E, Rivera J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "19909365", "url": "https://glygen.org/publication/PubMed/19909365" } ] }, { "title": "A Cdc42 activation cycle coordinated by PI 3-kinase during Fc receptor-mediated phagocytosis.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Beemiller P, Zhang Y, Mohan S, Levinsohn E, Gaeta I, Hoppe AD, Swanson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "19955216", "url": "https://glygen.org/publication/PubMed/19955216" } ] }, { "title": "Tyrosine phosphorylation of phospholipase C induced by membrane immunoglobulin in B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Carter RH, Park DJ, Rhee SG, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "2011584", "url": "https://glygen.org/publication/PubMed/2011584" } ] }, { "title": "Structure and function of immunoglobulins.", "journal": "The Journal of allergy and clinical immunology", "date": "2010-02", "authors": "Schroeder Harry W, Cavacini Lisa", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "20176268", "url": "https://glygen.org/publication/PubMed/20176268" } ] }, { "title": "Early events in B cell activation.", "journal": "Annual review of immunology", "date": "2010", "authors": "Harwood NE, Batista FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "20192804", "url": "https://glygen.org/publication/PubMed/20192804" } ] }, { "title": "Identification of a primary target of thalidomide teratogenicity.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Ito T, Ando H, Suzuki T, Ogura T, Hotta K, Imamura Y, Yamaguchi Y, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "20223979", "url": "https://glygen.org/publication/PubMed/20223979" } ] }, { "title": "The IKK complex, a central regulator of NF-kappaB activation.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Israel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20300203", "url": "https://glygen.org/publication/PubMed/20300203" } ] }, { "title": "Calcium-activated pathways and oxidative burst mediate zymosan-induced signaling and IL-10 production in human macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Kelly EK, Wang L, Ivashkiv LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "20400701", "url": "https://glygen.org/publication/PubMed/20400701" } ] }, { "title": "Metal ions and electrolytes regulate the dissociation of heme from human hemopexin at physiological pH.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Mauk MR, Mauk AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20430887", "url": "https://glygen.org/publication/PubMed/20430887" } ] }, { "title": "Antigen receptor signaling to NF-kappaB via CARMA1, BCL10, and MALT1.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Thome M, Charton JE, Pelzer C, Hailfinger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "20685844", "url": "https://glygen.org/publication/PubMed/20685844" } ] }, { "title": "Efficient inhibition of collagen-induced platelet activation and adhesion by LAIR-2, a soluble Ig-like receptor family member.", "journal": "PloS one", "date": "2010", "authors": "Lenting PJ, Westerlaken GH, Denis CV, Akkerman JW, Meyaard L", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "20730098", "url": "https://glygen.org/publication/PubMed/20730098" } ] }, { "title": "Signaling through LRP1: Protection from atherosclerosis and beyond.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Boucher P, Herz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "20920479", "url": "https://glygen.org/publication/PubMed/20920479" } ] }, { "title": "IgG1 is pathogenic in Leishmania mexicana infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Chu N, Thomas BN, Patel SR, Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "21037092", "url": "https://glygen.org/publication/PubMed/21037092" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "PANP is a novel O-glycosylated PILRalpha ligand expressed in neural tissues.", "journal": "Biochemical and biophysical research communications", "date": "2011", "authors": "Kogure A, Shiratori I, Wang J, Lanier LL, Arase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21241660", "url": "https://glygen.org/publication/PubMed/21241660" } ] }, { "title": "Local Ca(2)+ entry via Orai1 regulates plasma membrane recruitment of TRPC1 and controls cytosolic Ca(2)+ signals required for specific cell functions.", "journal": "PLoS biology", "date": "2011", "authors": "Cheng KT, Liu X, Ong HL, Swaim W, Ambudkar IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "21408196", "url": "https://glygen.org/publication/PubMed/21408196" } ] }, { "title": "ERK-MAPK drives lamellipodia protrusion by activating the WAVE2 regulatory complex.", "journal": "Molecular cell", "date": "2011", "authors": "Mendoza MC, Er EE, Zhang W, Ballif BA, Elliott HL, Danuser G, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "21419341", "url": "https://glygen.org/publication/PubMed/21419341" } ] }, { "title": "Complex phosphorylation dynamics control the composition of the Syk interactome in B cells.", "journal": "European journal of immunology", "date": "2011", "authors": "Bohnenberger H, Oellerich T, Engelke M, Hsiao HH, Urlaub H, Wienands J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "21469132", "url": "https://glygen.org/publication/PubMed/21469132" } ] }, { "title": "Gab2, via PI-3K, regulates ARF1 in FcepsilonRI-mediated granule translocation and mast cell degranulation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Nishida K, Yamasaki S, Hasegawa A, Iwamatsu A, Koseki H, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "21653832", "url": "https://glygen.org/publication/PubMed/21653832" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "Specific lipid recognition is a general feature of CD300 and TREM molecules.", "journal": "Immunogenetics", "date": "2012", "authors": "Cannon JP, O'Driscoll M, Litman GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21800138", "url": "https://glygen.org/publication/PubMed/21800138" } ] }, { "title": "The B-cell antigen receptor signals through a preformed transducer module of SLP65 and CIN85.", "journal": "The EMBO journal", "date": "2011", "authors": "Oellerich T, Bremes V, Neumann K, Bohnenberger H, Dittmann K, Hsiao HH, Engelke M, Schnyder T, Batista FD, Urlaub H, Wienands J", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "21822214", "url": "https://glygen.org/publication/PubMed/21822214" } ] }, { "title": "OSCAR is a collagen receptor that costimulates osteoclastogenesis in DAP12-deficient humans and mice.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Barrow AD, Raynal N, Andersen TL, Slatter DA, Bihan D, Pugh N, Cella M, Kim T, Rho J, Negishi-Koga T, Delaisse JM, Takayanagi H, Lorenzo J, Colonna M, Farndale RW, Choi Y, Trowsdale J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21841309", "url": "https://glygen.org/publication/PubMed/21841309" } ] }, { "title": "B7-H6/NKp30 interaction: a mechanism of alerting NK cells against tumors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kaifu T, Escaliere B, Gastinel LN, Vivier E, Baratin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "21877119", "url": "https://glygen.org/publication/PubMed/21877119" } ] }, { "title": "Oligomeric structure of the MALT1 tandem Ig-like domains.", "journal": "PloS one", "date": "2011", "authors": "Qiu L, Dhe-Paganon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "21966355", "url": "https://glygen.org/publication/PubMed/21966355" } ] }, { "title": "Molecular programming of B cell memory.", "journal": "Nature reviews. Immunology", "date": "2011-12-09", "authors": "McHeyzer-Williams Michael, Okitsu Shinji, Wang Nathaniel, McHeyzer-Williams Louise", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "22158414", "url": "https://glygen.org/publication/PubMed/22158414" } ] }, { "title": "The Bruton tyrosine kinase inhibitor PCI-32765 thwarts chronic lymphocytic leukemia cell survival and tissue homing in vitro and in vivo.", "journal": "Blood", "date": "2012", "authors": "Ponader S, Chen SS, Buggy JJ, Balakrishnan K, Gandhi V, Wierda WG, Keating MJ, O'Brien S, Chiorazzi N, Burger JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "22180443", "url": "https://glygen.org/publication/PubMed/22180443" } ] }, { "title": "The Ca(2+) sensor stromal interaction molecule 1 (STIM1) is necessary and sufficient for the store-operated Ca(2+) entry function of transient receptor potential canonical (TRPC) 1 and 4 channels in endothelial cells.", "journal": "Molecular pharmacology", "date": "2012", "authors": "Sundivakkam PC, Freichel M, Singh V, Yuan JP, Vogel SM, Flockerzi V, Malik AB, Tiruppathi C", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "22210847", "url": "https://glygen.org/publication/PubMed/22210847" } ] }, { "title": "Evolutionarily conserved paired immunoglobulin-like receptor alpha (PILRalpha) domain mediates its interaction with diverse sialylated ligands.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sun Y, Senger K, Baginski TK, Mazloom A, Chinn Y, Pantua H, Hamidzadeh K, Ramani SR, Luis E, Tom I, Sebrell A, Quinones G, Ma Y, Mukhyala K, Sai T, Ding J, Haley B, Shadnia H, Kapadia SB, Gonzalez LC, Hass PE, Zarrin AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "22396535", "url": "https://glygen.org/publication/PubMed/22396535" } ] }, { "title": "An extension of hypotheses regarding rapid-acting, treatment-refractory, and conventional antidepressant activity of dextromethorphan and dextrorphan.", "journal": "Medical hypotheses", "date": "2012", "authors": "Lauterbach EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22401777", "url": "https://glygen.org/publication/PubMed/22401777" } ] }, { "title": "Insertion of heme b into the structure of the Cys34-carbamidomethylated human lipocalin alpha(1)-microglobulin: formation of a [(heme)(2) (alpha(1)-Microglobulin)](3) complex.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2012", "authors": "Siebel JF, Kosinsky RL, Akerstrom B, Knipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22492620", "url": "https://glygen.org/publication/PubMed/22492620" } ] }, { "title": "Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide.", "journal": "Leukemia", "date": "2012", "authors": "Lopez-Girona A, Mendy D, Ito T, Miller K, Gandhi AK, Kang J, Karasawa S, Carmel G, Jackson P, Abbasian M, Mahmoudi A, Cathers B, Rychak E, Gaidarova S, Chen R, Schafer PH, Handa H, Daniel TO, Evans JF, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22552008", "url": "https://glygen.org/publication/PubMed/22552008" } ] }, { "title": "Regulation of PKC-theta function by phosphorylation in T cell receptor signaling.", "journal": "Frontiers in immunology", "date": "2012", "authors": "Wang X, Chuang HC, Li JP, Tan TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837" } ], "reference": [ { "type": "PubMed", "id": "22798961", "url": "https://glygen.org/publication/PubMed/22798961" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "An overview of tubulin inhibitors that interact with the colchicine binding site.", "journal": "Pharmaceutical research", "date": "2012", "authors": "Lu Y, Chen J, Xiao M, Li W, Miller DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "22814904", "url": "https://glygen.org/publication/PubMed/22814904" } ] }, { "title": "Structure of the haptoglobin-haemoglobin complex.", "journal": "Nature", "date": "2012", "authors": "Andersen CB, Torvund-Jensen M, Nielsen MJ, de Oliveira CL, Hersleth HP, Andersen NH, Pedersen JS, Andersen GR, Moestrup SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "22922649", "url": "https://glygen.org/publication/PubMed/22922649" } ] }, { "title": "Molecular components of the B cell antigen receptor complex of class IgD differ partly from those of IgM.", "journal": "The EMBO journal", "date": "1990", "authors": "Wienands J, Hombach J, Radbruch A, Riesterer C, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "2303036", "url": "https://glygen.org/publication/PubMed/2303036" } ] }, { "title": "Molecular components of the B-cell antigen receptor complex of the IgM class.", "journal": "Nature", "date": "1990", "authors": "Hombach J, Tsubata T, Leclercq L, Stappert H, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "2304550", "url": "https://glygen.org/publication/PubMed/2304550" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "From alpha4beta2 Nicotinic Ligands to the Discovery of sigma1 Receptor Ligands: Pharmacophore Analysis and Rational Design.", "journal": "ACS medicinal chemistry letters", "date": "2012", "authors": "Yu LF, Zhang HK, Gunosewoyo H, Kozikowski AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "23641311", "url": "https://glygen.org/publication/PubMed/23641311" } ] }, { "title": "Leishmania mexicana infection induces IgG to parasite surface glycoinositol phospholipids that can induce IL-10 in mice and humans.", "journal": "PLoS neglected tropical diseases", "date": "2013", "authors": "Buxbaum LU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "23675550", "url": "https://glygen.org/publication/PubMed/23675550" } ] }, { "title": "CS1 (SLAMF7) inhibits production of proinflammatory cytokines by activated monocytes.", "journal": "Inflammation research : official journal of the European Histamine Research Society ... [et al.]", "date": "2013", "authors": "Kim JR, Horton NC, Mathew SO, Mathew PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23695528", "url": "https://glygen.org/publication/PubMed/23695528" } ] }, { "title": "CD22 ligand-binding and signaling domains reciprocally regulate B-cell Ca2+ signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Muller J, Obermeier I, Wohner M, Brandl C, Mrotzek S, Angermuller S, Maity PC, Reth M, Nitschke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "23836650", "url": "https://glygen.org/publication/PubMed/23836650" } ] }, { "title": "Genetically coupled receptor-ligand pair NKp80-AICL enables autonomous control of human NK cell responses.", "journal": "Blood", "date": "2013", "authors": "Klimosch SN, Bartel Y, Wiemann S, Steinle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "23929856", "url": "https://glygen.org/publication/PubMed/23929856" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2013", "authors": "Lucas X, Wohlwend D, Hugle M, Schmidtkunz K, Gerhardt S, Schule R, Jung M, Einsle O, Gunther S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24272870", "url": "https://glygen.org/publication/PubMed/24272870" } ] }, { "title": "BAG-6, a jack of all trades in health and disease.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2014", "authors": "Binici J, Koch J", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "24305946", "url": "https://glygen.org/publication/PubMed/24305946" } ] }, { "title": "Dual kinase-bromodomain inhibitors for rationally designed polypharmacology.", "journal": "Nature chemical biology", "date": "2014", "authors": "Ciceri P, Muller S, O'Mahony A, Fedorov O, Filippakopoulos P, Hunt JP, Lasater EA, Pallares G, Picaud S, Wells C, Martin S, Wodicka LM, Shah NP, Treiber DK, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "24584101", "url": "https://glygen.org/publication/PubMed/24584101" } ] }, { "title": "Immunoglobulin and T Cell Receptor Genes: IMGT(\u00ae) and the Birth and Rise of Immunoinformatics.", "journal": "Frontiers in immunology", "date": "2014", "authors": "Lefranc Marie-Paule", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "24600447", "url": "https://glygen.org/publication/PubMed/24600447" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "Human Fc gamma RIII (CD16). Isoforms with distinct allelic expression, extracellular domains, and membrane linkages on polymorphonuclear and natural killer cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1989", "authors": "Edberg JC, Redecha PB, Salmon JE, Kimberly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2474607", "url": "https://glygen.org/publication/PubMed/2474607" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "Directed evolution of human heavy chain variable domain (VH) using in vivo protein fitness filter.", "journal": "PLoS ONE", "date": "2014", "authors": "Kim Dong-Sik, Song Hyung-Nam, Nam Hyo Jung, Kim Sung-Geun, Park Young-Seoub, Park Jae-Chan, Woo Eui-Jeon, Lim Hyung-Kwon", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "24892548", "url": "https://glygen.org/publication/PubMed/24892548" } ] }, { "title": "Pharmacokinetics, pharmacodynamics and safety of QGE031 (ligelizumab), a novel high-affinity anti-IgE antibody, in atopic subjects.", "journal": "Clinical and experimental allergy : journal of the British Society for Allergy and Clinical Immunology", "date": "2014", "authors": "Arm JP, Bottoli I, Skerjanec A, Floch D, Groenewegen A, Maahs S, Owen CE, Jones I, Lowe PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "25200415", "url": "https://glygen.org/publication/PubMed/25200415" } ] }, { "title": "Structure and expression of human IgG FcRII(CD32). Functional heterogeneity is encoded by the alternatively spliced products of multiple genes.", "journal": "The Journal of experimental medicine", "date": "1989", "authors": "Brooks DG, Qiu WQ, Luster AD, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "2529342", "url": "https://glygen.org/publication/PubMed/2529342" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "CD1 and mycobacterial lipids activate human T cells.", "journal": "Immunological reviews", "date": "2015", "authors": "Van Rhijn I, Moody DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25703557", "url": "https://glygen.org/publication/PubMed/25703557" } ] }, { "title": "OSCAR is a receptor for surfactant protein D that activates TNF-alpha release from human CCR2+ inflammatory monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Barrow AD, Palarasah Y, Bugatti M, Holehouse AS, Byers DE, Holtzman MJ, Vermi W, Skjodt K, Crouch E, Colonna M", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "25716998", "url": "https://glygen.org/publication/PubMed/25716998" } ] }, { "title": "Structure guided design of potent and selective ponatinib-based hybrid inhibitors for RIPK1.", "journal": "Cell reports", "date": "2015", "authors": "Najjar M, Suebsuwong C, Ray SS, Thapa RJ, Maki JL, Nogusa S, Shah S, Saleh D, Gough PJ, Bertin J, Yuan J, Balachandran S, Cuny GD, Degterev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "25801024", "url": "https://glygen.org/publication/PubMed/25801024" } ] }, { "title": "CC-122, a pleiotropic pathway modifier, mimics an interferon response and has antitumor activity in DLBCL.", "journal": "Blood", "date": "2015", "authors": "Hagner PR, Man HW, Fontanillo C, Wang M, Couto S, Breider M, Bjorklund C, Havens CG, Lu G, Rychak E, Raymon H, Narla RK, Barnes L, Khambatta G, Chiu H, Kosek J, Kang J, Amantangelo MD, Waldman M, Lopez-Girona A, Cai T, Pourdehnad M, Trotter M, Daniel TO, Schafer PH, Klippel A, Thakurta A, Chopra R, Gandhi AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "26002965", "url": "https://glygen.org/publication/PubMed/26002965" } ] }, { "title": "IL-10 Production in Macrophages Is Regulated by a TLR-Driven CREB-Mediated Mechanism That Is Linked to Genes Involved in Cell Metabolism.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Sanin DE, Prendergast CT, Mountford AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "26116503", "url": "https://glygen.org/publication/PubMed/26116503" } ] }, { "title": "Activation of human T cells by CD1 and self-lipids.", "journal": "Immunological reviews", "date": "2015", "authors": "de Jong A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26284469", "url": "https://glygen.org/publication/PubMed/26284469" } ] }, { "title": "Recognition of Microbial Glycolipids by Natural Killer T Cells.", "journal": "Frontiers in immunology", "date": "2015", "authors": "Zajonc DM, Girardi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "26300885", "url": "https://glygen.org/publication/PubMed/26300885" } ] }, { "title": "Serum proteins as mediators of hemin efflux from red cell membranes: specificity of hemopexin.", "journal": "FEBS letters", "date": "1989", "authors": "Solar I, Muller-Eberhard U, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2806549", "url": "https://glygen.org/publication/PubMed/2806549" } ] }, { "title": "Importance of ligand-induced conformational changes in hemopexin for receptor-mediated heme transport.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Smith A, Tatum FM, Muster P, Burch MK, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "2833500", "url": "https://glygen.org/publication/PubMed/2833500" } ] }, { "title": "Type I phosphatidylinositol kinase makes a novel inositol phospholipid, phosphatidylinositol-3-phosphate.", "journal": "Nature", "date": "1988", "authors": "Whitman M, Downes CP, Keeler M, Keller T, Cantley L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2730905", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905" } ], "reference": [ { "type": "PubMed", "id": "2833705", "url": "https://glygen.org/publication/PubMed/2833705" } ] }, { "title": "A Cereblon Modulator (CC-220) with Improved Degradation of Ikaros and Aiolos.", "journal": "Journal of medicinal chemistry", "date": "2018", "authors": "Matyskiela ME, Zhang W, Man HW, Muller G, Khambatta G, Baculi F, Hickman M, LeBrun L, Pagarigan B, Carmel G, Lu CC, Lu G, Riley M, Satoh Y, Schafer P, Daniel TO, Carmichael J, Cathers BE, Chamberlain PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "28425720", "url": "https://glygen.org/publication/PubMed/28425720" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Cereblon modulator iberdomide induces degradation of the transcription factors Ikaros and Aiolos: immunomodulation in healthy volunteers and relevance to systemic lupus erythematosus.", "journal": "Annals of the rheumatic diseases", "date": "2018", "authors": "Schafer PH, Ye Y, Wu L, Kosek J, Ringheim G, Yang Z, Liu L, Thomas M, Palmisano M, Chopra R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "29945920", "url": "https://glygen.org/publication/PubMed/29945920" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "A First-in-Human Study of Novel Cereblon Modulator Avadomide (CC-122) in Advanced Malignancies.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2019", "authors": "Rasco DW, Papadopoulos KP, Pourdehnad M, Gandhi AK, Hagner PR, Li Y, Wei X, Chopra R, Hege K, DiMartino J, Shih K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "30201761", "url": "https://glygen.org/publication/PubMed/30201761" } ] }, { "title": "Targeting RIPK1 for the treatment of human diseases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Degterev A, Ofengeim D, Yuan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9679191", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191" } ], "reference": [ { "type": "PubMed", "id": "31048504", "url": "https://glygen.org/publication/PubMed/31048504" } ] }, { "title": "Response of human B cells to different anti-immunoglobulin isotypes: absence of a correlation between early activation events and cell proliferation.", "journal": "European journal of immunology", "date": "1987", "authors": "Roifman CM, Mills GB, Stewart D, Cheung RK, Grinstein S, Gelfand EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "3500860", "url": "https://glygen.org/publication/PubMed/3500860" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Organization and sequences of the diversity, joining, and constant region genes of the human T-cell receptor beta chain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Toyonaga B, Yoshikai Y, Vadasz V, Chin B, Mak T W", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "3866244", "url": "https://glygen.org/publication/PubMed/3866244" } ] }, { "title": "Hemopexin-mediated heme transport to the liver. Evidence for a heme-binding protein in liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "3891754", "url": "https://glygen.org/publication/PubMed/3891754" } ] }, { "title": "Kinetics of hemoprotein reduction and interprotein heme transfer.", "journal": "Biochemistry", "date": "1985", "authors": "Pasternack RF, Gibbs EJ, Mauk AG, Reid LS, Wong NM, Kurokawa K, Hashim M, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4074707", "url": "https://glygen.org/publication/PubMed/4074707" } ] }, { "title": "Immunoglobulin structure and genetics. Identity between variable regions of a mu and a gamma2 chain.", "journal": "J. Biol. Chem.", "date": "1977", "authors": "Wang A C, Wang I Y, Fudenberg H H", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "409716", "url": "https://glygen.org/publication/PubMed/409716" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Structure of antibodies with shared idiotypy: the complete sequence of the heavy chain variable regions of two immunoglobulin M anti-gamma globulins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1974", "authors": "Capra J D, Kehoe J M", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "4139708", "url": "https://glygen.org/publication/PubMed/4139708" } ] }, { "title": "Some spectral properties of the human hemoglobin-haptoglobin complex.", "journal": "Biochemistry", "date": "1971", "authors": "Hamaguchi H, Isomoto A, Miyake Y, Nakajima H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "4327491", "url": "https://glygen.org/publication/PubMed/4327491" } ] }, { "title": "Variable region sequences of five human immunoglobulin heavy chains of the VH3 subgroup: definitive identification of four heavy chain hypervariable regions.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1974", "authors": "Capra J D, Kehoe J M", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "4522793", "url": "https://glygen.org/publication/PubMed/4522793" } ] }, { "title": "Occurrence of surface IgM, IgD, and free light chains of human lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1974", "authors": "Fu SM, Winchester RJ, Kunkel HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "4589993", "url": "https://glygen.org/publication/PubMed/4589993" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Haem transport to the liver by haemopexin. Receptor-mediated uptake with recycling of the protein.", "journal": "The Biochemical journal", "date": "1979", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "496916", "url": "https://glygen.org/publication/PubMed/496916" } ] }, { "title": "Studies on the structures of haptoglobin 1-1 and hemoglobin in the haptoglobin-hemoglobin complex.", "journal": "Biochemical and biophysical research communications", "date": "1971", "authors": "Waks M, Kahn PC, Beychok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "5135507", "url": "https://glygen.org/publication/PubMed/5135507" } ] }, { "title": "Formation and functional significance of a molecular complex derived from the second and the fourth component of human complement.", "journal": "The Journal of experimental medicine", "date": "1967", "authors": "Muller-Eberhard HJ, Polley MJ, Calcott MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "6019133", "url": "https://glygen.org/publication/PubMed/6019133" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "Enhanced tyrosine phosphorylation in B lymphocytes upon complexing of membrane immunoglobulin.", "journal": "Biochemical and biophysical research communications", "date": "1984", "authors": "Nel AE, Landreth GE, Goldschmidt-Clermont PJ, Tung HE, Galbraith RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "6335036", "url": "https://glygen.org/publication/PubMed/6335036" } ] }, { "title": "Structure and multiplicity of genes for the human immunoglobulin heavy chain variable region.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1980", "authors": "Matthyssens G, Rabbitts TH", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "6450418", "url": "https://glygen.org/publication/PubMed/6450418" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Hemopexin-mediated heme uptake by liver. Characterization of the interaction of heme-hemopexin with isolated rabbit liver plasma membranes.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6480598", "url": "https://glygen.org/publication/PubMed/6480598" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "Hemin binding to serum proteins and the catalysis of interprotein transfer.", "journal": "Biochemistry", "date": "1983", "authors": "Pasternack RF, Gibbs EJ, Hoeflin E, Kosar WP, Kubera G, Skowronek CA, Wong NM, Muller-Eberhard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "6849882", "url": "https://glygen.org/publication/PubMed/6849882" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C2 by C1s into the antigenically distinct fragments C2a and C2b: demonstration of binding of C2b to C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1977", "authors": "Nagasawa S, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "70787", "url": "https://glygen.org/publication/PubMed/70787" } ] }, { "title": "Haptoglobin-hemoglobin complex. Subunit interaction probed by cross-linking.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Greer J, Liao WD, Brown WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7263686", "url": "https://glygen.org/publication/PubMed/7263686" } ] }, { "title": "Hemopexin-mediated transport of heme into isolated rat hepatocytes.", "journal": "The Journal of biological chemistry", "date": "1981", "authors": "Smith A, Morgan WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7287740", "url": "https://glygen.org/publication/PubMed/7287740" } ] }, { "title": "Haemoglobin binding with haptoglobin. Unequivocal demonstration that the beta-chains of human haemoglobin bind to haptoglobin.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kazim AL, Atassi MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "7378053", "url": "https://glygen.org/publication/PubMed/7378053" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Interaction between the labile binding sites of the fourth (C4) and fifth (C5) human complement proteins and erythrocyte cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Law SK, Lichtenberg NA, Holcombe FH, Levine RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "7391573", "url": "https://glygen.org/publication/PubMed/7391573" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "Clustering of the high affinity Fc receptor for immunoglobulin G (Fc gamma RI) results in phosphorylation of its associated gamma-chain.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Duchemin AM, Ernst LK, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7512959", "url": "https://glygen.org/publication/PubMed/7512959" } ] }, { "title": "The high affinity Fc gamma receptor (CD64) induces phagocytosis in the absence of its cytoplasmic domain: the gamma subunit of Fc gamma RIIIA imparts phagocytic function to Fc gamma RI.", "journal": "Experimental hematology", "date": "1994", "authors": "Indik ZK, Hunter S, Huang MM, Pan XQ, Chien P, Kelly C, Levinson AI, Kimberly RP, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7516890", "url": "https://glygen.org/publication/PubMed/7516890" } ] }, { "title": "Tyrosine phosphorylation of phospholipase C-gamma 2 is involved in the activation of phosphoinositide hydrolysis by Fc receptors in human neutrophils.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Dusi S, Donini M, Della Bianca V, Rossi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "7517665", "url": "https://glygen.org/publication/PubMed/7517665" } ] }, { "title": "Tyrosine phosphorylation and activation of Bruton tyrosine kinase upon Fc epsilon RI cross-linking.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kawakami Y, Yao L, Miura T, Tsukada S, Witte ON, Kawakami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "7518558", "url": "https://glygen.org/publication/PubMed/7518558" } ] }, { "title": "Substitutions and deletions in the cytoplasmic domain of the phagocytic receptor Fc gamma RIIA: effect on receptor tyrosine phosphorylation and phagocytosis.", "journal": "Blood", "date": "1994", "authors": "Mitchell MA, Huang MM, Chien P, Indik ZK, Pan XQ, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7521687", "url": "https://glygen.org/publication/PubMed/7521687" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "Protein-tyrosine kinase p72syk in Fc gamma RI receptor signaling.", "journal": "Blood", "date": "1994", "authors": "Durden DL, Liu YB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7522622", "url": "https://glygen.org/publication/PubMed/7522622" } ] }, { "title": "Temporal differences in the activation of three classes of non-transmembrane protein tyrosine kinases following B-cell antigen receptor surface engagement.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Saouaf SJ, Mahajan S, Rowley RB, Kut SA, Fargnoli J, Burkhardt AL, Tsukada S, Witte ON, Bolen JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7524079", "url": "https://glygen.org/publication/PubMed/7524079" } ] }, { "title": "Transphosphorylation as the mechanism by which the high-affinity receptor for IgE is phosphorylated upon aggregation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Pribluda VS, Pribluda C, Metzger H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "7526393", "url": "https://glygen.org/publication/PubMed/7526393" } ] }, { "title": "Signaling through CD19 activates Vav/mitogen-activated protein kinase pathway and induces formation of a CD19/Vav/phosphatidylinositol 3-kinase complex in human B cell precursors.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Weng WK, Jarvis L, LeBien TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7528218", "url": "https://glygen.org/publication/PubMed/7528218" } ] }, { "title": "Interaction of p72syk with the gamma and beta subunits of the high-affinity receptor for immunoglobulin E, Fc epsilon RI.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Shiue L, Green J, Green OM, Karas JL, Morgenstern JP, Ram MK, Taylor MK, Zoller MJ, Zydowsky LD, Bolen JB, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "7528327", "url": "https://glygen.org/publication/PubMed/7528327" } ] }, { "title": "Tyrosine phosphorylation and association of Syk with Fc gamma RII in monocytic THP-1 cells.", "journal": "The Biochemical journal", "date": "1995", "authors": "Ghazizadeh S, Bolen JB, Fleit HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7530449", "url": "https://glygen.org/publication/PubMed/7530449" } ] }, { "title": "Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 A resolution.", "journal": "Nature", "date": "1995", "authors": "Jones EY, Harlos K, Bottomley MJ, Robinson RC, Driscoll PC, Edwards RM, Clements JM, Dudgeon TJ, Stuart DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7531291", "url": "https://glygen.org/publication/PubMed/7531291" } ] }, { "title": "Syk protein-tyrosine kinase is regulated by tyrosine-phosphorylated Ig alpha/Ig beta immunoreceptor tyrosine activation motif binding and autophosphorylation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Rowley RB, Burkhardt AL, Chao HG, Matsueda GR, Bolen JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7538118", "url": "https://glygen.org/publication/PubMed/7538118" } ] }, { "title": "CD1-restricted T cell recognition of microbial lipoglycan antigens.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Sieling PA, Chatterjee D, Porcelli SA, Prigozy TI, Mazzaccaro RJ, Soriano T, Bloom BR, Brenner MB, Kronenberg M, Brennan PJ, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "7542404", "url": "https://glygen.org/publication/PubMed/7542404" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Up-regulation of monocytic IL-10 by tumor necrosis factor-alpha and cAMP elevating drugs.", "journal": "International immunology", "date": "1995", "authors": "Platzer C, Meisel C, Vogt K, Platzer M, Volk HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "7547677", "url": "https://glygen.org/publication/PubMed/7547677" } ] }, { "title": "Ig domains 1 and 2 of murine CD22 constitute the ligand-binding domain and bind multiple sialylated ligands expressed on B and T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Law CL, Aruffo A, Chandran KA, Doty RT, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "7561031", "url": "https://glygen.org/publication/PubMed/7561031" } ] }, { "title": "Reconstitution of the B cell antigen receptor signaling components in COS cells.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Saouaf SJ, Kut SA, Fargnoli J, Rowley RB, Bolen JB, Mahajan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7592958", "url": "https://glygen.org/publication/PubMed/7592958" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "A role in B cell activation for CD22 and the protein tyrosine phosphatase SHP.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Doody GM, Justement LB, Delibrias CC, Matthews RJ, Lin J, Thomas ML, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "7618087", "url": "https://glygen.org/publication/PubMed/7618087" } ] }, { "title": "Nucleotidic sequence analysis of the variable domains of four human monoclonal IgM with an antibody activity to myelin-associated glycoprotein.", "journal": "Eur. J. Immunol.", "date": "1993", "authors": "Mariette X, Tsapis A, Brouet JC", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "reference": [ { "type": "PubMed", "id": "7681398", "url": "https://glygen.org/publication/PubMed/7681398" } ] }, { "title": "CD19 is a substrate of the antigen receptor-associated protein tyrosine kinase in human B cells.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Roifman CM, Ke S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7687428", "url": "https://glygen.org/publication/PubMed/7687428" } ] }, { "title": "Tyrosine phosphorylation of CD19 in pre-B and mature B cells.", "journal": "The EMBO journal", "date": "1993", "authors": "Chalupny NJ, Kanner SB, Schieven GL, Wee SF, Gilliland LK, Aruffo A, Ledbetter JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7687539", "url": "https://glygen.org/publication/PubMed/7687539" } ] }, { "title": "Signal transduction by immunoglobulin is mediated through Ig alpha and Ig beta.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Sanchez M, Misulovin Z, Burkhardt AL, Mahajan S, Costa T, Franke R, Bolen JB, Nussenzweig M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7688784", "url": "https://glygen.org/publication/PubMed/7688784" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Signal transduction through the CD19 receptor during discrete developmental stages of human B-cell ontogeny.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Uckun FM, Burkhardt AL, Jarvis L, Jun X, Stealey B, Dibirdik I, Myers DE, Tuel-Ahlgren L, Bolen JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7691807", "url": "https://glygen.org/publication/PubMed/7691807" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Binding of human plasma sialoglycoproteins by the B cell-specific lectin CD22. Selective recognition of immunoglobulin M and haptoglobin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Hanasaki K, Powell LD, Varki A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "7706301", "url": "https://glygen.org/publication/PubMed/7706301" } ] }, { "title": "Identification of signaling motifs within human Fc gamma RIIa and Fc gamma RIIb isoforms.", "journal": "Blood", "date": "1995", "authors": "Van den Herik-Oudijk IE, Capel PJ, van der Bruggen T, Van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "7718892", "url": "https://glygen.org/publication/PubMed/7718892" } ] }, { "title": "Kiz-1, a protein with LIM zinc finger and kinase domains, is expressed mainly in neurons.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "1994", "authors": "Bernard O, Ganiatsas S, Kannourakis G, Dringen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "7848918", "url": "https://glygen.org/publication/PubMed/7848918" } ] }, { "title": "MAPKs: new JNK expands the group.", "journal": "Trends in biochemical sciences", "date": "1994", "authors": "Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7855889", "url": "https://glygen.org/publication/PubMed/7855889" } ] }, { "title": "Tyrosine phosphorylation of MB-1, B29, and HS1 proteins in human B cells following receptor crosslinking.", "journal": "Immunology letters", "date": "1994", "authors": "Hata D, Nakamura T, Kawakami T, Kawakami Y, Herren B, Mayumi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "7927516", "url": "https://glygen.org/publication/PubMed/7927516" } ] }, { "title": "Activation of stress-activated protein kinase by MEKK1 phosphorylation of its activator SEK1.", "journal": "Nature", "date": "1994", "authors": "Yan M, Dai T, Deak JC, Kyriakis JM, Zon LI, Woodgett JR, Templeton DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "7997270", "url": "https://glygen.org/publication/PubMed/7997270" } ] }, { "title": "Similar idiotypic specificity for the membrane IgD and IgM of human B lymphocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1975", "authors": "Fu SM, Winchester RJ, Kunkel HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "803528", "url": "https://glygen.org/publication/PubMed/803528" } ] }, { "title": "Src homology 2 domains of Syk and Lyn bind to tyrosine-phosphorylated subunits of the high affinity IgE receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Kihara H, Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "8071371", "url": "https://glygen.org/publication/PubMed/8071371" } ] }, { "title": "Physicochemical and functional characterization of the C1r subunit of the first complement component.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1976", "authors": "Ziccardi RJ, Cooper NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173623", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623" } ], "reference": [ { "type": "PubMed", "id": "814163", "url": "https://glygen.org/publication/PubMed/814163" } ] }, { "title": "Molecular cloning of human Syk. A B cell protein-tyrosine kinase associated with the surface immunoglobulin M-B cell receptor complex.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Law CL, Sidorenko SP, Chandran KA, Draves KE, Chan AC, Weiss A, Edelhoff S, Disteche CM, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "8163536", "url": "https://glygen.org/publication/PubMed/8163536" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "Gene for familial psoriasis susceptibility mapped to the distal end of human chromosome 17q.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Tomfohrde J, Silverman A, Barnes R, Fernandez-Vina MA, Young M, Lory D, Morris L, Wuepper KD, Stastny P, Menter A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8178173", "url": "https://glygen.org/publication/PubMed/8178173" } ] }, { "title": "Cross-linking of Fc gamma receptor I (Fc gamma RI) and receptor II (Fc gamma RII) on monocytic cells activates a signal transduction pathway common to both Fc receptors that involves the stimulation of p72 Syk protein tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Kiener PA, Rankin BM, Burkhardt AL, Schieven GL, Gilliland LK, Rowley RB, Bolen JB, Ledbetter JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8226994", "url": "https://glygen.org/publication/PubMed/8226994" } ] }, { "title": "Immunoglobulin G-mediated phagocytosis activates a calcium-independent, phosphatidylethanolamine-specific phospholipase.", "journal": "Journal of leukocyte biology", "date": "1993", "authors": "Lennartz MR, Lefkowith JB, Bromley FA, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8228618", "url": "https://glygen.org/publication/PubMed/8228618" } ] }, { "title": "Dual role of the tyrosine activation motif of the Ig-alpha protein during signal transduction via the B cell antigen receptor.", "journal": "The EMBO journal", "date": "1994", "authors": "Flaswinkel H, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "8306975", "url": "https://glygen.org/publication/PubMed/8306975" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "Association of the high-affinity receptor for IgG (Fc gamma RI) with the gamma subunit of the IgE receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Ernst LK, Duchemin AM, Anderson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8327478", "url": "https://glygen.org/publication/PubMed/8327478" } ] }, { "title": "Involvement of p72syk, a protein-tyrosine kinase, in Fc gamma receptor signaling.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Agarwal A, Salem P, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8340414", "url": "https://glygen.org/publication/PubMed/8340414" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "In vivo fate of hemopexin and heme-hemopexin complexes in the rat.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Potter D, Chroneos ZC, Baynes JW, Sinclair PR, Gorman N, Liem HH, Muller-Eberhard U, Thorpe SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8424694", "url": "https://glygen.org/publication/PubMed/8424694" } ] }, { "title": "CD22 associates with the human surface IgM-B-cell antigen receptor complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Leprince C, Draves KE, Geahlen RL, Ledbetter JA, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "8475064", "url": "https://glygen.org/publication/PubMed/8475064" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "The reaction mechanism of the internal thioester in the human complement component C4.", "journal": "Nature", "date": "1996", "authors": "Dodds AW, Ren XD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-166663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663" } ], "reference": [ { "type": "PubMed", "id": "8538770", "url": "https://glygen.org/publication/PubMed/8538770" } ] }, { "title": "The molecular dissection of Fc gamma receptor mediated phagocytosis.", "journal": "Blood", "date": "1995", "authors": "Indik ZK, Park JG, Hunter S, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8541526", "url": "https://glygen.org/publication/PubMed/8541526" } ] }, { "title": "FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo.", "journal": "Blood", "date": "1996", "authors": "van Vugt MJ, Heijnen IA, Capel PJ, Park SY, Ra C, Saito T, Verbeek JS, van de Winkel JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8611682", "url": "https://glygen.org/publication/PubMed/8611682" } ] }, { "title": "Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Rawlings DJ, Scharenberg AM, Park H, Wahl MI, Lin S, Kato RM, Fluckiger AC, Witte ON, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8629002", "url": "https://glygen.org/publication/PubMed/8629002" } ] }, { "title": "Regulation of Btk function by a major autophosphorylation site within the SH3 domain.", "journal": "Immunity", "date": "1996", "authors": "Park H, Wahl MI, Afar DE, Turck CW, Rawlings DJ, Tam C, Scharenberg AM, Kinet JP, Witte ON", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8630736", "url": "https://glygen.org/publication/PubMed/8630736" } ] }, { "title": "Calcineurin binds the transcription factor NFAT1 and reversibly regulates its activity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Loh C, Shaw KT, Carew J, Viola JP, Luo C, Perrino BA, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8631904", "url": "https://glygen.org/publication/PubMed/8631904" } ] }, { "title": "Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Law CL, Chandran KA, Sidorenko SP, Clark EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "8657103", "url": "https://glygen.org/publication/PubMed/8657103" } ] }, { "title": "Syk-dependent phosphorylation of Shc. A potential link between FcepsilonRI and the Ras/mitogen-activated protein kinase signaling pathway through SOS and Grb2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jabril-Cuenod B, Zhang C, Scharenberg AM, Paolini R, Numerof R, Beaven MA, Kinet JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8663278", "url": "https://glygen.org/publication/PubMed/8663278" } ] }, { "title": "Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.", "journal": "Immunity", "date": "1996", "authors": "Wu J, Motto DG, Koretzky GA, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8673706", "url": "https://glygen.org/publication/PubMed/8673706" } ] }, { "title": "Phosphorylation of SLP-76 by the ZAP-70 protein-tyrosine kinase is required for T-cell receptor function.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bubeck Wardenburg J, Fu C, Jackman JK, Flotow H, Wilkinson SE, Williams DH, Johnson R, Kong G, Chan AC, Findell PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8702662", "url": "https://glygen.org/publication/PubMed/8702662" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Interaction of calcineurin with a domain of the transcription factor NFAT1 that controls nuclear import.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Luo C, Shaw KT, Raghavan A, Aramburu J, Garcia-Cozar F, Perrino BA, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871809", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809" } ], "reference": [ { "type": "PubMed", "id": "8799126", "url": "https://glygen.org/publication/PubMed/8799126" } ] }, { "title": "Vav in natural killer cells is tyrosine phosphorylated upon cross-linking of Fc gamma RIIIA and is constitutively associated with a serine/threonine kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Xu X, Chong AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "8809042", "url": "https://glygen.org/publication/PubMed/8809042" } ] }, { "title": "Role of hemopexin in protection of low-density lipoprotein against hemoglobin-induced oxidation.", "journal": "Biochemistry", "date": "1996", "authors": "Miller YI, Smith A, Morgan WT, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "8855948", "url": "https://glygen.org/publication/PubMed/8855948" } ] }, { "title": "Abrogation of the Fc gamma receptor IIA-mediated phagocytic signal by stem-loop Syk antisense oligonucleotides.", "journal": "Molecular biology of the cell", "date": "1996", "authors": "Matsuda M, Park JG, Wang DC, Hunter S, Chien P, Schreiber AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "8862523", "url": "https://glygen.org/publication/PubMed/8862523" } ] }, { "title": "Downstream signaling molecules bind to different phosphorylated immunoreceptor tyrosine-based activation motif (ITAM) peptides of the high affinity IgE receptor.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kimura T, Kihara H, Bhattacharyya S, Sakamoto H, Appella E, Siraganian RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "8910399", "url": "https://glygen.org/publication/PubMed/8910399" } ] }, { "title": "Distinct specificity in the recognition of phosphoinositides by the pleckstrin homology domains of dynamin and Bruton's tyrosine kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Salim K, Bottomley MJ, Querfurth E, Zvelebil MJ, Gout I, Scaife R, Margolis RL, Gigg R, Smith CI, Driscoll PC, Waterfield MD, Panayotou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "8947047", "url": "https://glygen.org/publication/PubMed/8947047" } ] }, { "title": "Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.", "journal": "Immunity", "date": "1996", "authors": "Deckert M, Tartare-Deckert S, Couture C, Mustelin T, Altman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8986718", "url": "https://glygen.org/publication/PubMed/8986718" } ] }, { "title": "cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mizuno T, Yoshihara Y, Inazawa J, Kagamiyama H, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "8995416", "url": "https://glygen.org/publication/PubMed/8995416" } ] }, { "title": "SLP-76 is a substrate of the high affinity IgE receptor-stimulated protein tyrosine kinases in rat basophilic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hendricks-Taylor LR, Motto DG, Zhang J, Siraganian RP, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "8995445", "url": "https://glygen.org/publication/PubMed/8995445" } ] }, { "title": "Tyrosine phosphorylation and Fcgamma receptor-mediated phagocytosis.", "journal": "FEBS letters", "date": "1997", "authors": "Strzelecka A, Kwiatkowska K, Sobota A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9000504", "url": "https://glygen.org/publication/PubMed/9000504" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Identification of the major sites of autophosphorylation of the murine protein-tyrosine kinase Syk.", "journal": "Biochimica et biophysica acta", "date": "1997", "authors": "Furlong MT, Mahrenholz AM, Kim KH, Ashendel CL, Harrison ML, Geahlen RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9042338", "url": "https://glygen.org/publication/PubMed/9042338" } ] }, { "title": "syk kinase activation by a src kinase-initiated activation loop phosphorylation chain reaction.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "El-Hillal O, Kurosaki T, Yamamura H, Kinet JP, Scharenberg AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9050880", "url": "https://glygen.org/publication/PubMed/9050880" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9099726", "url": "https://glygen.org/publication/PubMed/9099726" } ] }, { "title": "Mapping of the human IL10 gene and further characterization of the 5' flanking sequence.", "journal": "Immunogenetics", "date": "1997", "authors": "Eskdale J, Kube D, Tesch H, Gallagher G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9162098", "url": "https://glygen.org/publication/PubMed/9162098" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "Shc contains two Grb2 binding sites needed for efficient formation of complexes with SOS in B lymphocytes.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Harmer SL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9199344", "url": "https://glygen.org/publication/PubMed/9199344" } ] }, { "title": "p110delta, a novel phosphatidylinositol 3-kinase catalytic subunit that associates with p85 and is expressed predominantly in leukocytes.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Chantry D, Vojtek A, Kashishian A, Holtzman DA, Wood C, Gray PW, Cooper JA, Hoekstra MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9235916", "url": "https://glygen.org/publication/PubMed/9235916" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes.", "journal": "Immunity", "date": "1997", "authors": "Meyaard L, Adema GJ, Chang C, Woollatt E, Sutherland GR, Lanier LL, Phillips JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9285412", "url": "https://glygen.org/publication/PubMed/9285412" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "The unique domain as the site on Lyn kinase for its constitutive association with the high affinity receptor for IgE.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Vonakis BM, Chen H, Haleem-Smith H, Metzger H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "9295361", "url": "https://glygen.org/publication/PubMed/9295361" } ] }, { "title": "A critical role for Syk in signal transduction and phagocytosis mediated by Fcgamma receptors on macrophages.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Crowley MT, Costello PS, Fitzer-Attas CJ, Turner M, Meng F, Lowell C, Tybulewicz VL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029481", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481" } ], "reference": [ { "type": "PubMed", "id": "9314552", "url": "https://glygen.org/publication/PubMed/9314552" } ] }, { "title": "p46, a novel natural killer cell-specific surface molecule that mediates cell activation.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Sivori S, Vitale M, Morelli L, Sanseverino L, Augugliaro R, Bottino C, Moretta L, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9314561", "url": "https://glygen.org/publication/PubMed/9314561" } ] }, { "title": "Phosphorylation of two regulatory tyrosine residues in the activation of Bruton's tyrosine kinase via alternative receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Wahl MI, Fluckiger AC, Kato RM, Park H, Witte ON, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9326643", "url": "https://glygen.org/publication/PubMed/9326643" } ] }, { "title": "Identification of two tyrosine phosphoproteins, pp70 and pp68, which interact with phospholipase Cgamma, Grb2, and Vav after B cell antigen receptor activation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Fu C, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9341187", "url": "https://glygen.org/publication/PubMed/9341187" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Qualitative regulation of B cell antigen receptor signaling by CD19: selective requirement for PI3-kinase activation, inositol-1,4,5-trisphosphate production and Ca2+ mobilization.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Buhl AM, Pleiman CM, Rickert RC, Cambier JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9382888", "url": "https://glygen.org/publication/PubMed/9382888" } ] }, { "title": "Spontaneous autophosphorylation of Lyn tyrosine kinase at both its activation segment and C-terminal tail confers altered substrate specificity.", "journal": "Biochemistry", "date": "1998", "authors": "Donella-Deana A, Cesaro L, Ruzzene M, Brunati AM, Marin O, Pinna LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2454202", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202" } ], "reference": [ { "type": "PubMed", "id": "9477973", "url": "https://glygen.org/publication/PubMed/9477973" } ] }, { "title": "Inhibition of the B cell by CD22: a requirement for Lyn.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Smith KG, Tarlinton DM, Doody GM, Hibbs ML, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "9480991", "url": "https://glygen.org/publication/PubMed/9480991" } ] }, { "title": "A double-edged kinase Lyn: a positive and negative regulator for antigen receptor-mediated signals.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Nishizumi H, Horikawa K, Mlinaric-Rascan I, Yamamoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "9547345", "url": "https://glygen.org/publication/PubMed/9547345" } ] }, { "title": "The interaction of Arp2/3 complex with actin: nucleation, high affinity pointed end capping, and formation of branching networks of filaments.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Mullins RD, Heuser JA, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9600938", "url": "https://glygen.org/publication/PubMed/9600938" } ] }, { "title": "Defective negative regulation of antigen receptor signaling in Lyn-deficient B lymphocytes.", "journal": "Current biology : CB", "date": "1998", "authors": "Chan VW, Lowell CA, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "9601638", "url": "https://glygen.org/publication/PubMed/9601638" } ] }, { "title": "Differential activation of stress-activated protein kinase kinases SKK4/MKK7 and SKK1/MKK4 by the mixed-lineage kinase-2 and mitogen-activated protein kinase kinase (MKK) kinase-1.", "journal": "The Biochemical journal", "date": "1998", "authors": "Cuenda A, Dorow DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9639556", "url": "https://glygen.org/publication/PubMed/9639556" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "BLNK: a central linker protein in B cell activation.", "journal": "Immunity", "date": "1998", "authors": "Fu C, Turck CW, Kurosaki T, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9697839", "url": "https://glygen.org/publication/PubMed/9697839" } ] }, { "title": "Structural specializations of immunoglobulin superfamily members for adhesion to integrins and viruses.", "journal": "Immunological reviews", "date": "1998", "authors": "Wang J, Springer TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9700512", "url": "https://glygen.org/publication/PubMed/9700512" } ] }, { "title": "Structural requirements for PAK activation by Rac GTPases.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9705280", "url": "https://glygen.org/publication/PubMed/9705280" } ] }, { "title": "SLP-65: a new signaling component in B lymphocytes which requires expression of the antigen receptor for phosphorylation.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Wienands J, Schweikert J, Wollscheid B, Jumaa H, Nielsen PJ, Reth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695" } ], "reference": [ { "type": "PubMed", "id": "9705962", "url": "https://glygen.org/publication/PubMed/9705962" } ] }, { "title": "Transfer of heme from heme-albumin to hemopexin.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Morgan WT, Liem HH, Sutor RP, Muller-Ebergard U", "evidence": [ { "database": "Reactome", "id": "R-HSA-2168880", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880" } ], "reference": [ { "type": "PubMed", "id": "971416", "url": "https://glygen.org/publication/PubMed/971416" } ] }, { "title": "Molecular cloning of NKp46: a novel member of the immunoglobulin superfamily involved in triggering of natural cytotoxicity.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Pessino A, Sivori S, Bottino C, Malaspina A, Morelli L, Moretta L, Biassoni R, Moretta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933" } ], "reference": [ { "type": "PubMed", "id": "9730896", "url": "https://glygen.org/publication/PubMed/9730896" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] }, { "title": "Fc receptor-mediated phagocytosis requires CDC42 and Rac1.", "journal": "The EMBO journal", "date": "1998", "authors": "Massol P, Montcourrier P, Guillemot JC, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9799231", "url": "https://glygen.org/publication/PubMed/9799231" } ] }, { "title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.", "journal": "The EMBO journal", "date": "1998", "authors": "Miki H, Suetsugu S, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9843499", "url": "https://glygen.org/publication/PubMed/9843499" } ] }, { "title": "Cbl-mediated negative regulation of the Syk tyrosine kinase. A critical role for Cbl phosphotyrosine-binding domain binding to Syk phosphotyrosine 323.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lupher ML Jr, Rao N, Lill NL, Andoniou CE, Miyake S, Clark EA, Druker B, Band H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9664323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323" } ], "reference": [ { "type": "PubMed", "id": "9857068", "url": "https://glygen.org/publication/PubMed/9857068" } ] }, { "title": "EVH1/WH1 domains of VASP and WASP proteins belong to a large family including Ran-binding domains of the RanBP1 family.", "journal": "FEBS letters", "date": "1998", "authors": "Callebaut I, Cossart P, Dehoux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9883880", "url": "https://glygen.org/publication/PubMed/9883880" } ] }, { "title": "A contractile activity that closes phagosomes in macrophages.", "journal": "Journal of cell science", "date": "1999", "authors": "Swanson JA, Johnson MT, Beningo K, Post P, Mooseker M, Araki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482" } ], "reference": [ { "type": "PubMed", "id": "9885284", "url": "https://glygen.org/publication/PubMed/9885284" } ] }, { "title": "Definition of the sites of interaction between the protein tyrosine phosphatase SHP-1 and CD22.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Blasioli J, Paust S, Thomas ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714" } ], "reference": [ { "type": "PubMed", "id": "9890995", "url": "https://glygen.org/publication/PubMed/9890995" } ] }, { "title": "Fc gamma receptor-mediated activation of phospholipase D regulates macrophage phagocytosis of IgG-opsonized particles.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kusner DJ, Hall CF, Jackson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2029485", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485" } ], "reference": [ { "type": "PubMed", "id": "9973503", "url": "https://glygen.org/publication/PubMed/9973503" } ] }, { "title": "Mechanism of activation of Pak1 kinase by membrane localization.", "journal": "Oncogene", "date": "1999", "authors": "Lu W, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2871796", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796" } ], "reference": [ { "type": "PubMed", "id": "9989831", "url": "https://glygen.org/publication/PubMed/9989831" } ] } ], "pathway": [ { "id": "R-HSA-166663", "name": "Initial triggering of complement", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166663", "resource": "Reactome", "description": "Initial triggering of complement" }, { "id": "R-HSA-173623", "name": "Classical antibody-mediated complement activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173623", "resource": "Reactome", "description": "Classical antibody-mediated complement activation" }, { "id": "R-HSA-198933", "name": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-2029481", "name": "FCGR activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029481", "resource": "Reactome", "description": "FCGR activation" }, { "id": "R-HSA-2029482", "name": "Regulation of actin dynamics for phagocytic cup formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029482", "resource": "Reactome", "description": "Regulation of actin dynamics for phagocytic cup formation" }, { "id": "R-HSA-2029485", "name": "Role of phospholipids in phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485", "resource": "Reactome", "description": "Role of phospholipids in phagocytosis" }, { "id": "R-HSA-2168880", "name": "Scavenging of heme from plasma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2168880", "resource": "Reactome", "description": "Scavenging of heme from plasma" }, { "id": "R-HSA-2454202", "name": "Fc epsilon receptor (FCERI) signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454202", "resource": "Reactome", "description": "Fc epsilon receptor (FCERI) signaling" }, { "id": "R-HSA-2730905", "name": "Role of LAT2/NTAL/LAB on calcium mobilization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2730905", "resource": "Reactome", "description": "Role of LAT2/NTAL/LAB on calcium mobilization" }, { "id": "R-HSA-2871796", "name": "FCERI mediated MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871796", "resource": "Reactome", "description": "FCERI mediated MAPK activation" }, { "id": "R-HSA-2871809", "name": "FCERI mediated Ca+2 mobilization", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871809", "resource": "Reactome", "description": "FCERI mediated Ca+2 mobilization" }, { "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "description": "FCERI mediated NF-kB activation" }, { "id": "R-HSA-5690714", "name": "CD22 mediated BCR regulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5690714", "resource": "Reactome", "description": "CD22 mediated BCR regulation" }, { "id": "R-HSA-9664323", "name": "FCGR3A-mediated IL10 synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664323", "resource": "Reactome", "description": "FCGR3A-mediated IL10 synthesis" }, { "id": "R-HSA-9664422", "name": "FCGR3A-mediated phagocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9664422", "resource": "Reactome", "description": "FCGR3A-mediated phagocytosis" }, { "id": "R-HSA-9679191", "name": "Potential therapeutics for SARS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9679191", "resource": "Reactome", "description": "Potential therapeutics for SARS" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" }, { "id": "R-HSA-983695", "name": "Antigen activates B Cell Receptor (BCR) leading to generation of second messengers", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983695", "resource": "Reactome", "description": "Antigen activates B Cell Receptor (BCR) leading to generation of second messengers" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A075B5Q4-1", "protein_name": "Immunoglobulin heavy variable 5-12", "gene_name": "Ighv5-12", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNLGLSLIFLVLVLKGVQCEVKLVESGGGLVQPGGSLKLSCAASGFTFSDYYMYWVRQTPEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCAR", "length": 117 }, "evidence": [ { "id": "P01764", "url": "https://omabrowser.org/oma/group/P01764/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A8I6AM09-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "ENSRNOG00000063791", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDIRLSLVFLVLFIKGVQCEVQLVESGGGLVQPGRSLKLSCAASGFTFSSFPMAWVRQAPKKGLEWVASISSGGGGTYYPDSVKGRFTISRDNAKSTLYLQMDSLRSEDTASYYCARHTVS", "length": 121 }, "evidence": [ { "id": "P01764", "url": "https://omabrowser.org/oma/group/P01764/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "immunoglobulin complex", "id": "GO:0019814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" }, { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "P01764", "url": "https://www.uniprot.org/uniprot/P01764" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 97 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 543 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }