{ "uniprot_canonical_ac": "P01730-1", "uniprot_ac": "P01730", "uniprot_id": "CD4_HUMAN", "mass": { "chemical_mass": 51111.0, "monoisotopic_mass": 51111.0 }, "refseq": { "ac": "NP_000607", "name": "T-cell surface glycoprotein CD4 isoform 1 precursor", "summary": "This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The CD4 antigen is also a primary receptor for entry of the human immunodeficiency virus through interactions with the HIV Env gp120 subunit. This gene is expressed not only in T lymphocytes, but also in B cells, macrophages, granulocytes, as well as in various regions of the brain. The protein functions to initiate or augment the early phase of T-cell activation, and may function as an important mediator of indirect neuronal damage in infectious and immune-mediated diseases of the central nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, May 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, "gene_names": [ { "name": "CD4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01730", "id": "P01730" }, { "name": "CD4mut; IMD79; Leu-3; OKT4D; T4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607", "id": "NP_000607" }, { "name": "CD4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607", "id": "NP_000607" } ], "protein_names": [ { "name": "T-cell surface glycoprotein CD4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01730" }, { "name": "CD4 antigen (p55); CD4 receptor; T-cell surface antigen T4/Leu-3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607", "id": "NP_000607" }, { "name": "T-cell surface antigen T4/Leu-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01730" }, { "name": "T-cell surface glycoprotein CD4 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607", "id": "NP_000607" } ], "function": [ { "annotation": "(Microbial infection) Primary receptor for human immunodeficiency virus-1 (HIV-1) (PubMed:2214026, PubMed:16331979, PubMed:9641677, PubMed:12089508). Down-regulated by HIV-1 Vpu (PubMed:17346169). Acts as a receptor for Human Herpes virus 7/HHV-7 (PubMed:7909607).", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730#function" }, { "database": "PubMed", "id": "12089508", "url": "https://glygen.org/publication/PubMed/12089508" }, { "database": "PubMed", "id": "16331979", "url": "https://glygen.org/publication/PubMed/16331979" }, { "database": "PubMed", "id": "7909607", "url": "https://glygen.org/publication/PubMed/7909607" }, { "database": "PubMed", "id": "17346169", "url": "https://glygen.org/publication/PubMed/17346169" }, { "database": "PubMed", "id": "9641677", "url": "https://glygen.org/publication/PubMed/9641677" }, { "database": "PubMed", "id": "2214026", "url": "https://glygen.org/publication/PubMed/2214026" } ] }, { "annotation": "CD4+CD25+CD127[lo]FOXP3+ cell in food allergy: Does it predict anaphylaxis? Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, { "database": "PubMed", "id": "37169554", "url": "https://glygen.org/publication/PubMed/37169554" } ] }, { "annotation": "HIV-1 Env trimers asymmetrically engage CD4 receptors in membranes.", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, { "database": "PubMed", "id": "37993716", "url": "https://glygen.org/publication/PubMed/37993716" } ] }, { "annotation": "Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730#function" }, { "database": "PubMed", "id": "2823150", "url": "https://glygen.org/publication/PubMed/2823150" }, { "database": "PubMed", "id": "7604010", "url": "https://glygen.org/publication/PubMed/7604010" }, { "database": "PubMed", "id": "16951326", "url": "https://glygen.org/publication/PubMed/16951326" }, { "database": "PubMed", "id": "24942581", "url": "https://glygen.org/publication/PubMed/24942581" } ] }, { "annotation": "Intermediate conformations of CD4-bound HIV-1 Env heterotrimers. Erratum:[Nature. 2024 Jan 19;:. PMID: 38243106]", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, { "database": "PubMed", "id": "37993719", "url": "https://glygen.org/publication/PubMed/37993719" } ] }, { "annotation": "Lack of Association between Common LAG3/CD4 Variants and Risk of Migraine. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, { "database": "PubMed", "id": "36674807", "url": "https://glygen.org/publication/PubMed/36674807" } ] }, { "annotation": "Stem-cell-like CD4[+] T cells prey on MHC class II-negative tumors.", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" }, { "database": "PubMed", "id": "37460640", "url": "https://glygen.org/publication/PubMed/37460640" } ] }, { "annotation": "This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The CD4 antigen is also a primary receptor for entry of the human immunodeficiency virus through interactions with the HIV Env gp120 subunit. This gene is expressed not only in T lymphocytes, but also in B cells, macrophages, granulocytes, as well as in various regions of the brain. The protein functions to initiate or augment the early phase of T-cell activation, and may function as an important mediator of indirect neuronal damage in infectious and immune-mediated diseases of the central nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, May 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ] } ], "disease": [ { "disease_id": "DOID:0112277", "recommended_name": { "id": "DOID:0112277", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112277", "name": "immunodeficiency 79", "description": "A T cell deficiency characterized by childhood onset of recurrent and recalcitrant skin warts due to uncontrolled viral infection with human papillomavirus and absence of the CD4 antigen on T cells, monocytes, and dendritic cells that has_material_basis_in homozygous or compound heterozygous mutation in CD4 on chromosome 12p13." }, "synonyms": [ { "id": "DOID:0112277", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0112277", "name": "IMD79", "description": "" }, { "id": "MONDO:0030981", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030981", "name": "immunodeficiency 79", "description": "" }, { "id": "MONDO:0030981", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030981", "name": "CD4 Deficiency", "description": "" }, { "id": "MONDO:0030981", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030981", "name": "IMD79", "description": "" }, { "id": "MONDO:0030981", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0030981", "name": "immunodeficiency 79", "description": "" }, { "id": "MIM:619238", "resource": "MIM", "url": "https://www.omim.org/entry/619238", "name": "Immunodeficiency 79", "description": "Immunodeficiency 79" } ], "evidence": [ { "id": "619238", "database": "MIM", "url": "https://www.omim.org/entry/619238" } ] }, { "disease_id": "MONDO:0013497", "recommended_name": { "id": "MONDO:0013497", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013497", "name": "Okt4 epitope deficiency", "description": "" }, "synonyms": [ { "id": "MONDO:0013497", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013497", "name": "Okt4 epitope deficiency", "description": "" }, { "id": "MONDO:0013497", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013497", "name": "T4 epitope deficiency", "description": "" } ], "evidence": [ { "id": "613949", "database": "MIM", "url": "https://www.omim.org/entry/613949" } ] } ], "snv": [ { "evidence": [ { "id": "rs1209335387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1209335387" }, { "id": "rs1209335387", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1209335387#frequency_tab" }, { "id": "rs1209335387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1209335387" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 179, "end_pos": 179, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT).", "chr_id": "12", "chr_pos": "6814921", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S179", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555117941", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555117941" }, { "id": "rs1555117941", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555117941" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 296, "end_pos": 296, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "12", "chr_pos": "6816334", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1591564913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1591564913" }, { "id": "rs1591564913", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1591564913" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 327, "end_pos": 327, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "12", "chr_pos": "6817154", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T327", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1555118074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1555118074" }, { "id": "rs1555118074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1555118074" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 350, "end_pos": 350, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KVS->NVS).", "chr_id": "12", "chr_pos": "6817224", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K350", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01730", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01730" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 93, "end_pos": 93, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NFP->NFT).", "chr_id": "12", "chr_pos": "6814204", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P93", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 265, "end_pos": 265, "sequence_org": "R", "sequence_mut": "A", "comment": "Has no effect on the interaction with MHCII. Impairs recognition by OKT4 antibody.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "7604010", "url": "https://glygen.org/publication/PubMed/7604010" } ] }, { "start_pos": 432, "end_pos": 432, "sequence_org": "M", "sequence_mut": "T", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "8124721", "url": "https://glygen.org/publication/PubMed/8124721" } ] }, { "start_pos": 433, "end_pos": 433, "sequence_org": "S", "sequence_mut": "A", "comment": "About 75% loss of internalization.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" } ] }, { "start_pos": 433, "end_pos": 433, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "8124721", "url": "https://glygen.org/publication/PubMed/8124721" } ] }, { "start_pos": 438, "end_pos": 439, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Loss of Nef-induced CD4 down-modulation.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "8124721", "url": "https://glygen.org/publication/PubMed/8124721" } ] }, { "start_pos": 440, "end_pos": 440, "sequence_org": "S", "sequence_mut": "L", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "8124721", "url": "https://glygen.org/publication/PubMed/8124721" } ] }, { "start_pos": 445, "end_pos": 445, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of homodimerization; when associated with A-447.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "9168119", "url": "https://glygen.org/publication/PubMed/9168119" } ] }, { "start_pos": 447, "end_pos": 447, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of homodimerization; when associated with A-445.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "9168119", "url": "https://glygen.org/publication/PubMed/9168119" } ] }, { "start_pos": 457, "end_pos": 458, "sequence_org": "PI", "sequence_mut": "", "comment": "Abolished interaction with SPG21 and induced T-cell activation.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "11113139", "url": "https://glygen.org/publication/PubMed/11113139" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "Q", "sequence_mut": "Y", "comment": "Increases the affinity for MHCII; when associated with W-70; R-85 and R-88.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "21900604", "url": "https://glygen.org/publication/PubMed/21900604" } ] }, { "start_pos": 68, "end_pos": 68, "sequence_org": "F", "sequence_mut": "I", "comment": "Abrogates the interaction with MHCII and T cell activation.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "7604010", "url": "https://glygen.org/publication/PubMed/7604010" } ] }, { "start_pos": 70, "end_pos": 70, "sequence_org": "T", "sequence_mut": "W", "comment": "Increases the affinity for MHCII; when associated with Y-65; R-85 and R-88.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "21900604", "url": "https://glygen.org/publication/PubMed/21900604" } ] }, { "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "R", "comment": "Increases the affinity for MHCII; when associated with Y-65; W-70 and R-88.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "21900604", "url": "https://glygen.org/publication/PubMed/21900604" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "D", "sequence_mut": "R", "comment": "Increases the affinity for MHCII; when associated with Y-65; W-70 and R-85.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "21900604", "url": "https://glygen.org/publication/PubMed/21900604" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "72.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "79.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "89.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "93.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "82.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "76.81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "90.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "78.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "81.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01730" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "common_name": "Human" } ], "gene": [ { "name": "CD4", "url": "https://www.uniprot.org/uniprot/P01730", "locus": { "chromosome": "12", "start_pos": 6820799, "end_pos": 6786858, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000010610", "url": "https://www.ensembl.org/id/ENSG00000010610" } ] } } ], "crossref": [ { "id": "ENSG00000010610", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000010610", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01730", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01730", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd07690", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07690", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07694", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07694", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07695", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07695", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22570", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22570", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2754", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2754", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CD4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CD4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "920", "url": "https://www.ncbi.nlm.nih.gov/gene/920", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "1678", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1678", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01730", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01730*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000973", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000973", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015274", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015274", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021963", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021963", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:920", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:920", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "186940", "url": "http://www.omim.org/entry/186940", "database": "MIM", "categories": [ "Other" ] }, { "id": "613949", "url": "http://www.omim.org/entry/613949", "database": "MIM", "categories": [ "Other" ] }, { "id": "619238", "url": "http://www.omim.org/entry/619238", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01730", "url": "https://www.nextprot.org/entry/NX_P01730", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "KTCQCSH", "url": "https://omabrowser.org/oma/group/KTCQCSH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4637579at2759", "url": "http://www.orthodb.org/?query=4637579at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11422", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11422", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11422:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11422:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1CDH", "url": "https://www.rcsb.org/structure/1CDH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDI", "url": "https://www.rcsb.org/structure/1CDI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDJ", "url": "https://www.rcsb.org/structure/1CDJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDU", "url": "https://www.rcsb.org/structure/1CDU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDY", "url": "https://www.rcsb.org/structure/1CDY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1G9M", "url": "https://www.rcsb.org/structure/1G9M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1G9N", "url": "https://www.rcsb.org/structure/1G9N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GC1", "url": "https://www.rcsb.org/structure/1GC1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JL4", "url": "https://www.rcsb.org/structure/1JL4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Q68", "url": "https://www.rcsb.org/structure/1Q68", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RZJ", "url": "https://www.rcsb.org/structure/1RZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RZK", "url": "https://www.rcsb.org/structure/1RZK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WBR", "url": "https://www.rcsb.org/structure/1WBR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WIO", "url": "https://www.rcsb.org/structure/1WIO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WIP", "url": "https://www.rcsb.org/structure/1WIP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1WIQ", "url": "https://www.rcsb.org/structure/1WIQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B4C", "url": "https://www.rcsb.org/structure/2B4C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JKR", "url": "https://www.rcsb.org/structure/2JKR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JKT", "url": "https://www.rcsb.org/structure/2JKT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KLU", "url": "https://www.rcsb.org/structure/2KLU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NXY", "url": "https://www.rcsb.org/structure/2NXY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NXZ", "url": "https://www.rcsb.org/structure/2NXZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY0", "url": "https://www.rcsb.org/structure/2NY0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY1", "url": "https://www.rcsb.org/structure/2NY1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY2", "url": "https://www.rcsb.org/structure/2NY2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY3", "url": "https://www.rcsb.org/structure/2NY3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY4", "url": "https://www.rcsb.org/structure/2NY4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY5", "url": "https://www.rcsb.org/structure/2NY5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NY6", "url": "https://www.rcsb.org/structure/2NY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QAD", "url": "https://www.rcsb.org/structure/2QAD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B71", "url": "https://www.rcsb.org/structure/3B71", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CD4", "url": "https://www.rcsb.org/structure/3CD4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3J70", "url": "https://www.rcsb.org/structure/3J70", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JCB", "url": "https://www.rcsb.org/structure/3JCB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JCC", "url": "https://www.rcsb.org/structure/3JCC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JWD", "url": "https://www.rcsb.org/structure/3JWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JWO", "url": "https://www.rcsb.org/structure/3JWO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3LQA", "url": "https://www.rcsb.org/structure/3LQA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3O2D", "url": "https://www.rcsb.org/structure/3O2D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S4S", "url": "https://www.rcsb.org/structure/3S4S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S5L", "url": "https://www.rcsb.org/structure/3S5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3T0E", "url": "https://www.rcsb.org/structure/3T0E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4H8W", "url": "https://www.rcsb.org/structure/4H8W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JM2", "url": "https://www.rcsb.org/structure/4JM2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4P9H", "url": "https://www.rcsb.org/structure/4P9H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Q6I", "url": "https://www.rcsb.org/structure/4Q6I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4R2G", "url": "https://www.rcsb.org/structure/4R2G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4R4H", "url": "https://www.rcsb.org/structure/4R4H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RQS", "url": "https://www.rcsb.org/structure/4RQS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5A7X", "url": "https://www.rcsb.org/structure/5A7X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5A8H", "url": "https://www.rcsb.org/structure/5A8H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CAY", "url": "https://www.rcsb.org/structure/5CAY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5THR", "url": "https://www.rcsb.org/structure/5THR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5U1F", "url": "https://www.rcsb.org/structure/5U1F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VN3", "url": "https://www.rcsb.org/structure/5VN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CM3", "url": "https://www.rcsb.org/structure/6CM3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EDU", "url": "https://www.rcsb.org/structure/6EDU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6L1Y", "url": "https://www.rcsb.org/structure/6L1Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MEO", "url": "https://www.rcsb.org/structure/6MEO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MET", "url": "https://www.rcsb.org/structure/6MET", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OPN", "url": "https://www.rcsb.org/structure/6OPN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OPO", "url": "https://www.rcsb.org/structure/6OPO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OPP", "url": "https://www.rcsb.org/structure/6OPP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OPQ", "url": "https://www.rcsb.org/structure/6OPQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QH6", "url": "https://www.rcsb.org/structure/6QH6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QH7", "url": "https://www.rcsb.org/structure/6QH7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6U0L", "url": "https://www.rcsb.org/structure/6U0L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6U0N", "url": "https://www.rcsb.org/structure/6U0N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6URI", "url": "https://www.rcsb.org/structure/6URI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X5B", "url": "https://www.rcsb.org/structure/6X5B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X5C", "url": "https://www.rcsb.org/structure/6X5C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T0O", "url": "https://www.rcsb.org/structure/7T0O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7T0R", "url": "https://www.rcsb.org/structure/7T0R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TXD", "url": "https://www.rcsb.org/structure/7TXD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8D5C", "url": "https://www.rcsb.org/structure/8D5C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00047", "url": "http://pfam.xfam.org/family/PF00047", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05790", "url": "http://pfam.xfam.org/family/PF05790", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09191", "url": "http://pfam.xfam.org/family/PF09191", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12104", "url": "http://pfam.xfam.org/family/PF12104", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01730", "url": "https://pharos.nih.gov/targets/P01730", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051990", "url": "https://proconsortium.org/app/entry/PR:000051990", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051991", "url": "https://proconsortium.org/app/entry/PR:000051991", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051992", "url": "https://proconsortium.org/app/entry/PR:000051992", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051993", "url": "https://proconsortium.org/app/entry/PR:000051993", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051994", "url": "https://proconsortium.org/app/entry/PR:000051994", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051995", "url": "https://proconsortium.org/app/entry/PR:000051995", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051996", "url": "https://proconsortium.org/app/entry/PR:000051996", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051997", "url": "https://proconsortium.org/app/entry/PR:000051997", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051998", "url": "https://proconsortium.org/app/entry/PR:000051998", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051999", "url": "https://proconsortium.org/app/entry/PR:000051999", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052000", "url": "https://proconsortium.org/app/entry/PR:000052000", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052001", "url": "https://proconsortium.org/app/entry/PR:000052001", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052002", "url": "https://proconsortium.org/app/entry/PR:000052002", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052003", "url": "https://proconsortium.org/app/entry/PR:000052003", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052004", "url": "https://proconsortium.org/app/entry/PR:000052004", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052005", "url": "https://proconsortium.org/app/entry/PR:000052005", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052006", "url": "https://proconsortium.org/app/entry/PR:000052006", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052007", "url": "https://proconsortium.org/app/entry/PR:000052007", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052008", "url": "https://proconsortium.org/app/entry/PR:000052008", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052009", "url": "https://proconsortium.org/app/entry/PR:000052009", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052010", "url": "https://proconsortium.org/app/entry/PR:000052010", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052011", "url": "https://proconsortium.org/app/entry/PR:000052011", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052012", "url": "https://proconsortium.org/app/entry/PR:000052012", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052013", "url": "https://proconsortium.org/app/entry/PR:000052013", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052014", "url": "https://proconsortium.org/app/entry/PR:000052014", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052015", "url": "https://proconsortium.org/app/entry/PR:000052015", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052016", "url": "https://proconsortium.org/app/entry/PR:000052016", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052017", "url": "https://proconsortium.org/app/entry/PR:000052017", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052018", "url": "https://proconsortium.org/app/entry/PR:000052018", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052019", "url": "https://proconsortium.org/app/entry/PR:000052019", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052020", "url": "https://proconsortium.org/app/entry/PR:000052020", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052021", "url": "https://proconsortium.org/app/entry/PR:000052021", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052022", "url": "https://proconsortium.org/app/entry/PR:000052022", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052023", "url": "https://proconsortium.org/app/entry/PR:000052023", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052024", "url": "https://proconsortium.org/app/entry/PR:000052024", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052025", "url": "https://proconsortium.org/app/entry/PR:000052025", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052026", "url": "https://proconsortium.org/app/entry/PR:000052026", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052027", "url": "https://proconsortium.org/app/entry/PR:000052027", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052028", "url": "https://proconsortium.org/app/entry/PR:000052028", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052029", "url": "https://proconsortium.org/app/entry/PR:000052029", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052030", "url": "https://proconsortium.org/app/entry/PR:000052030", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052031", "url": "https://proconsortium.org/app/entry/PR:000052031", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052032", "url": "https://proconsortium.org/app/entry/PR:000052032", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052033", "url": "https://proconsortium.org/app/entry/PR:000052033", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052034", "url": "https://proconsortium.org/app/entry/PR:000052034", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052035", "url": "https://proconsortium.org/app/entry/PR:000052035", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052036", "url": "https://proconsortium.org/app/entry/PR:000052036", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052037", "url": "https://proconsortium.org/app/entry/PR:000052037", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052038", "url": "https://proconsortium.org/app/entry/PR:000052038", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052039", "url": "https://proconsortium.org/app/entry/PR:000052039", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052040", "url": "https://proconsortium.org/app/entry/PR:000052040", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000052041", "url": "https://proconsortium.org/app/entry/PR:000052041", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01730", "url": "http://purl.obolibrary.org/obo/PR_P01730", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01730", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "F5GYA9", "url": "https://www.uniprot.org/uniprot/F5GYA9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GYA9-1", "url": "https://www.uniprot.org/uniprot/F5GYA9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H480", "url": "https://www.uniprot.org/uniprot/F5H480", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H480-1", "url": "https://www.uniprot.org/uniprot/F5H480-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01730-1", "url": "https://www.uniprot.org/uniprot/P01730-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI", "length": 458, "header": "sp|P01730-1|CD4_HUMAN Isoform 1 of T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1 CANONICAL=P01730-1" }, "isoforms": [ { "isoform_ac": "F5GYA9-1", "url": "", "sequence": { "sequence": "MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQ", "length": 45, "header": "tr|F5GYA9-1|CD4_HUMAN Computationally mapped isoform of T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1 CANONICAL=P01730-1" }, "locus": { "chromosome": "12", "start_pos": 6800392, "end_pos": 6800139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000539492.1", "url": "https://www.ensembl.org/id/ENST00000539492.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000440720.1", "url": "https://www.ensembl.org/id/ENSP00000440720.1" } ] } }, { "isoform_ac": "F5H480-1", "url": "", "sequence": { "sequence": "MNRGVPFRHLLLVLQLGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLG", "length": 148, "header": "tr|F5H480-1|CD4_HUMAN Computationally mapped isoform of T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1 CANONICAL=P01730-1" }, "locus": { "chromosome": "12", "start_pos": 6815732, "end_pos": 6800139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000541982.5", "url": "https://www.ensembl.org/id/ENST00000541982.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000445167.1", "url": "https://www.ensembl.org/id/ENSP00000445167.1" } ] } }, { "isoform_ac": "P01730-1", "url": "", "sequence": { "sequence": "MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI", "length": 458, "header": "sp|P01730-1|CD4_HUMAN Isoform 1 of T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1 CANONICAL=P01730-1" }, "locus": { "chromosome": "12", "start_pos": 6819326, "end_pos": 6800139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000011653.9", "url": "https://www.ensembl.org/id/ENST00000011653.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000011653.4", "url": "https://www.ensembl.org/id/ENSP00000011653.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G03860PZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G05950HG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G07995VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G18188WJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G20779SK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G20966IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G27561QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-296 AND ASN-325 ; ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G35599NO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-296 AND ASN-325 ; ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G37166HP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G38756OC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G44276EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G45498YC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-296 AND ASN-325 ; ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G52622SW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G53450AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G53962WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G57413FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G64132UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G65890UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "ASN-296 AND ASN-325 ; ASN-296 AND ASN-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G87633UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "P01730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01730#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G03860PZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G05950HG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G07995VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G18188WJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G20779SK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G20966IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G27561QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G34730YF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G35599NO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G37166HP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G38756OC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G44276EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G45498YC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G45560HM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G52622SW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G53450AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G53962WT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G57413FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G64132UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G65890UA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" }, { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "glytoucan_ac": "G87633UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-296, N-325", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniCarbKB", "url": "" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 325, "start_aa": "Asn", "end_pos": 325, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn325", "evidence": [ { "id": "P01730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01730#ptm_processing" }, { "id": "2001369", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2001369" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "4P9H", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/4P9H" } ] }, { "glytoucan_ac": "G03860PZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G05950HG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G18188WJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G20779SK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G20966IA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G27561QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G37738XF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G38756OC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G44276EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G45498YC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G45864TJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G52622SW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G53450AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G57413FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G63923YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G64132UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2592374", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "glytoucan_ac": "G87633UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G88433PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G89878AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "587", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/587" }, { "id": "2209609", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2209609" } ] } ], "phosphorylation": [ { "start_pos": 433, "end_pos": 433, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" }, { "database": "phospho.ELM", "id": "P01730", "url": "http://phospho.elm.eu.org/byAccession/P01730.html" }, { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" }, { "database": "PubMed", "id": "1674746", "url": "https://glygen.org/publication/PubMed/1674746" }, { "database": "PubMed", "id": "28874665", "url": "https://glygen.org/publication/PubMed/28874665" } ], "site_lbl": "Ser433" }, { "start_pos": 440, "end_pos": 440, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" }, { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" } ], "site_lbl": "Ser440" }, { "start_pos": 456, "end_pos": 456, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" }, { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" } ], "site_lbl": "Ser456" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "The beta2-adrenergic receptor/betaarrestin complex recruits the clathrin adaptor AP-2 during endocytosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Laporte SA, Oakley RH, Zhang J, Holt JA, Ferguson SS, Caron MG, Barak LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10097102", "url": "https://glygen.org/publication/PubMed/10097102" } ] }, { "title": "Processing, secretion, and anti-HIV-1 activity of IL-16 with or without a signal peptide in CD4+ T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Zhou P, Devadas K, Tewari D, Jegorow A, Notkins AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "10395686", "url": "https://glygen.org/publication/PubMed/10395686" } ] }, { "title": "Conformational changes of gp120 in epitopes near the CCR5 binding site are induced by CD4 and a CD4 miniprotein mimetic.", "journal": "Biochemistry", "date": "1999", "authors": "Zhang W, Canziani G, Plugariu C, Wyatt R, Sodroski J, Sweet R, Kwong P, Hendrickson W, Chaiken I", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "10413516", "url": "https://glygen.org/publication/PubMed/10413516" } ] }, { "title": "Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.", "journal": "Molecular biology of the cell", "date": "1999", "authors": "Tebar F, Bohlander SK, Sorkin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10436022", "url": "https://glygen.org/publication/PubMed/10436022" } ] }, { "title": "Identification of a CD4 domain required for interleukin-16 binding and lymphocyte activation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Liu Y, Cruikshank WW, O'Loughlin T, O'Reilly P, Center DM, Kornfeld H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "10438516", "url": "https://glygen.org/publication/PubMed/10438516" } ] }, { "title": "CCR5 HIV-1 coreceptor activity. Role of cooperativity between residues in N-terminal extracellular and intracellular domains.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wang Z, Lee B, Murray JL, Bonneau F, Sun Y, Schweickart V, Zhang T, Peiper SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "10497202", "url": "https://glygen.org/publication/PubMed/10497202" } ] }, { "title": "Selection of gp41-mediated HIV-1 cell entry inhibitors from biased combinatorial libraries of non-natural binding elements.", "journal": "Nature structural biology", "date": "1999", "authors": "Ferrer M, Kapoor TM, Strassmaier T, Weissenhorn W, Skehel JJ, Oprian D, Schreiber SL, Wiley DC, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "10504731", "url": "https://glygen.org/publication/PubMed/10504731" } ] }, { "title": "Essential role of phosphoinositide metabolism in synaptic vesicle recycling.", "journal": "Cell", "date": "1999", "authors": "Cremona O, Di Paolo G, Wenk MR, Luthi A, Kim WT, Takei K, Daniell L, Nemoto Y, Shears SB, Flavell RA, McCormick DA, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10535736", "url": "https://glygen.org/publication/PubMed/10535736" } ] }, { "title": "The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Cestra G, Castagnoli L, Dente L, Minenkova O, Petrelli A, Migone N, Hoffmuller U, Schneider-Mergener J, Cesareni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10542231", "url": "https://glygen.org/publication/PubMed/10542231" } ] }, { "title": "Spatial control of coated-pit dynamics in living cells.", "journal": "Nature cell biology", "date": "1999", "authors": "Gaidarov I, Santini F, Warren RA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559856", "url": "https://glygen.org/publication/PubMed/10559856" } ] }, { "title": "Functional partnership between amphiphysin and dynamin in clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "1999", "authors": "Takei K, Slepnev VI, Haucke V, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559861", "url": "https://glygen.org/publication/PubMed/10559861" } ] }, { "title": "Phosphatidylinositol-3-OH kinases are Rab5 effectors.", "journal": "Nature cell biology", "date": "1999", "authors": "Christoforidis S, Miaczynska M, Ashman K, Wilm M, Zhao L, Yip SC, Waterfield MD, Backer JM, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10559924", "url": "https://glygen.org/publication/PubMed/10559924" } ] }, { "title": "The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Rosenthal JA, Chen H, Slepnev VI, Pellegrini L, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10567358", "url": "https://glygen.org/publication/PubMed/10567358" } ] }, { "title": "The eps15 homology (EH) domain-based interaction between eps15 and hrb connects the molecular machinery of endocytosis to that of nucleocytosolic transport.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Doria M, Salcini AE, Colombo E, Parslow TG, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10613896", "url": "https://glygen.org/publication/PubMed/10613896" } ] }, { "title": "Processing and targeting of granule proteins in human neutrophils.", "journal": "Journal of immunological methods", "date": "1999", "authors": "Gullberg U, Bengtsson N, Bulow E, Garwicz D, Lindmark A, Olsson I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "10618521", "url": "https://glygen.org/publication/PubMed/10618521" } ] }, { "title": "Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Greener T, Zhao X, Nojima H, Eisenberg E, Greene LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10625686", "url": "https://glygen.org/publication/PubMed/10625686" } ] }, { "title": "Functional association between SLAP-130 and SLP-76 in Jurkat T cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boerth NJ, Judd BA, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10671560", "url": "https://glygen.org/publication/PubMed/10671560" } ] }, { "title": "The PI3K-PDK1 connection: more than just a road to PKB.", "journal": "The Biochemical journal", "date": "2000", "authors": "Vanhaesebroeck B, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10698680", "url": "https://glygen.org/publication/PubMed/10698680" } ] }, { "title": "Structure, function, and biology of SHIP proteins.", "journal": "Genes & development", "date": "2000", "authors": "Rohrschneider LR, Fuller JF, Wolf I, Liu Y, Lucas DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10716940", "url": "https://glygen.org/publication/PubMed/10716940" } ] }, { "title": "Fyn-binding protein (Fyb)/SLP-76-associated protein (SLAP), Ena/vasodilator-stimulated phosphoprotein (VASP) proteins and the Arp2/3 complex link T cell receptor (TCR) signaling to the actin cytoskeleton.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Krause M, Sechi AS, Konradt M, Monner D, Gertler FB, Wehland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10747096", "url": "https://glygen.org/publication/PubMed/10747096" } ] }, { "title": "The class II phosphoinositide 3-kinase PI3K-C2alpha is concentrated in the trans-Golgi network and present in clathrin-coated vesicles.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Domin J, Gaidarov I, Smith ME, Keen JH, Waterfield MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "10766823", "url": "https://glygen.org/publication/PubMed/10766823" } ] }, { "title": "Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.", "journal": "The Biochemical journal", "date": "2000", "authors": "Oleinikov AV, Zhao J, Makker SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10769163", "url": "https://glygen.org/publication/PubMed/10769163" } ] }, { "title": "Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Brdicka T, Pavlistova D, Leo A, Bruyns E, Korinek V, Angelisova P, Scherer J, Shevchenko A, Hilgert I, Cerny J, Drbal K, Kuramitsu Y, Kornacker B, Horejsi V, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "10790433", "url": "https://glygen.org/publication/PubMed/10790433" } ] }, { "title": "Association of Grb2, Gads, and phospholipase C-gamma 1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell angigen receptor-mediated signaling.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang W, Trible RP, Zhu M, Liu SK, McGlade CJ, Samelson LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10811803", "url": "https://glygen.org/publication/PubMed/10811803" } ] }, { "title": "The hPLIC proteins may provide a link between the ubiquitination machinery and the proteasome.", "journal": "Molecular cell", "date": "2000", "authors": "Kleijnen MF, Shih AH, Zhou P, Kumar S, Soccio RE, Kedersha NL, Gill G, Howley PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "10983987", "url": "https://glygen.org/publication/PubMed/10983987" } ] }, { "title": "Evidence that the transition of HIV-1 gp41 into a six-helix bundle, not the bundle configuration, induces membrane fusion.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Melikyan GB, Markosyan RM, Hemmati H, Delmedico MK, Lambert DM, Cohen FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "11038187", "url": "https://glygen.org/publication/PubMed/11038187" } ] }, { "title": "The mechanism of phospholipase C-gamma1 regulation.", "journal": "Experimental & molecular medicine", "date": "2000", "authors": "Kim MJ, Kim E, Ryu SH, Suh PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11048639", "url": "https://glygen.org/publication/PubMed/11048639" } ] }, { "title": "Multiple C-terminal motifs of the 46-kDa mannose 6-phosphate receptor tail contribute to efficient binding of medium chains of AP-2 and AP-3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Storch S, Braulke T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11071885", "url": "https://glygen.org/publication/PubMed/11071885" } ] }, { "title": "Identification of ubiquilin, a novel presenilin interactor that increases presenilin protein accumulation.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Mah AL, Perry G, Smith MA, Monteiro MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11076969", "url": "https://glygen.org/publication/PubMed/11076969" } ] }, { "title": "All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.", "journal": "Journal of cell science", "date": "2000", "authors": "Modregger J, Ritter B, Witter B, Paulsson M, Plomann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11082044", "url": "https://glygen.org/publication/PubMed/11082044" } ] }, { "title": "Cloning of ACP33 as a novel intracellular ligand of CD4.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zeitlmann L, Sirim P, Kremmer E, Kolanus W", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "11113139", "url": "https://glygen.org/publication/PubMed/11113139" } ] }, { "title": "Clathrin uncoating: Auxilin comes to life.", "journal": "Current biology : CB", "date": "2001", "authors": "Lemmon SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11231140", "url": "https://glygen.org/publication/PubMed/11231140" } ] }, { "title": "The class II phosphoinositide 3-kinase C2alpha is activated by clathrin and regulates clathrin-mediated membrane trafficking.", "journal": "Molecular cell", "date": "2001", "authors": "Gaidarov I, Smith ME, Domin J, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11239472", "url": "https://glygen.org/publication/PubMed/11239472" } ] }, { "title": "Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Morris SM, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11247302", "url": "https://glygen.org/publication/PubMed/11247302" } ] }, { "title": "Protein kinase C theta is expressed in mast cells and is functionally involved in Fcepsilon receptor I signaling.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "Liu Y, Graham C, Parravicini V, Brown MJ, Rivera J, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11358993", "url": "https://glygen.org/publication/PubMed/11358993" } ] }, { "title": "Identification of a phospholipase C-gamma1 (PLC-gamma1) SH3 domain-binding site in SLP-76 required for T-cell receptor-mediated activation of PLC-gamma1 and NFAT.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Yablonski D, Kadlecek T, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11390650", "url": "https://glygen.org/publication/PubMed/11390650" } ] }, { "title": "Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.", "journal": "EMBO reports", "date": "2001", "authors": "Walther K, Krauss M, Diril MK, Lemke S, Ricotta D, Honing S, Kaiser S, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11454741", "url": "https://glygen.org/publication/PubMed/11454741" } ] }, { "title": "Multiple interactions of auxilin 1 with clathrin and the AP-2 adaptor complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Scheele U, Kalthoff C, Ungewickell E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11470803", "url": "https://glygen.org/publication/PubMed/11470803" } ] }, { "title": "Phosphorylation of threonine 156 of the mu2 subunit of the AP2 complex is essential for endocytosis in vitro and in vivo.", "journal": "Current biology : CB", "date": "2001", "authors": "Olusanya O, Andrews PD, Swedlow JR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11516654", "url": "https://glygen.org/publication/PubMed/11516654" } ] }, { "title": "HIP1 functions in clathrin-mediated endocytosis through binding to clathrin and adaptor protein 2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Metzler M, Legendre-Guillemin V, Gan L, Chopra V, Kwok A, McPherson PS, Hayden MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11517213", "url": "https://glygen.org/publication/PubMed/11517213" } ] }, { "title": "The huntingtin interacting protein HIP1 is a clathrin and alpha-adaptin-binding protein involved in receptor-mediated endocytosis.", "journal": "Human molecular genetics", "date": "2001", "authors": "Waelter S, Scherzinger E, Hasenbank R, Nordhoff E, Lurz R, Goehler H, Gauss C, Sathasivam K, Bates GP, Lehrach H, Wanker EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11532990", "url": "https://glygen.org/publication/PubMed/11532990" } ] }, { "title": "Clathrin- and AP-2-binding sites in HIP1 uncover a general assembly role for endocytic accessory proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mishra SK, Agostinelli NR, Brett TJ, Mizukami I, Ross TS, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11577110", "url": "https://glygen.org/publication/PubMed/11577110" } ] }, { "title": "Regulation of receptor fate by ubiquitination of activated beta 2-adrenergic receptor and beta-arrestin.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Shenoy SK, McDonald PH, Kohout TA, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11588219", "url": "https://glygen.org/publication/PubMed/11588219" } ] }, { "title": "HIV-1 gp41 six-helix bundle formation occurs rapidly after the engagement of gp120 by CXCR4 in the HIV-1 Env-mediated fusion process.", "journal": "Biochemistry", "date": "2001", "authors": "Gallo SA, Puri A, Blumenthal R", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "11591141", "url": "https://glygen.org/publication/PubMed/11591141" } ] }, { "title": "The role of Gads in hematopoietic cell signalling.", "journal": "Oncogene", "date": "2001", "authors": "Liu SK, Berry DM, McGlade CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11607830", "url": "https://glygen.org/publication/PubMed/11607830" } ] }, { "title": "LAT, the linker for activation of T cells: a bridge between T cell-specific and general signaling pathways.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2000", "authors": "Wange RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11752630", "url": "https://glygen.org/publication/PubMed/11752630" } ] }, { "title": "Adapters in lymphocyte signaling.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Leo A, Wienands J, Baier G, Horejsi V, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "11827988", "url": "https://glygen.org/publication/PubMed/11827988" } ] }, { "title": "Phosphorylation of the AP2 mu subunit by AAK1 mediates high affinity binding to membrane protein sorting signals.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Ricotta D, Conner SD, Schmid SL, von Figura K, Honing S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877457", "url": "https://glygen.org/publication/PubMed/11877457" } ] }, { "title": "Identification of an adaptor-associated kinase, AAK1, as a regulator of clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Conner SD, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11877461", "url": "https://glygen.org/publication/PubMed/11877461" } ] }, { "title": "Regulation of the immune response by SHIP.", "journal": "Seminars in immunology", "date": "2002", "authors": "March ME, Ravichandran K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11884229", "url": "https://glygen.org/publication/PubMed/11884229" } ] }, { "title": "HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Legendre-Guillemin V, Metzler M, Charbonneau M, Gan L, Chopra V, Philie J, Hayden MR, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "11889126", "url": "https://glygen.org/publication/PubMed/11889126" } ] }, { "title": "A single motif responsible for ubiquitin recognition and monoubiquitination in endocytic proteins.", "journal": "Nature", "date": "2002", "authors": "Polo S, Sigismund S, Faretta M, Guidi M, Capua MR, Bossi G, Chen H, De Camilli P, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11919637", "url": "https://glygen.org/publication/PubMed/11919637" } ] }, { "title": "The HIV-1 gp41 N-terminal heptad repeat plays an essential role in membrane fusion.", "journal": "Biochemistry", "date": "2002", "authors": "Sackett K, Shai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "11926830", "url": "https://glygen.org/publication/PubMed/11926830" } ] }, { "title": "Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.", "journal": "The EMBO journal", "date": "2002", "authors": "Morris SM, Tallquist MD, Rock CO, Cooper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11927540", "url": "https://glygen.org/publication/PubMed/11927540" } ] }, { "title": "Epsins and Vps27p/Hrs contain ubiquitin-binding domains that function in receptor endocytosis.", "journal": "Nature cell biology", "date": "2002", "authors": "Shih SC, Katzmann DJ, Schnell JD, Sutanto M, Emr SD, Hicke L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "11988742", "url": "https://glygen.org/publication/PubMed/11988742" } ] }, { "title": "Paneth cell trypsin is the processing enzyme for human defensin-5.", "journal": "Nature immunology", "date": "2002", "authors": "Ghosh D, Porter E, Shen B, Lee SK, Wilk D, Drazba J, Yadav SP, Crabb JW, Ganz T, Bevins CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "12021776", "url": "https://glygen.org/publication/PubMed/12021776" } ] }, { "title": "Accessory protein recruitment motifs in clathrin-mediated endocytosis.", "journal": "Structure (London, England : 1993)", "date": "2002", "authors": "Brett TJ, Traub LM, Fremont DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12057195", "url": "https://glygen.org/publication/PubMed/12057195" } ] }, { "title": "ADP ribosylation of human neutrophil peptide-1 regulates its biological properties.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Paone G, Wada A, Stevens LA, Matin A, Hirayama T, Levine RL, Moss J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "12060767", "url": "https://glygen.org/publication/PubMed/12060767" } ] }, { "title": "Molecular architecture and functional model of the endocytic AP2 complex.", "journal": "Cell", "date": "2002", "authors": "Collins BM, McCoy AJ, Kent HM, Evans PR, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12086608", "url": "https://glygen.org/publication/PubMed/12086608" } ] }, { "title": "Disulfide exchange in domain 2 of CD4 is required for entry of HIV-1.", "journal": "Nature immunology", "date": "2002-08", "authors": "Matthias Lisa J, Yam Patricia T W, Jiang Xing-Mai, Vandegraaff Nick, Li Peng, Poumbourios Pantelis, Donoghue Neil, Hogg Philip J", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "12089508", "url": "https://glygen.org/publication/PubMed/12089508" } ] }, { "title": "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Wasiak S, Legendre-Guillemin V, Puertollano R, Blondeau F, Girard M, de Heuvel E, Boismenu D, Bell AW, Bonifacino JS, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12213833", "url": "https://glygen.org/publication/PubMed/12213833" } ] }, { "title": "ARH is a modular adaptor protein that interacts with the LDL receptor, clathrin, and AP-2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "He G, Gupta S, Yi M, Michaely P, Hobbs HH, Cohen JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12221107", "url": "https://glygen.org/publication/PubMed/12221107" } ] }, { "title": "Disabled-2 exhibits the properties of a cargo-selective endocytic clathrin adaptor.", "journal": "The EMBO journal", "date": "2002", "authors": "Mishra SK, Keyel PA, Hawryluk MJ, Agostinelli NR, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12234931", "url": "https://glygen.org/publication/PubMed/12234931" } ] }, { "title": "Transforming growth factor-beta receptors interact with AP2 by direct binding to beta2 subunit.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Yao D, Ehrlich M, Henis YI, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12429842", "url": "https://glygen.org/publication/PubMed/12429842" } ] }, { "title": "ARF6-GTP recruits Nm23-H1 to facilitate dynamin-mediated endocytosis during adherens junctions disassembly.", "journal": "Nature cell biology", "date": "2002", "authors": "Palacios F, Schweitzer JK, Boshans RL, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12447393", "url": "https://glygen.org/publication/PubMed/12447393" } ] }, { "title": "The autosomal recessive hypercholesterolemia (ARH) protein interfaces directly with the clathrin-coat machinery.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Mishra SK, Watkins SC, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12451172", "url": "https://glygen.org/publication/PubMed/12451172" } ] }, { "title": "Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braun L, Christophe T, Boulay F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12464600", "url": "https://glygen.org/publication/PubMed/12464600" } ] }, { "title": "IL-28, IL-29 and their class II cytokine receptor IL-28R.", "journal": "Nature immunology", "date": "2003", "authors": "Sheppard P, Kindsvogel W, Xu W, Henderson K, Schlutsmeyer S, Whitmore TE, Kuestner R, Garrigues U, Birks C, Roraback J, Ostrander C, Dong D, Shin J, Presnell S, Fox B, Haldeman B, Cooper E, Taft D, Gilbert T, Grant FJ, Tackett M, Krivan W, McKnight G, Clegg C, Foster D, Klucher KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "12469119", "url": "https://glygen.org/publication/PubMed/12469119" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "Positive and negative regulation of T-cell activation through kinases and phosphatases.", "journal": "The Biochemical journal", "date": "2003", "authors": "Mustelin T, Tasken K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "12485116", "url": "https://glygen.org/publication/PubMed/12485116" } ] }, { "title": "Lipid raft distribution of CD4 depends on its palmitoylation and association with Lck, and evidence for CD4-induced lipid raft aggregation as an additional mechanism to enhance CD3 signaling.", "journal": "J. Immunol.", "date": "2003", "authors": "Fragoso Roben, Ren Dejian, Zhang Xiaoping, Su Michael Wei-Chih, Burakoff Steven J, Jin Yong-Jiu", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "12517957", "url": "https://glygen.org/publication/PubMed/12517957" } ] }, { "title": "Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2003", "authors": "Nogami S, Satoh S, Nakano M, Shimizu H, Fukushima H, Maruyama A, Terano A, Shirataki H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "12558796", "url": "https://glygen.org/publication/PubMed/12558796" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Multiple monoubiquitination of RTKs is sufficient for their endocytosis and degradation.", "journal": "Nature cell biology", "date": "2003", "authors": "Haglund K, Sigismund S, Polo S, Szymkiewicz I, Di Fiore PP, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12717448", "url": "https://glygen.org/publication/PubMed/12717448" } ] }, { "title": "Novel therapies based on mechanisms of HIV-1 cell entry.", "journal": "The New England journal of medicine", "date": "2003", "authors": "Kilby JM, Eron JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "12773651", "url": "https://glygen.org/publication/PubMed/12773651" } ] }, { "title": "ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12847086", "url": "https://glygen.org/publication/PubMed/12847086" } ] }, { "title": "Differential binding properties of B7-H1 and B7-DC to programmed death-1.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Youngnak P, Kozono Y, Kozono H, Iwai H, Otsuki N, Jin H, Omura K, Yagita H, Pardoll DM, Chen L, Azuma M", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "12893276", "url": "https://glygen.org/publication/PubMed/12893276" } ] }, { "title": "The activation of Csk by CD4 interferes with TCR-mediated activatory signaling.", "journal": "European journal of immunology", "date": "2003", "authors": "Marinari B, Simeoni L, Schraven B, Piccolella E, Tuosto L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "12938237", "url": "https://glygen.org/publication/PubMed/12938237" } ] }, { "title": "Xenopus autosomal recessive hypercholesterolemia protein couples lipoprotein receptors with the AP-2 complex in oocytes and embryos and is required for vitellogenesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhou Y, Zhang J, King ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12944396", "url": "https://glygen.org/publication/PubMed/12944396" } ] }, { "title": "Cytotoxic T-lymphocyte antigen-4 and programmed death-1 function as negative regulators of lymphocyte activation.", "journal": "Immunologic research", "date": "2003", "authors": "Carter LL, Carreno BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "12947224", "url": "https://glygen.org/publication/PubMed/12947224" } ] }, { "title": "Sorting nexin 9 participates in clathrin-mediated endocytosis through interactions with the core components.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "12952949", "url": "https://glygen.org/publication/PubMed/12952949" } ] }, { "title": "Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Chen W, ten Berge D, Brown J, Ahn S, Hu LA, Miller WE, Caron MG, Barak LS, Nusse R, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "12958364", "url": "https://glygen.org/publication/PubMed/12958364" } ] }, { "title": "Defensins: endogenous antibiotic peptides from human leukocytes.", "journal": "Ciba Foundation symposium", "date": "1992", "authors": "Lehrer RI, Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "1302183", "url": "https://glygen.org/publication/PubMed/1302183" } ] }, { "title": "Characterization of the signal for rapid internalization of the bovine mannose 6-phosphate/insulin-like growth factor-II receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Jadot M, Canfield WM, Gregory W, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1317852", "url": "https://glygen.org/publication/PubMed/1317852" } ] }, { "title": "Posttranslational processing of defensins in immature human myeloid cells.", "journal": "Blood", "date": "1992", "authors": "Valore EV, Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "1339298", "url": "https://glygen.org/publication/PubMed/1339298" } ] }, { "title": "Cloning and sequences of primate CD4 molecules: diversity of the cellular receptor for simian immunodeficiency virus/human immunodeficiency virus.", "journal": "Eur. J. Immunol.", "date": "1992", "authors": "Fomsgaard A, Hirsch VM, Johnson PR", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1425921", "url": "https://glygen.org/publication/PubMed/1425921" } ] }, { "title": "A synthetic peptide inhibitor of human immunodeficiency virus replication: correlation between solution structure and viral inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Wild C, Oas T, McDanal C, Bolognesi D, Matthews T", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "1438243", "url": "https://glygen.org/publication/PubMed/1438243" } ] }, { "title": "NMR studies of defensin antimicrobial peptides. 1. Resonance assignment and secondary structure determination of rabbit NP-2 and human HNP-1.", "journal": "Biochemistry", "date": "1992", "authors": "Zhang XL, Selsted ME, Pardi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "1445872", "url": "https://glygen.org/publication/PubMed/1445872" } ] }, { "title": "Hematopoietic adaptors in T-cell signaling: potential applications to transplantation.", "journal": "American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons", "date": "2003", "authors": "Rudd CE, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "14510693", "url": "https://glygen.org/publication/PubMed/14510693" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.", "journal": "EMBO reports", "date": "2003", "authors": "Ritter B, Philie J, Girard M, Tung EC, Blondeau F, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14555962", "url": "https://glygen.org/publication/PubMed/14555962" } ] }, { "title": "Clathrin promotes incorporation of cargo into coated pits by activation of the AP2 adaptor micro2 kinase.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Jackson AP, Flett A, Smythe C, Hufton L, Wettey FR, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14581451", "url": "https://glygen.org/publication/PubMed/14581451" } ] }, { "title": "AAK1-mediated micro2 phosphorylation is stimulated by assembled clathrin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2003", "authors": "Conner SD, Schroter T, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14617351", "url": "https://glygen.org/publication/PubMed/14617351" } ] }, { "title": "Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating.", "journal": "Neuron", "date": "2003", "authors": "Verstreken P, Koh TW, Schulze KL, Zhai RG, Hiesinger PR, Zhou Y, Mehta SQ, Cao Y, Roos J, Bellen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622578", "url": "https://glygen.org/publication/PubMed/14622578" } ] }, { "title": "Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin.", "journal": "Neuron", "date": "2003", "authors": "Schuske KR, Richmond JE, Matthies DS, Davis WS, Runz S, Rube DA, van der Bliek AM, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "14622579", "url": "https://glygen.org/publication/PubMed/14622579" } ] }, { "title": "The ubiquitin-related protein PLIC-1 regulates heterotrimeric G protein function through association with Gbetagamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "N'Diaye EN, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14662753", "url": "https://glygen.org/publication/PubMed/14662753" } ] }, { "title": "Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Walther K, Diril MK, Jung N, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "14726597", "url": "https://glygen.org/publication/PubMed/14726597" } ] }, { "title": "T cell receptor signaling: beyond complex complexes.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Huang Y, Wange RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15084594", "url": "https://glygen.org/publication/PubMed/15084594" } ] }, { "title": "CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.", "journal": "Nature reviews. Immunology", "date": "2004", "authors": "Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15122200", "url": "https://glygen.org/publication/PubMed/15122200" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.", "journal": "Biochimie", "date": "2004", "authors": "Gallagher H, Oleinikov AV, Fenske C, Newman DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15134832", "url": "https://glygen.org/publication/PubMed/15134832" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "ARF1 regulates Nef-induced CD4 degradation.", "journal": "Current biology : CB", "date": "2004", "authors": "Faure J, Stalder R, Borel C, Sobo K, Piguet V, Demaurex N, Gruenberg J, Trono D", "evidence": [ { "database": "Reactome", "id": "R-HSA-167590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167590" } ], "reference": [ { "type": "PubMed", "id": "15202998", "url": "https://glygen.org/publication/PubMed/15202998" } ] }, { "title": "Activity of alpha- and theta-defensins against primary isolates of HIV-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Wang W, Owen SM, Rudolph DL, Cole AM, Hong T, Waring AJ, Lal RB, Lehrer RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "15210812", "url": "https://glygen.org/publication/PubMed/15210812" } ] }, { "title": "A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kamioka Y, Fukuhara S, Sawa H, Nagashima K, Masuda M, Matsuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15252009", "url": "https://glygen.org/publication/PubMed/15252009" } ] }, { "title": "Dap160/intersectin scaffolds the periactive zone to achieve high-fidelity endocytosis and normal synaptic growth.", "journal": "Neuron", "date": "2004", "authors": "Marie B, Sweeney ST, Poskanzer KE, Roos J, Kelly RB, Davis GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15260957", "url": "https://glygen.org/publication/PubMed/15260957" } ] }, { "title": "The stimulatory action of amphiphysin on dynamin function is dependent on lipid bilayer curvature.", "journal": "The EMBO journal", "date": "2004", "authors": "Yoshida Y, Kinuta M, Abe T, Liang S, Araki K, Cremona O, Di Paolo G, Moriyama Y, Yasuda T, De Camilli P, Takei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15318165", "url": "https://glygen.org/publication/PubMed/15318165" } ] }, { "title": "Endocytosis by random initiation and stabilization of clathrin-coated pits.", "journal": "Cell", "date": "2004", "authors": "Ehrlich M, Boll W, Van Oijen A, Hariharan R, Chandran K, Nibert ML, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15339664", "url": "https://glygen.org/publication/PubMed/15339664" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "A novel di-leucine motif and a tyrosine-based motif independently mediate lysosomal targeting and endocytosis of CD3 chains.", "journal": "Cell", "date": "1992", "authors": "Letourneur F, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1535555", "url": "https://glygen.org/publication/PubMed/1535555" } ] }, { "title": "PD-1 inhibits T-cell receptor induced phosphorylation of the ZAP70/CD3zeta signalosome and downstream signaling to PKCtheta.", "journal": "FEBS letters", "date": "2004", "authors": "Sheppard KA, Fitz LJ, Lee JM, Benander C, George JA, Wooters J, Qiu Y, Jussif JM, Carter LL, Wood CR, Chaudhary D", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "15358536", "url": "https://glygen.org/publication/PubMed/15358536" } ] }, { "title": "Signaling to NF-kappaB.", "journal": "Genes & development", "date": "2004", "authors": "Hayden MS, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15371334", "url": "https://glygen.org/publication/PubMed/15371334" } ] }, { "title": "Characterization of defensin precursors in mature human neutrophils.", "journal": "Blood", "date": "1992", "authors": "Harwig SS, Park AS, Lehrer RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "1547345", "url": "https://glygen.org/publication/PubMed/1547345" } ] }, { "title": "Adaptors for clathrin coats: structure and function.", "journal": "Annual review of cell and developmental biology", "date": "2004", "authors": "Owen DJ, Collins BM, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15473838", "url": "https://glygen.org/publication/PubMed/15473838" } ] }, { "title": "Structure and regulation of Src family kinases.", "journal": "Oncogene", "date": "2004", "authors": "Boggon TJ, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15489910", "url": "https://glygen.org/publication/PubMed/15489910" } ] }, { "title": "Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.", "journal": "Oncogene", "date": "2004", "authors": "Palacios EH, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15489916", "url": "https://glygen.org/publication/PubMed/15489916" } ] }, { "title": "Molecular model for a complete clathrin lattice from electron cryomicroscopy.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Sliz P, Grigorieff N, Harrison SC, Kirchhausen T, Walz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502812", "url": "https://glygen.org/publication/PubMed/15502812" } ] }, { "title": "Structure of an auxilin-bound clathrin coat and its implications for the mechanism of uncoating.", "journal": "Nature", "date": "2004", "authors": "Fotin A, Cheng Y, Grigorieff N, Walz T, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15502813", "url": "https://glygen.org/publication/PubMed/15502813" } ] }, { "title": "N-substituted pyrrole derivatives as novel human immunodeficiency virus type 1 entry inhibitors that interfere with the gp41 six-helix bundle formation and block virus fusion.", "journal": "Antimicrobial agents and chemotherapy", "date": "2004", "authors": "Jiang S, Lu H, Liu S, Zhao Q, He Y, Debnath AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "15504864", "url": "https://glygen.org/publication/PubMed/15504864" } ] }, { "title": "The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling.", "journal": "Seminars in immunology", "date": "2004", "authors": "Lin X, Wang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15541657", "url": "https://glygen.org/publication/PubMed/15541657" } ] }, { "title": "BAR domains and membrane curvature: bringing your curves to the BAR.", "journal": "Biochemical Society symposium", "date": "2005", "authors": "Gallop JL, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15649145", "url": "https://glygen.org/publication/PubMed/15649145" } ] }, { "title": "Different G protein-coupled receptor kinases govern G protein and beta-arrestin-mediated signaling of V2 vasopressin receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Ren XR, Reiter E, Ahn S, Kim J, Chen W, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15671180", "url": "https://glygen.org/publication/PubMed/15671180" } ] }, { "title": "SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Soulet F, Yarar D, Leonard M, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15703209", "url": "https://glygen.org/publication/PubMed/15703209" } ] }, { "title": "Functional dissection of an AP-2 beta2 appendage-binding sequence within the autosomal recessive hypercholesterolemia protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Mishra SK, Keyel PA, Edeling MA, Dupin AL, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "15728179", "url": "https://glygen.org/publication/PubMed/15728179" } ] }, { "title": "The small G-protein Arf6GTP recruits the AP-2 adaptor complex to membranes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Paleotti O, Macia E, Luton F, Klein S, Partisani M, Chardin P, Kirchhausen T, Franco M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15802264", "url": "https://glygen.org/publication/PubMed/15802264" } ] }, { "title": "Caenorhabditis elegans RME-6 is a novel regulator of RAB-5 at the clathrin-coated pit.", "journal": "Nature cell biology", "date": "2005", "authors": "Sato M, Sato K, Fonarev P, Huang CJ, Liou W, Grant BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15895077", "url": "https://glygen.org/publication/PubMed/15895077" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2.", "journal": "Molecular cell", "date": "2005", "authors": "Honing S, Ricotta D, Krauss M, Spate K, Spolaore B, Motley A, Robinson M, Robinson C, Haucke V, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "15916959", "url": "https://glygen.org/publication/PubMed/15916959" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Shin HW, Hayashi M, Christoforidis S, Lacas-Gervais S, Hoepfner S, Wenk MR, Modregger J, Uttenweiler-Joseph S, Wilm M, Nystuen A, Frankel WN, Solimena M, De Camilli P, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16103228", "url": "https://glygen.org/publication/PubMed/16103228" } ] }, { "title": "Ubiquilin recruits Eps15 into ubiquitin-rich cytoplasmic aggregates via a UIM-UBL interaction.", "journal": "Journal of cell science", "date": "2005", "authors": "Regan-Klapisz E, Sorokina I, Voortman J, de Keizer P, Roovers RC, Verheesen P, Urbe S, Fallon L, Fon EA, Verkleij A, Benmerah A, van Bergen en Henegouwen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16159959", "url": "https://glygen.org/publication/PubMed/16159959" } ] }, { "title": "Identification of palmitoylation sites on CD4, the human immunodeficiency virus receptor.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Crise B, Rose JK", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1618861", "url": "https://glygen.org/publication/PubMed/1618861" } ] }, { "title": "Individual phosphoinositide 3-kinase C2alpha domain activities independently regulate clathrin function.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Gaidarov I, Zhao Y, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16215232", "url": "https://glygen.org/publication/PubMed/16215232" } ] }, { "title": "Structure of a V3-containing HIV-1 gp120 core.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Huang CC, Tang M, Zhang MY, Majeed S, Montabana E, Stanfield RL, Dimitrov DS, Korber B, Sodroski J, Wilson IA, Wyatt R, Kwong PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "16284180", "url": "https://glygen.org/publication/PubMed/16284180" } ] }, { "title": "Mutations in the leucine zipper of the human immunodeficiency virus type 1 transmembrane glycoprotein affect fusion and infectivity.", "journal": "Journal of virology", "date": "1992", "authors": "Dubay JW, Roberts SJ, Brody B, Hunter E", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "1629954", "url": "https://glygen.org/publication/PubMed/1629954" } ] }, { "title": "Dynamin and the actin cytoskeleton cooperatively regulate plasma membrane invagination by BAR and F-BAR proteins.", "journal": "Developmental cell", "date": "2005", "authors": "Itoh T, Erdmann KS, Roux A, Habermann B, Werner H, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16326391", "url": "https://glygen.org/publication/PubMed/16326391" } ] }, { "title": "Protein minimization of the gp120 binding region of human CD4.", "journal": "Biochemistry", "date": "2005-12-13", "authors": "Sharma Deepak, Balamurali M M, Chakraborty Kausik, Kumaran Sowmini, Jeganathan Sadasivam, Rashid Umar, Ingallinella Paolo, Varadarajan Raghavan", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "16331979", "url": "https://glygen.org/publication/PubMed/16331979" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of the CARMA1 linker controls NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Sommer K, Guo B, Pomerantz JL, Bandaranayake AD, Moreno-Garcia ME, Ovechkina YL, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356855", "url": "https://glygen.org/publication/PubMed/16356855" } ] }, { "title": "T-cell signalling and immune system disorders.", "journal": "Expert reviews in molecular medicine", "date": "2005", "authors": "Wilkinson B, Downey JS, Rudd CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "16364187", "url": "https://glygen.org/publication/PubMed/16364187" } ] }, { "title": "Rab5-activating protein 6, a novel endosomal protein with a role in endocytosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Hunker CM, Galvis A, Kruk I, Giambini H, Veisaga ML, Barbieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16410077", "url": "https://glygen.org/publication/PubMed/16410077" } ] }, { "title": "Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.", "journal": "Developmental cell", "date": "2006", "authors": "Diril MK, Wienisch M, Jung N, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16459302", "url": "https://glygen.org/publication/PubMed/16459302" } ] }, { "title": "The structural basis of arrestin-mediated regulation of G-protein-coupled receptors.", "journal": "Pharmacology & therapeutics", "date": "2006", "authors": "Gurevich VV, Gurevich EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16460808", "url": "https://glygen.org/publication/PubMed/16460808" } ] }, { "title": "Identification of substrates of human protein-tyrosine phosphatase PTPN22.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wu J, Katrekar A, Honigberg LA, Smith AM, Conn MT, Tang J, Jeffery D, Mortara K, Sampang J, Williams SR, Buggy J, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "16461343", "url": "https://glygen.org/publication/PubMed/16461343" } ] }, { "title": "Proteinase 3 is an IL-32 binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Novick D, Rubinstein M, Azam T, Rabinkov A, Dinarello CA, Kim SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "16488976", "url": "https://glygen.org/publication/PubMed/16488976" } ] }, { "title": "Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Tamada T, Honjo E, Maeda Y, Okamoto T, Ishibashi M, Tokunaga M, Kuroki R", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "16492764", "url": "https://glygen.org/publication/PubMed/16492764" } ] }, { "title": "Molecular switches involving the AP-2 beta2 appendage regulate endocytic cargo selection and clathrin coat assembly.", "journal": "Developmental cell", "date": "2006", "authors": "Edeling MA, Mishra SK, Keyel PA, Steinhauser AL, Collins BM, Roth R, Heuser JE, Owen DJ, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16516836", "url": "https://glygen.org/publication/PubMed/16516836" } ] }, { "title": "Normal T-cell development and immune functions in TRIM-deficient mice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Kolsch U, Arndt B, Reinhold D, Lindquist JA, Juling N, Kliche S, Pfeffer K, Bruyns E, Schraven B, Simeoni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16612002", "url": "https://glygen.org/publication/PubMed/16612002" } ] }, { "title": "Type Igamma661 phosphatidylinositol phosphate kinase directly interacts with AP2 and regulates endocytosis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bairstow SF, Ling K, Su X, Firestone AJ, Carbonara C, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16707488", "url": "https://glygen.org/publication/PubMed/16707488" } ] }, { "title": "Endocytosis of the glucose transporter GLUT8 is mediated by interaction of a dileucine motif with the beta2-adaptin subunit of the AP-2 adaptor complex.", "journal": "Journal of cell science", "date": "2006", "authors": "Schmidt U, Briese S, Leicht K, Schurmann A, Joost HG, Al-Hasani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "16723738", "url": "https://glygen.org/publication/PubMed/16723738" } ] }, { "title": "Lymphocyte chemoattractant factor induces CD4-dependent intracytoplasmic signaling in lymphocytes.", "journal": "J. Immunol.", "date": "1991", "authors": "Cruikshank W W, Greenstein J L, Theodore A C, Center D M", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1673145", "url": "https://glygen.org/publication/PubMed/1673145" } ] }, { "title": "Phosphorylation-dependent down-modulation of CD4 requires a specific structure within the cytoplasmic domain of CD4.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Shin J, Dunbrack RL Jr, Lee S, Strominger JL", "evidence": [ { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" } ], "reference": [ { "type": "PubMed", "id": "1674746", "url": "https://glygen.org/publication/PubMed/1674746" } ] }, { "title": "A burst of auxilin recruitment determines the onset of clathrin-coated vesicle uncoating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Massol RH, Boll W, Griffin AM, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16798879", "url": "https://glygen.org/publication/PubMed/16798879" } ] }, { "title": "Stimulation of phosphatidylinositol kinase type I-mediated phosphatidylinositol (4,5)-bisphosphate synthesis by AP-2mu-cargo complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Krauss M, Kukhtina V, Pechstein A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16880396", "url": "https://glygen.org/publication/PubMed/16880396" } ] }, { "title": "Glucocorticoids cause rapid dissociation of a T-cell-receptor-associated protein complex containing LCK and FYN.", "journal": "EMBO Rep.", "date": "2006", "authors": "L\u00f6wenberg Mark, Verhaar Auke P, Bilderbeek Joyce, Marle Jan van, Buttgereit Frank, Peppelenbosch Maikel P, van Deventer Sander J, Hommes Daniel W", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "16888650", "url": "https://glygen.org/publication/PubMed/16888650" } ] }, { "title": "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.", "journal": "PLoS biology", "date": "2006", "authors": "Schmid EM, Ford MG, Burtey A, Praefcke GJ, Peak-Chew SY, Mills IG, Benmerah A, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "16903783", "url": "https://glygen.org/publication/PubMed/16903783" } ] }, { "title": "CD4 expression on activated NK cells: ligation of CD4 induces cytokine expression and cell migration.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006-09-15", "authors": "Bernstein Helene B, Plasterer Mary C, Schiff Sherrie E, Kitchen Christina M R, Kitchen Scott, Zack Jerome A", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "16951326", "url": "https://glygen.org/publication/PubMed/16951326" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "Atomic structure of a fragment of human CD4 containing two immunoglobulin-like domains.", "journal": "Nature", "date": "1990", "authors": "Wang JH, Yan YW, Garrett TP, Liu JH, Rodgers DW, Garlick RL, Tarr GE, Husain Y, Reinherz EL, Harrison SC", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1701030", "url": "https://glygen.org/publication/PubMed/1701030" } ] }, { "title": "Cargo regulates clathrin-coated pit dynamics.", "journal": "Cell", "date": "2006", "authors": "Puthenveedu MA, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17018281", "url": "https://glygen.org/publication/PubMed/17018281" } ] }, { "title": "Phosphoinositides in cell regulation and membrane dynamics.", "journal": "Nature", "date": "2006", "authors": "Di Paolo G, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17035995", "url": "https://glygen.org/publication/PubMed/17035995" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Introduction to NF-kappaB: players, pathways, perspectives.", "journal": "Oncogene", "date": "2006", "authors": "Gilmore TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17072321", "url": "https://glygen.org/publication/PubMed/17072321" } ] }, { "title": "Humans with OKT4-epitope deficiency have a single nucleotide base change in the CD4 gene, resulting in substitution of TRP240 for ARG240.", "journal": "Human immunology", "date": "1991", "authors": "Hodge TW, Sasso DR, McDougal JS", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1708753", "url": "https://glygen.org/publication/PubMed/1708753" } ] }, { "title": "Crystal structures of human alpha-defensins HNP4, HD5, and HD6.", "journal": "Protein science : a publication of the Protein Society", "date": "2006", "authors": "Szyk A, Wu Z, Tucker K, Yang D, Lu W, Lubkowski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "17088326", "url": "https://glygen.org/publication/PubMed/17088326" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "Two synaptojanin 1 isoforms are recruited to clathrin-coated pits at different stages.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Perera RM, Zoncu R, Lucast L, De Camilli P, Toomre D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17158794", "url": "https://glygen.org/publication/PubMed/17158794" } ] }, { "title": "Downregulation of CD4 by human immunodeficiency virus type 1 Nef is dependent on clathrin and involves direct interaction of Nef with the AP2 clathrin adaptor.", "journal": "Journal of virology", "date": "2007", "authors": "Chaudhuri R, Lindwasser OW, Smith WJ, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17267500", "url": "https://glygen.org/publication/PubMed/17267500" } ] }, { "title": "Mechanisms of CD4 downregulation by the Nef and Vpu proteins of primate immunodeficiency viruses.", "journal": "Current molecular medicine", "date": "2007-03", "authors": "Lindwasser O Wolf, Chaudhuri Rittik, Bonifacino Juan S", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "17346169", "url": "https://glygen.org/publication/PubMed/17346169" } ] }, { "title": "The gamma/sigma1 and alpha/sigma2 hemicomplexes of clathrin adaptors AP-1 and AP-2 harbor the dileucine recognition site.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doray B, Lee I, Knisely J, Bu G, Kornfeld S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17360967", "url": "https://glygen.org/publication/PubMed/17360967" } ] }, { "title": "Phosphorylation and ubiquitination of the IkappaB kinase complex by two distinct signaling pathways.", "journal": "The EMBO journal", "date": "2007", "authors": "Shambharkar PB, Blonska M, Pappu BP, Li H, You Y, Sakurai H, Darnay BG, Hara H, Penninger J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17363905", "url": "https://glygen.org/publication/PubMed/17363905" } ] }, { "title": "Src-dependent phosphorylation of beta2-adaptin dissociates the beta-arrestin-AP-2 complex.", "journal": "Journal of cell science", "date": "2007", "authors": "Fessart D, Simaan M, Zimmerman B, Comeau J, Hamdan FF, Wiseman PW, Bouvier M, Laporte SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17456551", "url": "https://glygen.org/publication/PubMed/17456551" } ] }, { "title": "Post-translational modifications regulate distinct functions of CARMA1 and BCL10.", "journal": "Trends in immunology", "date": "2007", "authors": "Thome M, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17468049", "url": "https://glygen.org/publication/PubMed/17468049" } ] }, { "title": "A novel AAK1 splice variant functions at multiple steps of the endocytic pathway.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Henderson DM, Conner SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17494869", "url": "https://glygen.org/publication/PubMed/17494869" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Curved EFC/F-BAR-domain dimers are joined end to end into a filament for membrane invagination in endocytosis.", "journal": "Cell", "date": "2007", "authors": "Shimada A, Niwa H, Tsujita K, Suetsugu S, Nitta K, Hanawa-Suetsugu K, Akasaka R, Nishino Y, Toyama M, Chen L, Liu ZJ, Wang BC, Yamamoto M, Terada T, Miyazawa A, Tanaka A, Sugano S, Shirouzu M, Nagayama K, Takenawa T, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17512409", "url": "https://glygen.org/publication/PubMed/17512409" } ] }, { "title": "Clathrin-dependent entry of severe acute respiratory syndrome coronavirus into target cells expressing ACE2 with the cytoplasmic tail deleted.", "journal": "Journal of virology", "date": "2007", "authors": "Inoue Y, Tanaka N, Tanaka Y, Inoue S, Morita K, Zhuang M, Hattori T, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17522231", "url": "https://glygen.org/publication/PubMed/17522231" } ] }, { "title": "Structure and analysis of FCHo2 F-BAR domain: a dimerizing and membrane recruitment module that effects membrane curvature.", "journal": "Structure (London, England : 1993)", "date": "2007", "authors": "Henne WM, Kent HM, Ford MG, Hegde BG, Daumke O, Butler PJ, Mittal R, Langen R, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17540576", "url": "https://glygen.org/publication/PubMed/17540576" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Ctheta.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Melowic HR, Stahelin RV, Blatner NR, Tian W, Hayashi K, Altman A, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17548359", "url": "https://glygen.org/publication/PubMed/17548359" } ] }, { "title": "SNX9 couples actin assembly to phosphoinositide signals and is required for membrane remodeling during endocytosis.", "journal": "Developmental cell", "date": "2007", "authors": "Yarar D, Waterman-Storer CM, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17609109", "url": "https://glygen.org/publication/PubMed/17609109" } ] }, { "title": "Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2007", "authors": "Qi Q, August A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "17652306", "url": "https://glygen.org/publication/PubMed/17652306" } ] }, { "title": "Sorting nexin 9 interacts with dynamin 1 and N-WASP and coordinates synaptic vesicle endocytosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Shin N, Lee S, Ahn N, Kim SA, Ahn SG, YongPark Z, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17681954", "url": "https://glygen.org/publication/PubMed/17681954" } ] }, { "title": "Integrating molecular and network biology to decode endocytosis.", "journal": "Nature", "date": "2007", "authors": "Schmid EM, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "17713526", "url": "https://glygen.org/publication/PubMed/17713526" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "The NECAP PHear domain increases clathrin accessory protein binding potential.", "journal": "The EMBO journal", "date": "2007", "authors": "Ritter B, Denisov AY, Philie J, Allaire PD, Legendre-Guillemin V, Zylbergold P, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17762867", "url": "https://glygen.org/publication/PubMed/17762867" } ] }, { "title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.", "journal": "Developmental cell", "date": "2007", "authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17765681", "url": "https://glygen.org/publication/PubMed/17765681" } ] }, { "title": "A motif in the clathrin heavy chain required for the Hsc70/auxilin uncoating reaction.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Rapoport I, Boll W, Yu A, Bocking T, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "17978091", "url": "https://glygen.org/publication/PubMed/17978091" } ] }, { "title": "A diacidic motif in human immunodeficiency virus type 1 Nef is a novel determinant of binding to AP-2.", "journal": "Journal of virology", "date": "2008", "authors": "Lindwasser OW, Smith WJ, Chaudhuri R, Yang P, Hurley JH, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18032517", "url": "https://glygen.org/publication/PubMed/18032517" } ] }, { "title": "Structural basis for the interaction between focal adhesion kinase and CD4.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Garron Marie-Line, Arthos James, Guichou Jean-Fran\u00e7ois, McNally Jonathan, Cicala Claudia, Arold Stefan T", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "18078954", "url": "https://glygen.org/publication/PubMed/18078954" } ] }, { "title": "The dual phosphatase activity of synaptojanin1 is required for both efficient synaptic vesicle endocytosis and reavailability at nerve terminals.", "journal": "Neuron", "date": "2007", "authors": "Mani M, Lee SY, Lucast L, Cremona O, Di Paolo G, De Camilli P, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18093523", "url": "https://glygen.org/publication/PubMed/18093523" } ] }, { "title": "Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Jung N, Wienisch M, Gu M, Rand JB, Muller SL, Krause G, Jorgensen EM, Klingauf J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18166656", "url": "https://glygen.org/publication/PubMed/18166656" } ] }, { "title": "PD-1 and its ligands in tolerance and immunity.", "journal": "Annual review of immunology", "date": "2008", "authors": "Keir ME, Butte MJ, Freeman GJ, Sharpe AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "18173375", "url": "https://glygen.org/publication/PubMed/18173375" } ] }, { "title": "The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "N'Diaye EN, Hanyaloglu AC, Kajihara KK, Puthenveedu MA, Wu P, von Zastrow M, Brown EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18199683", "url": "https://glygen.org/publication/PubMed/18199683" } ] }, { "title": "SNX9 regulates tubular invagination of the plasma membrane through interaction with actin cytoskeleton and dynamin 2.", "journal": "Journal of cell science", "date": "2008", "authors": "Shin N, Ahn N, Chang-Ileto B, Park J, Takei K, Ahn SG, Kim SA, Di Paolo G, Chang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18388313", "url": "https://glygen.org/publication/PubMed/18388313" } ] }, { "title": "Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Lin H, Lee E, Hestir K, Leo C, Huang M, Bosch E, Halenbeck R, Wu G, Zhou A, Behrens D, Hollenbaugh D, Linnemann T, Qin M, Wong J, Chu K, Doberstein SK, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "18467591", "url": "https://glygen.org/publication/PubMed/18467591" } ] }, { "title": "Interaction of phosphoinositide cycle intermediates with the plasma membrane-associated clathrin assembly protein AP-2.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Beck KA, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "1847920", "url": "https://glygen.org/publication/PubMed/1847920" } ] }, { "title": "Control of peripheral T-cell tolerance and autoimmunity via the CTLA-4 and PD-1 pathways.", "journal": "Immunological reviews", "date": "2008", "authors": "Fife BT, Bluestone JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "18759926", "url": "https://glygen.org/publication/PubMed/18759926" } ] }, { "title": "Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.", "journal": "Cell", "date": "2008", "authors": "Pryor PR, Jackson L, Gray SR, Edeling MA, Thompson A, Sanderson CM, Evans PR, Owen DJ, Luzio JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18775314", "url": "https://glygen.org/publication/PubMed/18775314" } ] }, { "title": "Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wilbur JD, Chen CY, Manalo V, Hwang PK, Fletterick RJ, Brodsky FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18790740", "url": "https://glygen.org/publication/PubMed/18790740" } ] }, { "title": "Role of HRB in clathrin-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chaineau M, Danglot L, Proux-Gillardeaux V, Galli T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "18819912", "url": "https://glygen.org/publication/PubMed/18819912" } ] }, { "title": "Mechanisms of alpha-defensin bactericidal action: comparative membrane disruption by Cryptdin-4 and its disulfide-null analogue.", "journal": "Biochemistry", "date": "2008", "authors": "Hadjicharalambous C, Sheynis T, Jelinek R, Shanahan MT, Ouellette AJ, Gizeli E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "18973303", "url": "https://glygen.org/publication/PubMed/18973303" } ] }, { "title": "Coordinated regulation of AP2 uncoating from clathrin-coated vesicles by rab5 and hRME-6.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Semerdjieva S, Shortt B, Maxwell E, Singh S, Fonarev P, Hansen J, Schiavo G, Grant BD, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "18981233", "url": "https://glygen.org/publication/PubMed/18981233" } ] }, { "title": "SNX9 - a prelude to vesicle release.", "journal": "Journal of cell science", "date": "2009", "authors": "Lundmark R, Carlsson SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19092055", "url": "https://glygen.org/publication/PubMed/19092055" } ] }, { "title": "A structural explanation for the binding of endocytic dileucine motifs by the AP2 complex.", "journal": "Nature", "date": "2008", "authors": "Kelly BT, McCoy AJ, Spate K, Miller SE, Evans PR, Honing S, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19140243", "url": "https://glygen.org/publication/PubMed/19140243" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730#ptm_processing" }, { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Clathrin regulates the association of PIPKIgamma661 with the AP-2 adaptor beta2 appendage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Thieman JR, Mishra SK, Ling K, Doray B, Anderson RA, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19287005", "url": "https://glygen.org/publication/PubMed/19287005" } ] }, { "title": "Cargo and dynamin regulate clathrin-coated pit maturation.", "journal": "PLoS biology", "date": "2009", "authors": "Loerke D, Mettlen M, Yarar D, Jaqaman K, Jaqaman H, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19296720", "url": "https://glygen.org/publication/PubMed/19296720" } ] }, { "title": "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Mettlen M, Stoeber M, Loerke D, Antonescu CN, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19458185", "url": "https://glygen.org/publication/PubMed/19458185" } ] }, { "title": "A PH domain within OCRL bridges clathrin-mediated membrane trafficking to phosphoinositide metabolism.", "journal": "The EMBO journal", "date": "2009", "authors": "Mao Y, Balkin DM, Zoncu R, Erdmann KS, Tomasini L, Hu F, Jin MM, Hodsdon ME, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19536138", "url": "https://glygen.org/publication/PubMed/19536138" } ] }, { "title": "Molecular circuitry of endocytosis at nerve terminals.", "journal": "Annual review of cell and developmental biology", "date": "2009", "authors": "Dittman J, Ryan TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19575674", "url": "https://glygen.org/publication/PubMed/19575674" } ] }, { "title": "Rab GTPases as coordinators of vesicle traffic.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19603039", "url": "https://glygen.org/publication/PubMed/19603039" } ] }, { "title": "A single amino acid substitution in a common African allele of the CD4 molecule ablates binding of the monoclonal antibody, OKT4.", "journal": "Molecular immunology", "date": "1991", "authors": "Lederman S, DeMartino JA, Daugherty BL, Foeldvari I, Yellin MJ, Cleary AM, Berkowitz N, Lowy I, Braunstein NS, Mark GE, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "1961196", "url": "https://glygen.org/publication/PubMed/1961196" } ] }, { "title": "NPXY, a sequence often found in cytoplasmic tails, is required for coated pit-mediated internalization of the low density lipoprotein receptor.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Chen WJ, Goldstein JL, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "1968060", "url": "https://glygen.org/publication/PubMed/1968060" } ] }, { "title": "Tickets to ride: selecting cargo for clathrin-regulated internalization.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19696796", "url": "https://glygen.org/publication/PubMed/19696796" } ] }, { "title": "Endocytosis and signalling: intertwining molecular networks.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Sorkin A, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19696798", "url": "https://glygen.org/publication/PubMed/19696798" } ] }, { "title": "Syp1 is a conserved endocytic adaptor that contains domains involved in cargo selection and membrane tubulation.", "journal": "The EMBO journal", "date": "2009", "authors": "Reider A, Barker SL, Mishra SK, Im YJ, Maldonado-Baez L, Hurley JH, Traub LM, Wendland B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19713939", "url": "https://glygen.org/publication/PubMed/19713939" } ] }, { "title": "Stonins--specialized adaptors for synaptic vesicle recycling and beyond?", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Maritzen T, Podufall J, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19732400", "url": "https://glygen.org/publication/PubMed/19732400" } ] }, { "title": "Early-arriving Syp1p and Ede1p function in endocytic site placement and formation in budding yeast.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Stimpson HE, Toret CP, Cheng AT, Pauly BS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19776351", "url": "https://glygen.org/publication/PubMed/19776351" } ] }, { "title": "Distinct dynamics of endocytic clathrin-coated pits and coated plaques.", "journal": "PLoS biology", "date": "2009", "authors": "Saffarian S, Cocucci E, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "19809571", "url": "https://glygen.org/publication/PubMed/19809571" } ] }, { "title": "Arrestin development: emerging roles for beta-arrestins in developmental signaling pathways.", "journal": "Developmental cell", "date": "2009", "authors": "Kovacs JJ, Hara MR, Davenport CL, Kim J, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "19853559", "url": "https://glygen.org/publication/PubMed/19853559" } ] }, { "title": "Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells.", "journal": "Biochemistry", "date": "1991", "authors": "Spellman MW, Leonard CK, Basa LJ, Gelineo I, van Halbeek H", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730#ptm_processing" }, { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" } ], "reference": [ { "type": "PubMed", "id": "2001369", "url": "https://glygen.org/publication/PubMed/2001369" } ] }, { "title": "Structure of clathrin coat with bound Hsc70 and auxilin: mechanism of Hsc70-facilitated disassembly.", "journal": "The EMBO journal", "date": "2010", "authors": "Xing Y, Bocking T, Wolf M, Grigorieff N, Kirchhausen T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20033059", "url": "https://glygen.org/publication/PubMed/20033059" } ] }, { "title": "Coordinated actions of actin and BAR proteins upstream of dynamin at endocytic clathrin-coated pits.", "journal": "Developmental cell", "date": "2009", "authors": "Ferguson SM, Raimondi A, Paradise S, Shen H, Mesaki K, Ferguson A, Destaing O, Ko G, Takasaki J, Cremona O, O' Toole E, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20059951", "url": "https://glygen.org/publication/PubMed/20059951" } ] }, { "title": "Crystal structure of defensin HNP-3, an amphiphilic dimer: mechanisms of membrane permeabilization.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Hill CP, Yee J, Selsted ME, Eisenberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "2006422", "url": "https://glygen.org/publication/PubMed/2006422" } ] }, { "title": "Serine phosphorylation-independent downregulation of cell-surface CD4 by nef.", "journal": "Nature", "date": "1991", "authors": "Garcia JV, Miller AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-167590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167590" } ], "reference": [ { "type": "PubMed", "id": "2014052", "url": "https://glygen.org/publication/PubMed/2014052" } ] }, { "title": "ArfGAP1 interacts with coat proteins through tryptophan-based motifs.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Rawet M, Levi-Tal S, Szafer-Glusman E, Parnis A, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20211604", "url": "https://glygen.org/publication/PubMed/20211604" } ] }, { "title": "Cargo- and adaptor-specific mechanisms regulate clathrin-mediated endocytosis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mettlen M, Loerke D, Yarar D, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20231386", "url": "https://glygen.org/publication/PubMed/20231386" } ] }, { "title": "CD45-Csk phosphatase-kinase titration uncouples basal and inducible T cell receptor signaling during thymic development.", "journal": "Immunity", "date": "2010", "authors": "Zikherman J, Jenne C, Watson S, Doan K, Raschke W, Goodnow CC, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "20346773", "url": "https://glygen.org/publication/PubMed/20346773" } ] }, { "title": "Alpha-AP-2 directs myosin VI-dependent endocytosis of cystic fibrosis transmembrane conductance regulator chloride channels in the intestine.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Collaco A, Jakab R, Hegan P, Mooseker M, Ameen N", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "20351096", "url": "https://glygen.org/publication/PubMed/20351096" } ] }, { "title": "G domain dimerization controls dynamin's assembly-stimulated GTPase activity.", "journal": "Nature", "date": "2010", "authors": "Chappie JS, Acharya S, Leonard M, Schmid SL, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20428113", "url": "https://glygen.org/publication/PubMed/20428113" } ] }, { "title": "FCHo proteins are nucleators of clathrin-mediated endocytosis.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Henne WM, Boucrot E, Meinecke M, Evergren E, Vallis Y, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20448150", "url": "https://glygen.org/publication/PubMed/20448150" } ] }, { "title": "Structure of the PTEN-like region of auxilin, a detector of clathrin-coated vesicle budding.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Guan R, Dai H, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20826345", "url": "https://glygen.org/publication/PubMed/20826345" } ] }, { "title": "Intersectin 1 forms complexes with SGIP1 and Reps1 in clathrin-coated pits.", "journal": "Biochemical and biophysical research communications", "date": "2010", "authors": "Dergai O, Novokhatska O, Dergai M, Skrypkina I, Tsyba L, Moreau J, Rynditch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "20946875", "url": "https://glygen.org/publication/PubMed/20946875" } ] }, { "title": "Structural features of the cytoplasmic region of CD4 required for internalization.", "journal": "The EMBO journal", "date": "1990", "authors": "Shin J, Doyle C, Yang Z, Kappes D, Strominger JL", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" } ], "reference": [ { "type": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" } ] }, { "title": "CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.", "journal": "The EMBO journal", "date": "2011", "authors": "Granata A, Koo SJ, Haucke V, Schiavo G, Warner TT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21102408", "url": "https://glygen.org/publication/PubMed/21102408" } ] }, { "title": "Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments.", "journal": "Cell", "date": "1990", "authors": "Chavrier P, Parton RG, Hauri HP, Simons K, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "2115402", "url": "https://glygen.org/publication/PubMed/2115402" } ] }, { "title": "Clinical development of mAbs to block the PD1 pathway as an immunotherapy for cancer.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2010", "authors": "Kline J, Gajewski TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "21154117", "url": "https://glygen.org/publication/PubMed/21154117" } ] }, { "title": "Local clustering of transferrin receptors promotes clathrin-coated pit initiation.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Liu AP, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21187331", "url": "https://glygen.org/publication/PubMed/21187331" } ] }, { "title": "Single-molecule analysis of a molecular disassemblase reveals the mechanism of Hsc70-driven clathrin uncoating.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Bocking T, Aguet F, Harrison SC, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21278753", "url": "https://glygen.org/publication/PubMed/21278753" } ] }, { "title": "Synaptojanin 1-mediated PI(4,5)P2 hydrolysis is modulated by membrane curvature and facilitates membrane fission.", "journal": "Developmental cell", "date": "2011", "authors": "Chang-Ileto B, Frere SG, Chan RB, Voronov SV, Roux A, Di Paolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21316588", "url": "https://glygen.org/publication/PubMed/21316588" } ] }, { "title": "A high precision survey of the molecular dynamics of mammalian clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2011", "authors": "Taylor MJ, Perrais D, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21445324", "url": "https://glygen.org/publication/PubMed/21445324" } ] }, { "title": "Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains.", "journal": "The Journal of experimental medicine", "date": "1990", "authors": "Larsen A, Davis T, Curtis BM, Gimpel S, Sims JE, Cosman D, Park L, Sorensen E, March CJ, Smith CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "2147944", "url": "https://glygen.org/publication/PubMed/2147944" } ] }, { "title": "A sequential mechanism for clathrin cage disassembly by 70-kDa heat-shock cognate protein (Hsc70) and auxilin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Rothnie A, Clarke AR, Kuzmic P, Cameron A, Smith CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21482805", "url": "https://glygen.org/publication/PubMed/21482805" } ] }, { "title": "ARFGAP1 promotes AP-2-dependent endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Bai M, Gad H, Turacchio G, Cocucci E, Yang JS, Li J, Beznoussenko GV, Nie Z, Luo R, Fu L, Collawn JF, Kirchhausen T, Luini A, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21499258", "url": "https://glygen.org/publication/PubMed/21499258" } ] }, { "title": "Regulation of Src family kinases involved in T cell receptor signaling by protein-tyrosine phosphatase CD148.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Stepanek O, Kalina T, Draber P, Skopcova T, Svojgr K, Angelisova P, Horejsi V, Weiss A, Brdicka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "21543337", "url": "https://glygen.org/publication/PubMed/21543337" } ] }, { "title": "Phosphatidylinositol-(4,5)-bisphosphate regulates clathrin-coated pit initiation, stabilization, and size.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Antonescu CN, Aguet F, Danuser G, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21613550", "url": "https://glygen.org/publication/PubMed/21613550" } ] }, { "title": "A cytokine gene screen uncovers SOCS1 as genetic risk factor for multiple sclerosis.", "journal": "Genes and immunity", "date": "2012", "authors": "Vandenbroeck K, Alvarez J, Swaminathan B, Alloza I, Matesanz F, Urcelay E, Comabella M, Alcina A, Fedetz M, Ortiz MA, Izquierdo G, Fernandez O, Rodriguez-Ezpeleta N, Matute C, Caillier S, Arroyo R, Montalban X, Oksenberg JR, Antiguedad A, Aransay A", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "21716315", "url": "https://glygen.org/publication/PubMed/21716315" } ] }, { "title": "Molecular mechanism and physiological functions of clathrin-mediated endocytosis.", "journal": "Nature reviews. Molecular cell biology", "date": "2011", "authors": "McMahon HT, Boucrot E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21779028", "url": "https://glygen.org/publication/PubMed/21779028" } ] }, { "title": "Actin dynamics counteract membrane tension during clathrin-mediated endocytosis.", "journal": "Nature cell biology", "date": "2011", "authors": "Boulant S, Kural C, Zeeh JC, Ubelmann F, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21841790", "url": "https://glygen.org/publication/PubMed/21841790" } ] }, { "title": "Hotspots organize clathrin-mediated endocytosis by efficient recruitment and retention of nucleating resources.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2011", "authors": "Nunez D, Antonescu C, Mettlen M, Liu A, Schmid SL, Loerke D, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21883765", "url": "https://glygen.org/publication/PubMed/21883765" } ] }, { "title": "Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Wang XX, Li Y, Yin Y, Mo M, Wang Q, Gao W, Wang L, Mariuzza RA", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "21900604", "url": "https://glygen.org/publication/PubMed/21900604" } ] }, { "title": "Characterization of the fusion domain of the human immunodeficiency virus type 1 envelope glycoprotein gp41.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Freed EO, Myers DJ, Risser R", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2191297", "url": "https://glygen.org/publication/PubMed/2191297" } ] }, { "title": "Crystal structure of nucleotide-free dynamin.", "journal": "Nature", "date": "2011", "authors": "Faelber K, Posor Y, Gao S, Held M, Roske Y, Schulze D, Haucke V, Noe F, Daumke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927000", "url": "https://glygen.org/publication/PubMed/21927000" } ] }, { "title": "The crystal structure of dynamin.", "journal": "Nature", "date": "2011", "authors": "Ford MG, Jenni S, Nunnari J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21927001", "url": "https://glygen.org/publication/PubMed/21927001" } ] }, { "title": "A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.", "journal": "Cell", "date": "2011", "authors": "Chappie JS, Mears JA, Fang S, Leonard M, Schmid SL, Milligan RA, Hinshaw JE, Dyda F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "21962517", "url": "https://glygen.org/publication/PubMed/21962517" } ] }, { "title": "Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.", "journal": "The Biochemical journal", "date": "2012", "authors": "Fu L, Rab A, Tang LP, Rowe SM, Bebok Z, Collawn JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "21995445", "url": "https://glygen.org/publication/PubMed/21995445" } ] }, { "title": "The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Yuen CT, Carr SA, Feizi T", "evidence": [ { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" } ], "reference": [ { "type": "PubMed", "id": "2209609", "url": "https://glygen.org/publication/PubMed/2209609" } ] }, { "title": "Recruitment of endophilin to clathrin-coated pit necks is required for efficient vesicle uncoating after fission.", "journal": "Neuron", "date": "2011", "authors": "Milosevic I, Giovedi S, Lou X, Raimondi A, Collesi C, Shen H, Paradise S, O'Toole E, Ferguson S, Cremona O, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22099461", "url": "https://glygen.org/publication/PubMed/22099461" } ] }, { "title": "The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.", "journal": "Cell", "date": "2011", "authors": "Miller SE, Sahlender DA, Graham SC, Honing S, Robinson MS, Peden AA, Owen DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22118466", "url": "https://glygen.org/publication/PubMed/22118466" } ] }, { "title": "CD4 is retained in the endoplasmic reticulum by the human immunodeficiency virus type 1 glycoprotein precursor.", "journal": "Journal of virology", "date": "1990-11", "authors": "Crise B, Buonocore L, Rose J K", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "2214026", "url": "https://glygen.org/publication/PubMed/2214026" } ] }, { "title": "Dynamin, a membrane-remodelling GTPase.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Ferguson SM, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22233676", "url": "https://glygen.org/publication/PubMed/22233676" } ] }, { "title": "The role of ubiquitylation in receptor endocytosis and endosomal sorting.", "journal": "Journal of cell science", "date": "2012", "authors": "Haglund K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22357968", "url": "https://glygen.org/publication/PubMed/22357968" } ] }, { "title": "LYP inhibits T-cell activation when dissociated from CSK.", "journal": "Nature chemical biology", "date": "2012", "authors": "Vang T, Liu WH, Delacroix L, Wu S, Vasile S, Dahl R, Yang L, Musumeci L, Francis D, Landskron J, Tasken K, Tremblay ML, Lie BA, Page R, Mustelin T, Rahmouni S, Rickert RC, Tautz L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "22426112", "url": "https://glygen.org/publication/PubMed/22426112" } ] }, { "title": "Crystal structure of an HIV-binding recombinant fragment of human CD4.", "journal": "Nature", "date": "1990", "authors": "Ryu SE, Kwong PD, Truneh A, Porter TG, Arthos J, Rosenberg M, Dai XP, Xuong NH, Axel R, Sweet RW, et al.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2247146", "url": "https://glygen.org/publication/PubMed/2247146" } ] }, { "title": "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.", "journal": "Nature cell biology", "date": "2012", "authors": "Umasankar PK, Sanker S, Thieman JR, Chakraborty S, Wendland B, Tsang M, Traub LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22484487", "url": "https://glygen.org/publication/PubMed/22484487" } ] }, { "title": "A feedback loop between dynamin and actin recruitment during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2012", "authors": "Taylor MJ, Lampe M, Merrifield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22505844", "url": "https://glygen.org/publication/PubMed/22505844" } ] }, { "title": "Transferrin receptor internalization sequence YXRF implicates a tight turn as the structural recognition motif for endocytosis.", "journal": "Cell", "date": "1990", "authors": "Collawn JF, Stangel M, Kuhn LA, Esekogwu V, Jing SQ, Trowbridge IS, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2257624", "url": "https://glygen.org/publication/PubMed/2257624" } ] }, { "title": "BRAG2/GEP100/IQSec1 interacts with clathrin and regulates alpha5beta1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Moravec R, Conger KK, D'Souza R, Allison AB, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22815487", "url": "https://glygen.org/publication/PubMed/22815487" } ] }, { "title": "The first five seconds in the life of a clathrin-coated pit.", "journal": "Cell", "date": "2012", "authors": "Cocucci E, Aguet F, Boulant S, Kirchhausen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "22863004", "url": "https://glygen.org/publication/PubMed/22863004" } ] }, { "title": "The epsin protein family: coordinators of endocytosis and signaling.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Sen A, Madhivanan K, Mukherjee D, Aguilar RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "22942912", "url": "https://glygen.org/publication/PubMed/22942912" } ] }, { "title": "A variant upstream of IFNL3 (IL28B) creating a new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus.", "journal": "Nature genetics", "date": "2013", "authors": "Prokunina-Olsson L, Muchmore B, Tang W, Pfeiffer RM, Park H, Dickensheets H, Hergott D, Porter-Gill P, Mumy A, Kohaar I, Chen S, Brand N, Tarway M, Liu L, Sheikh F, Astemborski J, Bonkovsky HL, Edlin BR, Howell CD, Morgan TR, Thomas DL, Rehermann B, Donnelly RP, O'Brien TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "23291588", "url": "https://glygen.org/publication/PubMed/23291588" } ] }, { "title": "Cooperative recruitment of dynamin and BIN/amphiphysin/Rvs (BAR) domain-containing proteins leads to GTP-dependent membrane scission.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Meinecke M, Boucrot E, Camdere G, Hon WC, Mittal R, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23297414", "url": "https://glygen.org/publication/PubMed/23297414" } ] }, { "title": "Beyond the standard of care: a review of novel immunotherapy trials for the treatment of lung cancer.", "journal": "Cancer control : journal of the Moffitt Cancer Center", "date": "2013", "authors": "Hall RD, Gray JE, Chiappori AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "23302904", "url": "https://glygen.org/publication/PubMed/23302904" } ] }, { "title": "Divergent modes for cargo-mediated control of clathrin-coated pit dynamics.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Soohoo AL, Puthenveedu MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23536704", "url": "https://glygen.org/publication/PubMed/23536704" } ] }, { "title": "The large ectodomains of CD45 and CD148 regulate their segregation from and inhibition of ligated T-cell receptor.", "journal": "Blood", "date": "2013", "authors": "Cordoba SP, Choudhuri K, Zhang H, Bridge M, Basat AB, Dustin ML, van der Merwe PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "23580664", "url": "https://glygen.org/publication/PubMed/23580664" } ] }, { "title": "Retroviral envelope glycoproteins contain a `leucine zipper`-like repeat.", "journal": "AIDS research and human retroviruses", "date": "1990", "authors": "Delwart EL, Mosialos G, Gilmore T", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2364015", "url": "https://glygen.org/publication/PubMed/2364015" } ] }, { "title": "Receptor-type protein-tyrosine phosphatase zeta is a functional receptor for interleukin-34.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Nandi S, Cioce M, Yeung YG, Nieves E, Tesfa L, Lin H, Hsu AW, Halenbeck R, Cheng HY, Gokhan S, Mehler MF, Stanley ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "23744080", "url": "https://glygen.org/publication/PubMed/23744080" } ] }, { "title": "Spatiotemporal control of endocytosis by phosphatidylinositol-3,4-bisphosphate.", "journal": "Nature", "date": "2013", "authors": "Posor Y, Eichhorn-Gruenig M, Puchkov D, Schoneberg J, Ullrich A, Lampe A, Muller R, Zarbakhsh S, Gulluni F, Hirsch E, Krauss M, Schultz C, Schmoranzer J, Noe F, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23823722", "url": "https://glygen.org/publication/PubMed/23823722" } ] }, { "title": "Dual role of BAR domain-containing proteins in regulating vesicle release catalyzed by the GTPase, dynamin-2.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Neumann S, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23861397", "url": "https://glygen.org/publication/PubMed/23861397" } ] }, { "title": "Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.", "journal": "Developmental cell", "date": "2013", "authors": "Aguet F, Antonescu CN, Mettlen M, Schmid SL, Danuser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "23891661", "url": "https://glygen.org/publication/PubMed/23891661" } ] }, { "title": "NECAP 1 regulates AP-2 interactions to control vesicle size, number, and cargo during clathrin-mediated endocytosis.", "journal": "PLoS biology", "date": "2013", "authors": "Ritter B, Murphy S, Dokainish H, Girard M, Gudheti MV, Kozlov G, Halin M, Philie J, Jorgensen EM, Gehring K, McPherson PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24130457", "url": "https://glygen.org/publication/PubMed/24130457" } ] }, { "title": "Cargo recognition in clathrin-mediated endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Traub LM, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24186068", "url": "https://glygen.org/publication/PubMed/24186068" } ] }, { "title": "Binding of the human retrovirus HTLV-III/LAV/ARV/HIV to the CD4 (T4) molecule: conformation dependence, epitope mapping, antibody inhibition, and potential for idiotypic mimicry.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "McDougal JS, Nicholson JK, Cross GD, Cort SP, Kennedy MS, Mawle AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2428879", "url": "https://glygen.org/publication/PubMed/2428879" } ] }, { "title": "Ubiquitin-dependent sorting in endocytosis.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Piper RC, Dikic I, Lukacs GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24384571", "url": "https://glygen.org/publication/PubMed/24384571" } ] }, { "title": "Delineation of a region of the human immunodeficiency virus type 1 gp120 glycoprotein critical for interaction with the CD4 receptor.", "journal": "Cell", "date": "1987", "authors": "Lasky LA, Nakamura G, Smith DH, Fennie C, Shimasaki C, Patzer E, Berman P, Gregory T, Capon DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2441877", "url": "https://glygen.org/publication/PubMed/2441877" } ] }, { "title": "BAR domain scaffolds in dynamin-mediated membrane fission.", "journal": "Cell", "date": "2014", "authors": "Daumke O, Roux A, Haucke V", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24581490", "url": "https://glygen.org/publication/PubMed/24581490" } ] }, { "title": "Role of beta-arrestins and arrestin domain-containing proteins in G protein-coupled receptor trafficking.", "journal": "Current opinion in cell biology", "date": "2014", "authors": "Kang DS, Tian X, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24680432", "url": "https://glygen.org/publication/PubMed/24680432" } ] }, { "title": "CD4+ T Cells: guardians of the phagosome.", "journal": "Clin. Microbiol. Rev.", "date": "2014", "authors": "Tubo Noah J, Jenkins Marc K", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "24696433", "url": "https://glygen.org/publication/PubMed/24696433" } ] }, { "title": "Regulation of clathrin-mediated endocytosis by dynamic ubiquitination and deubiquitination.", "journal": "Current biology : CB", "date": "2014", "authors": "Weinberg JS, Drubin DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "24746795", "url": "https://glygen.org/publication/PubMed/24746795" } ] }, { "title": "Molecular structure, function, and dynamics of clathrin-mediated membrane traffic.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Kirchhausen T, Owen D, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24789820", "url": "https://glygen.org/publication/PubMed/24789820" } ] }, { "title": "CD4 ligation on human blood monocytes triggers macrophage differentiation and enhances HIV infection.", "journal": "Journal of virology", "date": "2014", "authors": "Zhen A, Krutzik SR, Levin BR, Kasparian S, Zack JA, Kitchen SG", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "24942581", "url": "https://glygen.org/publication/PubMed/24942581" } ] }, { "title": "Inositol lipid phosphatases in membrane trafficking and human disease.", "journal": "The Biochemical journal", "date": "2014", "authors": "Billcliff PG, Lowe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "24966051", "url": "https://glygen.org/publication/PubMed/24966051" } ] }, { "title": "Purification and characterization of human neutrophil peptide 4, a novel member of the defensin family.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Wilde CG, Griffith JE, Marra MN, Snable JL, Scott RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "2500436", "url": "https://glygen.org/publication/PubMed/2500436" } ] }, { "title": "A role of OCRL in clathrin-coated pit dynamics and uncoating revealed by studies of Lowe syndrome cells.", "journal": "eLife", "date": "2014", "authors": "Nandez R, Balkin DM, Messa M, Liang L, Paradise S, Czapla H, Hein MY, Duncan JS, Mann M, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25107275", "url": "https://glygen.org/publication/PubMed/25107275" } ] }, { "title": "Phosphorylation and down-regulation of CD4 and CD8 in human CTLs and mouse L cells.", "journal": "Immunogenetics", "date": "1989", "authors": "DiSanto JP, Klein JS, Flomenberg N", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "2512251", "url": "https://glygen.org/publication/PubMed/2512251" } ] }, { "title": "The membrane-associated proteins FCHo and SGIP are allosteric activators of the AP2 clathrin adaptor complex.", "journal": "eLife", "date": "2014", "authors": "Hollopeter G, Lange JJ, Zhang Y, Vu TN, Gu M, Ailion M, Lambie EJ, Slaughter BD, Unruh JR, Florens L, Jorgensen EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25303366", "url": "https://glygen.org/publication/PubMed/25303366" } ] }, { "title": "Expression of CD45 alters phosphorylation of the lck-encoded tyrosine protein kinase in murine lymphoma T-cell lines.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Ostergaard HL, Shackelford DA, Hurley TR, Johnson P, Hyman R, Sefton BM, Trowbridge IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "2530588", "url": "https://glygen.org/publication/PubMed/2530588" } ] }, { "title": "Rab proteins and the compartmentalization of the endosomal system.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2014", "authors": "Wandinger-Ness A, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "25341920", "url": "https://glygen.org/publication/PubMed/25341920" } ] }, { "title": "Identification of the fusion peptide of primate immunodeficiency viruses.", "journal": "Science (New York, N.Y.)", "date": "1989", "authors": "Bosch ML, Earl PL, Fargnoli K, Picciafuoco S, Giombini F, Wong-Staal F, Franchini G", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2541505", "url": "https://glygen.org/publication/PubMed/2541505" } ] }, { "title": "Syndecan-1 regulates the biological activities of interleukin-34.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Segaliny AI, Brion R, Mortier E, Maillasson M, Cherel M, Jacques Y, Le Goff B, Heymann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "25662098", "url": "https://glygen.org/publication/PubMed/25662098" } ] }, { "title": "Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730#ptm_processing" }, { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "UniCarbKB", "id": "P01730", "url": "" }, { "database": "GlyConnect", "id": "587", "url": "https://glyconnect.expasy.org/browser/proteins/587" } ], "reference": [ { "type": "PubMed", "id": "2592374", "url": "https://glygen.org/publication/PubMed/2592374" } ] }, { "title": "The role of molecular chaperones in clathrin mediated vesicular trafficking.", "journal": "Frontiers in molecular biosciences", "date": "2015", "authors": "Sousa R, Lafer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26042225", "url": "https://glygen.org/publication/PubMed/26042225" } ] }, { "title": "IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.", "journal": "Cytokine", "date": "2015", "authors": "Segaliny AI, Brion R, Brulin B, Maillasson M, Charrier C, Teletchea S, Heymann D", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "26095744", "url": "https://glygen.org/publication/PubMed/26095744" } ] }, { "title": "Forty Years of Clathrin-coated Vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Robinson MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "26403691", "url": "https://glygen.org/publication/PubMed/26403691" } ] }, { "title": "Interaction of human defensins with Escherichia coli. Mechanism of bactericidal activity.", "journal": "The Journal of clinical investigation", "date": "1989", "authors": "Lehrer RI, Barton A, Daher KA, Harwig SS, Ganz T, Selsted ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "2668334", "url": "https://glygen.org/publication/PubMed/2668334" } ] }, { "title": "beta-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.", "journal": "Nature cell biology", "date": "2016", "authors": "Eichel K, Jullie D, von Zastrow M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "26829388", "url": "https://glygen.org/publication/PubMed/26829388" } ] }, { "title": "Remarkably low affinity of CD4/peptide-major histocompatibility complex class II protein interactions.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2016", "authors": "Jonsson P, Southcombe JH, Santos AM, Huo J, Fernandes RA, McColl J, Lever M, Evans EJ, Hudson A, Chang VT, Hanke T, Godkin A, Dunne PD, Horrocks MH, Palayret M, Screaton GR, Petersen J, Rossjohn J, Fugger L, Dushek O, Xu XN, Davis SJ, Klenerman D", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "27114505", "url": "https://glygen.org/publication/PubMed/27114505" } ] }, { "title": "A general model for the transmembrane proteins of HIV and other retroviruses.", "journal": "AIDS research and human retroviruses", "date": "1989", "authors": "Gallaher WR, Ball JM, Garry RF, Griffin MC, Montelaro RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2788443", "url": "https://glygen.org/publication/PubMed/2788443" } ] }, { "title": "An unexpected N-terminal loop in PD-1 dominates binding by nivolumab.", "journal": "Nature communications", "date": "2017", "authors": "Tan S, Zhang H, Chai Y, Song H, Tong Z, Wang Q, Qi J, Wong G, Zhu X, Liu WJ, Gao S, Wang Z, Shi Y, Yang F, Gao GF, Yan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "28165004", "url": "https://glygen.org/publication/PubMed/28165004" } ] }, { "title": "Interaction between CD4 and class II MHC molecules mediates cell adhesion.", "journal": "Nature", "date": "1987", "authors": "Doyle C, Strominger J L", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "2823150", "url": "https://glygen.org/publication/PubMed/2823150" } ] }, { "title": "Characterization of the Anti-PD-1 Antibody REGN2810 and Its Antitumor Activity in Human PD-1 Knock-In Mice.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Burova E, Hermann A, Waite J, Potocky T, Lai V, Hong S, Liu M, Allbritton O, Woodruff A, Wu Q, D'Orvilliers A, Garnova E, Rafique A, Poueymirou W, Martin J, Huang T, Skokos D, Kantrowitz J, Popke J, Mohrs M, MacDonald D, Ioffe E, Olson W, Lowy I, Murphy A, Thurston G", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "28265006", "url": "https://glygen.org/publication/PubMed/28265006" } ] }, { "title": "Quantitative measurement of fusion between human immunodeficiency virus and cultured cells using membrane fluorescence dequenching.", "journal": "FEBS letters", "date": "1988", "authors": "Sinangil F, Loyter A, Volsky DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "2846352", "url": "https://glygen.org/publication/PubMed/2846352" } ] }, { "title": "Endocytic sorting motif interactions involved in Nef-mediated downmodulation of CD4 and CD3.", "journal": "Nature communications", "date": "2017-09-05", "authors": "Manrique Santiago, Sauter Daniel, Horenkamp Florian A, L\u00fclf Sebastian, Yu Hangxing, Hotter Dominik, Anand Kanchan, Kirchhoff Frank, Geyer Matthias", "evidence": [ { "database": "iPTMnet", "id": "P01730", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01730" } ], "reference": [ { "type": "PubMed", "id": "28874665", "url": "https://glygen.org/publication/PubMed/28874665" } ] }, { "title": "Clathrin assembly proteins: affinity purification and a model for coat assembly.", "journal": "The Journal of cell biology", "date": "1987", "authors": "Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "2890644", "url": "https://glygen.org/publication/PubMed/2890644" } ] }, { "title": "PD-1 Blockade with Cemiplimab in Advanced Cutaneous Squamous-Cell Carcinoma.", "journal": "The New England journal of medicine", "date": "2018", "authors": "Migden MR, Rischin D, Schmults CD, Guminski A, Hauschild A, Lewis KD, Chung CH, Hernandez-Aya L, Lim AM, Chang ALS, Rabinowits G, Thai AA, Dunn LA, Hughes BGM, Khushalani NI, Modi B, Schadendorf D, Gao B, Seebach F, Li S, Li J, Mathias M, Booth J, Mohan K, Stankevich E, Babiker HM, Brana I, Gil-Martin M, Homsi J, Johnson ML, Moreno V, Niu J, Owonikoko TK, Papadopoulos KP, Yancopoulos GD, Lowy I, Fury MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "29863979", "url": "https://glygen.org/publication/PubMed/29863979" } ] }, { "title": "The isolation and nucleotide sequence of a cDNA encoding the T cell surface protein T4: a new member of the immunoglobulin gene family.", "journal": "Cell", "date": "1985", "authors": "Maddon P J, Littman D R, Godfrey M, Maddon D E, Chess L, Axel R", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "2990730", "url": "https://glygen.org/publication/PubMed/2990730" } ] }, { "title": "Defensins. Natural peptide antibiotics of human neutrophils.", "journal": "The Journal of clinical investigation", "date": "1985", "authors": "Ganz T, Selsted ME, Szklarek D, Harwig SS, Daher K, Bainton DF, Lehrer RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "2997278", "url": "https://glygen.org/publication/PubMed/2997278" } ] }, { "title": "Binding of HTLV-III/LAV to T4+ T cells by a complex of the 110K viral protein and the T4 molecule.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "McDougal JS, Kennedy MS, Sligh JM, Cort SP, Mawle A, Nicholson JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "3001934", "url": "https://glygen.org/publication/PubMed/3001934" } ] }, { "title": "PD-1/ PD-L1 blockade as a novel treatment for colorectal cancer.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2019", "authors": "Yaghoubi N, Soltani A, Ghazvini K, Hassanian SM, Hashemy SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "30522017", "url": "https://glygen.org/publication/PubMed/30522017" } ] }, { "title": "Camrelizumab: First Global Approval.", "journal": "Drugs", "date": "2019", "authors": "Markham A, Keam SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "31313098", "url": "https://glygen.org/publication/PubMed/31313098" } ] }, { "title": "Complete Multilineage CD4 Expression Defect Associated With Warts Due to an Inherited Homozygous CD4 Gene Mutation.", "journal": "Front. Immunol.", "date": "2019", "authors": "Fernandes Rosa Anita, Perez-Andres Martin, Blanco Elena, Jara-Acevedo Maria, Criado Ignacio, Almeida Julia, Botafogo Vitor, Coutinho Ines, Paiva Artur, van Dongen Jacques J M, Orfao Alberto, Faria Emilia", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "31781092", "url": "https://glygen.org/publication/PubMed/31781092" } ] }, { "title": "Corrected CD4 sequence.", "journal": "Cell", "date": "1988", "authors": "Littman D R, Maddon P J, Axel R", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "3263213", "url": "https://glygen.org/publication/PubMed/3263213" } ] }, { "title": "Lost in Translation: Lack of CD4 Expression due to a Novel Genetic Defect.", "journal": "J. Infect. Dis.", "date": "2021", "authors": "Lisco Andrea, Ye Peying, Wong Chun-Shu, Pei Luxin, Hsu Amy P, Mace Emily M, Orange Jordan S, Lage Silvia Lucena, Ward Addison Jon, Migueles Stephen A, Connors Mark, Anderson Megan V, Buckner Clarisa M, Moir Susan, Rupert Adam, Dulau-Florea Alina, Ogbogu Princess, Timberlake Dylan, Notarangelo Luigi D, Pittaluga Stefania, Abraham Roshini S, Sereti Irini", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "33471124", "url": "https://glygen.org/publication/PubMed/33471124" } ] }, { "title": "Deep-etch visualization of proteins involved in clathrin assembly.", "journal": "The Journal of cell biology", "date": "1988", "authors": "Heuser JE, Keen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "3417785", "url": "https://glygen.org/publication/PubMed/3417785" } ] }, { "title": "Functional regions of the envelope glycoprotein of human immunodeficiency virus type 1.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Kowalski M, Potz J, Basiripour L, Dorfman T, Goh WC, Terwilliger E, Dayton A, Rosen C, Haseltine W, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "3629244", "url": "https://glygen.org/publication/PubMed/3629244" } ] }, { "title": "Lack of Association between Common LAG3/CD4 Variants and Risk of Migraine.", "journal": "International journal of molecular sciences", "date": "2023", "authors": "Garcia-Martin E, Navarro-Munoz S, Ayuso P, Rodriguez C, Serrador M, Alonso-Navarro H, Calleja M, Navacerrada F, Turpin-Fenoll L, Recio-Bermejo M, Garcia-Ruiz R, Millan-Pascual J, Plaza-Nieto JF, Garcia-Albea E, Agundez JAG, Jimenez-Jimenez FJ", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ], "reference": [ { "type": "PubMed", "id": "36674807", "url": "https://glygen.org/publication/PubMed/36674807" } ] }, { "title": "CD4+CD25+CD127loFOXP3+ cell in food allergy: Does it predict anaphylaxis?", "journal": "Allergologia et immunopathologia", "date": "2023", "authors": "Erdem Semiha Bahceci, Genel Ferah, Nacaroglu Hikmet Tekin, Karaman Sait, Kark\u0131ner Canan Sule Unsal, S\u00fcr\u00fcc\u00fc Murat, Can Demet", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ], "reference": [ { "type": "PubMed", "id": "37169554", "url": "https://glygen.org/publication/PubMed/37169554" } ] }, { "title": "Stem-cell-like CD4+ T cells prey on MHC class II-negative tumors.", "journal": "Nature immunology", "date": "2023-08", "authors": "Veatch Joshua R, Riddell Stanley R", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ], "reference": [ { "type": "PubMed", "id": "37460640", "url": "https://glygen.org/publication/PubMed/37460640" } ] }, { "title": "HIV-1 Env trimers asymmetrically engage CD4 receptors in membranes.", "journal": "Nature", "date": "2023-11", "authors": "Li Wenwei, Qin Zhuan, Nand Elizabeth, Grunst Michael W, Grover Jonathan R, Bess Julian W, Lifson Jeffrey D, Zwick Michael B, Tagare Hemant D, Uchil Pradeep D, Mothes Walther", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ], "reference": [ { "type": "PubMed", "id": "37993716", "url": "https://glygen.org/publication/PubMed/37993716" } ] }, { "title": "Intermediate conformations of CD4-bound HIV-1 Env heterotrimers.", "journal": "Nature", "date": "2023-11", "authors": "Dam Kim-Marie A, Fan Chengcheng, Yang Zhi, Bjorkman Pamela J", "evidence": [ { "database": "RefSeq", "id": "NP_000607", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000607" } ], "reference": [ { "type": "PubMed", "id": "37993719", "url": "https://glygen.org/publication/PubMed/37993719" } ] }, { "title": "T-lymphocyte T4 molecule behaves as the receptor for human retrovirus LAV.", "journal": "Nature", "date": "1984", "authors": "Klatzmann D, Champagne E, Chamaret S, Gruest J, Guetard D, Hercend T, Gluckman JC, Montagnier L", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "6083454", "url": "https://glygen.org/publication/PubMed/6083454" } ] }, { "title": "The CD4 (T4) antigen is an essential component of the receptor for the AIDS retrovirus.", "journal": "Nature", "date": "1984", "authors": "Dalgleish AG, Beverley PC, Clapham PR, Crawford DH, Greaves MF, Weiss RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "6096719", "url": "https://glygen.org/publication/PubMed/6096719" } ] }, { "title": "An enzyme that removes clathrin coats: purification of an uncoating ATPase.", "journal": "The Journal of cell biology", "date": "1984", "authors": "Schlossman DM, Schmid SL, Braell WA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "6146630", "url": "https://glygen.org/publication/PubMed/6146630" } ] }, { "title": "Stimulation-dependent I kappa B alpha phosphorylation marks the NF-kappa B inhibitor for degradation via the ubiquitin-proteasome pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Alkalay I, Yaron A, Hatzubai A, Orian A, Ciechanover A, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "7479848", "url": "https://glygen.org/publication/PubMed/7479848" } ] }, { "title": "A molecular clasp in the human immunodeficiency virus (HIV) type 1 TM protein determines the anti-HIV activity of gp41 derivatives: implication for viral fusion.", "journal": "Journal of virology", "date": "1995", "authors": "Chen CH, Matthews TJ, McDanal CB, Bolognesi DP, Greenberg ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "7538176", "url": "https://glygen.org/publication/PubMed/7538176" } ] }, { "title": "Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Rivero-Lezcano OM, Marcilla A, Sameshima JH, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "7565724", "url": "https://glygen.org/publication/PubMed/7565724" } ] }, { "title": "Interaction of tyrosine-based sorting signals with clathrin-associated proteins.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Ohno H, Stewart J, Fournier MC, Bosshart H, Rhee I, Miyatake S, Saito T, Gallusser A, Kirchhausen T, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7569928", "url": "https://glygen.org/publication/PubMed/7569928" } ] }, { "title": "Oligomerization of CD4 is required for stable binding to class II major histocompatibility complex proteins but not for interaction with human immunodeficiency virus gp120.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Sakihama T, Smolyar A, Reinherz EL", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "7604010", "url": "https://glygen.org/publication/PubMed/7604010" } ] }, { "title": "The CD4-associated tyrosine kinase p56lck is required for lymphocyte chemoattractant factor-induced T lymphocyte migration.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Ryan TC, Cruikshank WW, Kornfeld H, Collins TL, Center DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "7615501", "url": "https://glygen.org/publication/PubMed/7615501" } ] }, { "title": "Characterization of neutralizing monoclonal antibodies to linear and conformation-dependent epitopes within the first and second variable domains of human immunodeficiency virus type 1 gp120.", "journal": "Journal of virology", "date": "1993", "authors": "McKeating JA, Shotton C, Cordell J, Graham S, Balfe P, Sullivan N, Charles M, Page M, Bolmstedt A, Olofsson S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "7687306", "url": "https://glygen.org/publication/PubMed/7687306" } ] }, { "title": "Requirement of N-terminal amino acid residues of gp41 for human immunodeficiency virus type 1-mediated cell fusion.", "journal": "Journal of virology", "date": "1995", "authors": "Schaal H, Klein M, Gehrmann P, Adams O, Scheid A", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "7745678", "url": "https://glygen.org/publication/PubMed/7745678" } ] }, { "title": "Evidence for the ligand-induced conversion from a dimer to a tetramer of the granulocyte colony-stimulating factor receptor.", "journal": "FEBS letters", "date": "1994", "authors": "Hiraoka O, Anaguchi H, Ota Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "7805849", "url": "https://glygen.org/publication/PubMed/7805849" } ] }, { "title": "Arrestin interactions with G protein-coupled receptors. Direct binding studies of wild type and mutant arrestins with rhodopsin, beta 2-adrenergic, and m2 muscarinic cholinergic receptors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Gurevich VV, Dion SB, Onorato JJ, Ptasienski J, Kim CM, Sterne-Marr R, Hosey MM, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "7822302", "url": "https://glygen.org/publication/PubMed/7822302" } ] }, { "title": "Interactions between human defensins and lipid bilayers: evidence for formation of multimeric pores.", "journal": "Protein science : a publication of the Protein Society", "date": "1994", "authors": "Wimley WC, Selsted ME, White SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "7833799", "url": "https://glygen.org/publication/PubMed/7833799" } ] }, { "title": "Dynamin self-assembles into rings suggesting a mechanism for coated vesicle budding.", "journal": "Nature", "date": "1995", "authors": "Hinshaw JE, Schmid SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "7877694", "url": "https://glygen.org/publication/PubMed/7877694" } ] }, { "title": "CD4 is a critical component of the receptor for human herpesvirus 7: interference with human immunodeficiency virus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-04-26", "authors": "Lusso P, Secchiero P, Crowley R W, Garzino-Demo A, Berneman Z N, Gallo R C", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "7909607", "url": "https://glygen.org/publication/PubMed/7909607" } ] }, { "title": "Evidence that HIV-1 Rev directly promotes the nuclear export of unspliced RNA.", "journal": "The EMBO journal", "date": "1994", "authors": "Fischer U, Meyer S, Teufel M, Heckel C, Luhrmann R, Rautmann G", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8076606", "url": "https://glygen.org/publication/PubMed/8076606" } ] }, { "title": "CD4 and CD8 expression by human and mouse thymic dendritic cells.", "journal": "Immunol. Lett.", "date": "1994", "authors": "Winkel K, Sotzik F, Vremec D, Cameron P U, Shortman K", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "8088877", "url": "https://glygen.org/publication/PubMed/8088877" } ] }, { "title": "Nef induces CD4 endocytosis: requirement for a critical dileucine motif in the membrane-proximal CD4 cytoplasmic domain.", "journal": "Cell", "date": "1994", "authors": "Aiken C, Konner J, Landau NR, Lenburg ME, Trono D", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "8124721", "url": "https://glygen.org/publication/PubMed/8124721" } ] }, { "title": "Posttranslational processing and targeting of transgenic human defensin in murine granulocyte, macrophage, fibroblast, and pituitary adenoma cell lines.", "journal": "Blood", "date": "1993", "authors": "Ganz T, Liu L, Valore EV, Oren A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "8329717", "url": "https://glygen.org/publication/PubMed/8329717" } ] }, { "title": "Inhibition of HIV-1 infection by a fusion domain binding peptide from the HIV-1 envelope glycoprotein GP41.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Jiang S, Lin K, Strick N, Neurath AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8373393", "url": "https://glygen.org/publication/PubMed/8373393" } ] }, { "title": "Effects of amino acid changes in the extracellular domain of the human immunodeficiency virus type 1 gp41 envelope glycoprotein.", "journal": "Journal of virology", "date": "1993", "authors": "Cao J, Bergeron L, Helseth E, Thali M, Repke H, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8474172", "url": "https://glygen.org/publication/PubMed/8474172" } ] }, { "title": "A spring-loaded mechanism for the conformational change of influenza hemagglutinin.", "journal": "Cell", "date": "1993", "authors": "Carr CM, Kim PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8500173", "url": "https://glygen.org/publication/PubMed/8500173" } ] }, { "title": "The Syk/ZAP-70 protein tyrosine kinase connection to antigen receptor signalling processes.", "journal": "Seminars in immunology", "date": "1995", "authors": "van Oers NS, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "8520027", "url": "https://glygen.org/publication/PubMed/8520027" } ] }, { "title": "Role of auxilin in uncoating clathrin-coated vesicles.", "journal": "Nature", "date": "1995", "authors": "Ungewickell E, Ungewickell H, Holstein SE, Lindner R, Prasad K, Barouch W, Martin B, Greene LE, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8524399", "url": "https://glygen.org/publication/PubMed/8524399" } ] }, { "title": "Critical role for lysines 21 and 22 in signal-induced, ubiquitin-mediated proteolysis of I kappa B-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Baldi L, Brown K, Franzoso G, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8550590", "url": "https://glygen.org/publication/PubMed/8550590" } ] }, { "title": "A role of amphiphysin in synaptic vesicle endocytosis suggested by its binding to dynamin in nerve terminals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "David C, McPherson PS, Mundigl O, de Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "8552632", "url": "https://glygen.org/publication/PubMed/8552632" } ] }, { "title": "Role of beta-arrestin in mediating agonist-promoted G protein-coupled receptor internalization.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Ferguson SS, Downey WE 3rd, Colapietro AM, Barak LS, Menard L, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8553074", "url": "https://glygen.org/publication/PubMed/8553074" } ] }, { "title": "Site-specific phosphorylation of IkappaBalpha by a novel ubiquitination-dependent protein kinase activity.", "journal": "Cell", "date": "1996", "authors": "Chen ZJ, Parent L, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8601309", "url": "https://glygen.org/publication/PubMed/8601309" } ] }, { "title": "The ectodomain of HIV-1 env subunit gp41 forms a soluble, alpha-helical, rod-like oligomer in the absence of gp120 and the N-terminal fusion peptide.", "journal": "The EMBO journal", "date": "1996", "authors": "Weissenhorn W, Wharton SA, Calder LJ, Earl PL, Moss B, Aliprandis E, Skehel JJ, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8612573", "url": "https://glygen.org/publication/PubMed/8612573" } ] }, { "title": "Identification of a major co-receptor for primary isolates of HIV-1.", "journal": "Nature", "date": "1996", "authors": "Deng H, Liu R, Ellmeier W, Choe S, Unutmaz D, Burkhart M, Di Marzio P, Marmon S, Sutton RE, Hill CM, Davis CB, Peiper SC, Schall TJ, Littman DR, Landau NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8649511", "url": "https://glygen.org/publication/PubMed/8649511" } ] }, { "title": "CC CKR5: a RANTES, MIP-1alpha, MIP-1beta receptor as a fusion cofactor for macrophage-tropic HIV-1.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Alkhatib G, Combadiere C, Broder CC, Feng Y, Kennedy PE, Murphy PM, Berger EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8658171", "url": "https://glygen.org/publication/PubMed/8658171" } ] }, { "title": "The beta-chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates.", "journal": "Cell", "date": "1996", "authors": "Choe H, Farzan M, Sun Y, Sullivan N, Rollins B, Ponath PD, Wu L, Mackay CR, LaRosa G, Newman W, Gerard N, Gerard C, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8674119", "url": "https://glygen.org/publication/PubMed/8674119" } ] }, { "title": "A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.", "journal": "Genome Res.", "date": "1996", "authors": "Ansari-Lari MA, Muzny DM, Lu J, Lu F, Lilley CE, Spanos S, Malley T, Gibbs RA", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "8723724", "url": "https://glygen.org/publication/PubMed/8723724" } ] }, { "title": "The adaptor protein Nck links receptor tyrosine kinases with the serine-threonine kinase Pak1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Galisteo ML, Chernoff J, Su YC, Skolnik EY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8798379", "url": "https://glygen.org/publication/PubMed/8798379" } ] }, { "title": "Interaction of the Nck adapter protein with p21-activated kinase (PAK1).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bokoch GM, Wang Y, Bohl BP, Sells MA, Quilliam LA, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8824201", "url": "https://glygen.org/publication/PubMed/8824201" } ] }, { "title": "Beta-arrestin acts as a clathrin adaptor in endocytosis of the beta2-adrenergic receptor.", "journal": "Nature", "date": "1996", "authors": "Goodman OB Jr, Krupnick JG, Santini F, Gurevich VV, Penn RB, Gagnon AW, Keen JH, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "8837779", "url": "https://glygen.org/publication/PubMed/8837779" } ] }, { "title": "CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5.", "journal": "Nature", "date": "1996", "authors": "Trkola A, Dragic T, Arthos J, Binley JM, Olson WC, Allaway GP, Cheng-Mayer C, Robinson J, Maddon PJ, Moore JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "8906796", "url": "https://glygen.org/publication/PubMed/8906796" } ] }, { "title": "Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.", "journal": "Genome Res.", "date": "1997", "authors": "Ansari-Lari MA, Shen Y, Muzny DM, Lee W, Gibbs RA", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "9074930", "url": "https://glygen.org/publication/PubMed/9074930" } ] }, { "title": "Synaptic vesicle endocytosis impaired by disruption of dynamin-SH3 domain interactions.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Shupliakov O, Low P, Grabs D, Gad H, Chen H, David C, Takei K, De Camilli P, Brodin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9092476", "url": "https://glygen.org/publication/PubMed/9092476" } ] }, { "title": "Human immunodeficiency virus type 1 coreceptors participate in postentry stages in the virus replication cycle and function in simian immunodeficiency virus infection.", "journal": "Journal of virology", "date": "1997", "authors": "Chackerian B, Long EM, Luciw PA, Overbaugh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9094670", "url": "https://glygen.org/publication/PubMed/9094670" } ] }, { "title": "Auxilin-induced interaction of the molecular chaperone Hsc70 with clathrin baskets.", "journal": "Biochemistry", "date": "1997", "authors": "Barouch W, Prasad K, Greene L, Eisenberg E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9100026", "url": "https://glygen.org/publication/PubMed/9100026" } ] }, { "title": "Core structure of gp41 from the HIV envelope glycoprotein.", "journal": "Cell", "date": "1997", "authors": "Chan DC, Fass D, Berger JM, Kim PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9108481", "url": "https://glygen.org/publication/PubMed/9108481" } ] }, { "title": "Molecular cloning of SLAP-130, an SLP-76-associated substrate of the T cell antigen receptor-stimulated protein tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Musci MA, Hendricks-Taylor LR, Motto DG, Paskind M, Kamens J, Turck CW, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9115214", "url": "https://glygen.org/publication/PubMed/9115214" } ] }, { "title": "Structural features of membrane fusion between influenza virus and liposome as revealed by quick-freezing electron microscopy.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Kanaseki T, Kawasaki K, Murata M, Ikeuchi Y, Ohnishi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9166405", "url": "https://glygen.org/publication/PubMed/9166405" } ] }, { "title": "Dimeric association and segmental variability in the structure of human CD4.", "journal": "Nature", "date": "1997", "authors": "Wu H, Kwong PD, Hendrickson WA", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "reference": [ { "type": "PubMed", "id": "9168119", "url": "https://glygen.org/publication/PubMed/9168119" } ] }, { "title": "Arrestin/clathrin interaction. Localization of the arrestin binding locus to the clathrin terminal domain.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Goodman OB Jr, Krupnick JG, Gurevich VV, Benovic JL, Keen JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9169477", "url": "https://glygen.org/publication/PubMed/9169477" } ] }, { "title": "Localization of human intestinal defensin 5 in Paneth cell granules.", "journal": "Infection and immunity", "date": "1997", "authors": "Porter EM, Liu L, Oren A, Anton PA, Ganz T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054" } ], "reference": [ { "type": "PubMed", "id": "9169779", "url": "https://glygen.org/publication/PubMed/9169779" } ] }, { "title": "A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.", "journal": "Nature", "date": "1997", "authors": "DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9252186", "url": "https://glygen.org/publication/PubMed/9252186" } ] }, { "title": "Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.", "journal": "Genes & development", "date": "1997", "authors": "Salcini AE, Confalonieri S, Doria M, Santolini E, Tassi E, Minenkova O, Cesareni G, Pelicci PG, Di Fiore PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9303539", "url": "https://glygen.org/publication/PubMed/9303539" } ] }, { "title": "Coreceptor usage of primary human immunodeficiency virus type 1 isolates varies according to biological phenotype.", "journal": "Journal of virology", "date": "1997", "authors": "Bjorndal A, Deng H, Jansson M, Fiore JR, Colognesi C, Karlsson A, Albert J, Scarlatti G, Littman DR, Fenyo EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9311827", "url": "https://glygen.org/publication/PubMed/9311827" } ] }, { "title": "The carboxy-terminus of I kappaB alpha determines susceptibility to degradation by the catalytic core of the proteasome.", "journal": "Oncogene", "date": "1997", "authors": "Kroll M, Conconi M, Desterro MJ, Marin A, Thomas D, Friguet B, Hay RT, Virelizier JL, Arenzana-Seisdedos F, Rodriguez MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9362451", "url": "https://glygen.org/publication/PubMed/9362451" } ] }, { "title": "Processing and activation of pro-interleukin-16 by caspase-3.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang Y, Center DM, Wu DM, Cruikshank WW, Yuan J, Andrews DW, Kornfeld H", "evidence": [ { "database": "Reactome", "id": "R-HSA-449836", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836" } ], "reference": [ { "type": "PubMed", "id": "9422780", "url": "https://glygen.org/publication/PubMed/9422780" } ] }, { "title": "A novel role for Rab5-GDI in ligand sequestration into clathrin-coated pits.", "journal": "Current biology : CB", "date": "1998", "authors": "McLauchlan H, Newell J, Morrice N, Osborne A, West M, Smythe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9427626", "url": "https://glygen.org/publication/PubMed/9427626" } ] }, { "title": "Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15.", "journal": "FEBS letters", "date": "1997", "authors": "Haffner C, Takei K, Chen H, Ringstad N, Hudson A, Butler MH, Salcini AE, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9428629", "url": "https://glygen.org/publication/PubMed/9428629" } ] }, { "title": "Human immunodeficiency virus (HIV) envelope binds to CXCR4 independently of CD4, and binding can be enhanced by interaction with soluble CD4 or by HIV envelope deglycosylation.", "journal": "Journal of virology", "date": "1998", "authors": "Bandres JC, Wang QF, O'Leary J, Baleaux F, Amara A, Hoxie JA, Zolla-Pazner S, Gorny MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9499113", "url": "https://glygen.org/publication/PubMed/9499113" } ] }, { "title": "Capture of an early fusion-active conformation of HIV-1 gp41.", "journal": "Nature structural biology", "date": "1998", "authors": "Furuta RA, Wild CT, Weng Y, Weiss CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9546217", "url": "https://glygen.org/publication/PubMed/9546217" } ] }, { "title": "CD4-Induced conformational changes in the human immunodeficiency virus type 1 gp120 glycoprotein: consequences for virus entry and neutralization.", "journal": "Journal of virology", "date": "1998", "authors": "Sullivan N, Sun Y, Sattentau Q, Thali M, Wu D, Denisova G, Gershoni J, Robinson J, Moore J, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9573233", "url": "https://glygen.org/publication/PubMed/9573233" } ] }, { "title": "A conserved HIV gp120 glycoprotein structure involved in chemokine receptor binding.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Rizzuto CD, Wyatt R, Hernandez-Ramos N, Sun Y, Kwong PD, Hendrickson WA, Sodroski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9632396", "url": "https://glygen.org/publication/PubMed/9632396" } ] }, { "title": "Dynamin undergoes a GTP-dependent conformational change causing vesiculation.", "journal": "Cell", "date": "1998", "authors": "Sweitzer SM, Hinshaw JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9635431", "url": "https://glygen.org/publication/PubMed/9635431" } ] }, { "title": "Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody.", "journal": "Nature", "date": "1998", "authors": "Kwong PD, Wyatt R, Robinson J, Sweet RW, Sodroski J, Hendrickson WA", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9641677", "url": "https://glygen.org/publication/PubMed/9641677" } ] }, { "title": "A novel human WD protein, h-beta TrCp, that interacts with HIV-1 Vpu connects CD4 to the ER degradation pathway through an F-box motif.", "journal": "Molecular cell", "date": "1998", "authors": "Margottin F, Bour SP, Durand H, Selig L, Benichou S, Richard V, Thomas D, Strebel K, Benarous R", "evidence": [ { "database": "Reactome", "id": "R-HSA-180534", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534" } ], "reference": [ { "type": "PubMed", "id": "9660940", "url": "https://glygen.org/publication/PubMed/9660940" } ] }, { "title": "T cell receptor (TCR) interacting molecule (TRIM), a novel disulfide-linked dimer associated with the TCR-CD3-zeta complex, recruits intracellular signaling proteins to the plasma membrane.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Bruyns E, Marie-Cardine A, Kirchgessner H, Sagolla K, Shevchenko A, Mann M, Autschbach F, Bensussan A, Meuer S, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9687533", "url": "https://glygen.org/publication/PubMed/9687533" } ] }, { "title": "Interactions among HIV gp120, CD4, and CXCR4: dependence on CD4 expression level, gp120 viral origin, conservation of the gp120 COOH- and NH2-termini and V1/V2 and V3 loops, and sensitivity to neutralizing antibodies.", "journal": "Virology", "date": "1998", "authors": "Mondor I, Moulard M, Ugolini S, Klasse PJ, Hoxie J, Amara A, Delaunay T, Wyatt R, Sodroski J, Sattentau QJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-173107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107" } ], "reference": [ { "type": "PubMed", "id": "9721247", "url": "https://glygen.org/publication/PubMed/9721247" } ] }, { "title": "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis.", "journal": "Nature", "date": "1998", "authors": "Chen H, Fre S, Slepnev VI, Capua MR, Takei K, Butler MH, Di Fiore PP, De Camilli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9723620", "url": "https://glygen.org/publication/PubMed/9723620" } ] }, { "title": "Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.", "journal": "The EMBO journal", "date": "1998", "authors": "Owen DJ, Wigge P, Vallis Y, Moore JD, Evans PR, McMahon HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828" } ], "reference": [ { "type": "PubMed", "id": "9736607", "url": "https://glygen.org/publication/PubMed/9736607" } ] }, { "title": "A structural explanation for the recognition of tyrosine-based endocytotic signals.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Owen DJ, Evans PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825" } ], "reference": [ { "type": "PubMed", "id": "9812899", "url": "https://glygen.org/publication/PubMed/9812899" } ] }, { "title": "Regulation of PAK activation and the T cell cytoskeleton by the linker protein SLP-76.", "journal": "Immunity", "date": "1998", "authors": "Bubeck Wardenburg J, Pappu R, Bu JY, Mayer B, Chernoff J, Straus D, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9846482", "url": "https://glygen.org/publication/PubMed/9846482" } ] }, { "title": "The Syk family of protein tyrosine kinases in T-cell activation and development.", "journal": "Immunological reviews", "date": "1998", "authors": "Chu DH, Morita CT, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "9850860", "url": "https://glygen.org/publication/PubMed/9850860" } ] }, { "title": "Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.", "journal": "Genes & development", "date": "1999", "authors": "Spencer E, Jiang J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9990853", "url": "https://glygen.org/publication/PubMed/9990853" } ] } ], "pathway": [ { "id": "hsa:920", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:920", "resource": "KEGG Pathway" }, { "id": "R-HSA-1462054", "name": "Alpha-defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1462054", "resource": "Reactome", "description": "Alpha-defensins" }, { "id": "R-HSA-167590", "name": "Nef Mediated CD4 Down-regulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167590", "resource": "Reactome", "description": "Nef Mediated CD4 Down-regulation" }, { "id": "R-HSA-173107", "name": "Binding and entry of HIV virion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-173107", "resource": "Reactome", "description": "Binding and entry of HIV virion" }, { "id": "R-HSA-180534", "name": "Vpu mediated degradation of CD4", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "resource": "Reactome", "description": "Vpu mediated degradation of CD4" }, { "id": "R-HSA-202424", "name": "Downstream TCR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "description": "Downstream TCR signaling" }, { "id": "R-HSA-202427", "name": "Phosphorylation of CD3 and TCR zeta chains", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427", "resource": "Reactome", "description": "Phosphorylation of CD3 and TCR zeta chains" }, { "id": "R-HSA-202430", "name": "Translocation of ZAP-70 to Immunological synapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430", "resource": "Reactome", "description": "Translocation of ZAP-70 to Immunological synapse" }, { "id": "R-HSA-202433", "name": "Generation of second messenger molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "resource": "Reactome", "description": "Generation of second messenger molecules" }, { "id": "R-HSA-389948", "name": "PD-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948", "resource": "Reactome", "description": "PD-1 signaling" }, { "id": "R-HSA-449836", "name": "Other interleukin signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-449836", "resource": "Reactome", "description": "Other interleukin signaling" }, { "id": "R-HSA-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-HSA-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" } ], "orthologs": [ { "uniprot_canonical_ac": "I3L556-1", "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "CD4", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MDPGTSLRHLFLVLQLAMLPAASGTQEKYLVLGKAGDLAELPCHSSQKKNLPFNWKSSNQTKILGGHGSFWHTASVTELTSRLDSKKNMWDHGSFPLIIKNLEVTDSGIYICEVEDKRIEVQLLVFRLTASVTRVLLGQSLTLTLEGPSGSHPTVQWKGPGNKSKNDVKSLLLPQVGLEDSGLWTCTVSQDQKTLVFRSNIFVLAFQKVPSTVYVKEGDQVVLSFPLTFEAESLSGELMWRQTKGASSPQSWITFSLKDRKVTVQKSLQNLKLRMAEKLPLQITLLQALPQYAGSGNLTLVLPEGRLHREVNLVVMRATQSKNEVTCEVLGPTPPKVVLSLKLGNQSMKVSDQQKLVTVLDPEAGMWRCLLRDKDKVLLESQVEVLPTAFTRAWPKLLAFVIGGIIGLLFLAGFCIVCVKCWHRRRRAERMSQIKRLLSEKKTCQCAHRQQKNYSLT", "length": 457 }, "evidence": [ { "id": "P01730", "url": "https://omabrowser.org/oma/group/P01730/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P05540-1", "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "Cd4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCRGFSFRHLLPLLLLQLSKLLVVTQGKTVVLGKEGGSAELPCESTSRRSASFAWKSSDQKTILGYKNKLLIKGSLELYSRFDSRKNAWERGSFPLIINKLRMEDSQTYVCELENKKEEVELWVFRVTFNPGTRLLQGQSLTLILDSNPKVSDPPIECKHKSSNIVKDSKAFSTHSLRIQDSGIWNCTVTLNQKKHSFDMKLSVLGFASTSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQVLSKGLNQTMFLAVVLGSAFSFLVFTGLCILFCVRCRHQQRQAARMSQIKRLLSEKKTCQCSHRMQKSHNLI", "length": 457 }, "evidence": [ { "id": "45929212", "url": "http://www.informatics.jax.org/homology/45929212", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P06332-1", "protein_name": "T-cell surface glycoprotein CD4", "gene_name": "Cd4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCRAISLRRLLLLLLQLSQLLAVTQGKTLVLGKEGESAELPCESSQKKITVFTWKFSDQRKILGQHGKGVLIRGGSPSQFDRFDSKKGAWEKGSFPLIINKLKMEDSQTYICELENRKEEVELWVFKVTFSPGTSLLQGQSLTLTLDSNSKVSNPLTECKHKKGKVVSGSKVLSMSNLRVQDSDFWNCTVTLDQKKNWFGMTLSVLGFQSTAITAYKSEGESAEFSFPLNFAEENGWGELMWKAEKDSFFQPWISFSIKNKEVSVQKSTKDLKLQLKETLPLTLKIPQVSLQFAGSGNLTLTLDKGTLHQEVNLVVMKVAQLNNTLTCEVMGPTSPKMRLTLKQENQEARVSEEQKVVQVVAPETGLWQCLLSEGDKVKMDSRIQVLSRGVNQTVFLACVLGGSFGFLGFLGLCILCCVRCRHQQRQAARMSQIKRLLSEKKTCQCPHRMQKSHNLI", "length": 457 }, "evidence": [ { "id": "45929212", "url": "http://www.informatics.jax.org/homology/45929212", "database": "MGI" }, { "id": "P01730", "url": "https://omabrowser.org/oma/group/P01730/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle membrane", "id": "GO:0030669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030669", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 32, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "maintenance of protein location in cell", "id": "GO:0032507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032507", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "transmembrane receptor protein tyrosine kinase signaling pathway", "id": "GO:0007169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007169", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "calcium-mediated signaling", "id": "GO:0019722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "T cell activation", "id": "GO:0042110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042110", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of protein kinase activity", "id": "GO:0045860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045860", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "regulation of calcium ion transport", "id": "GO:0051924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051924", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of kinase activity", "id": "GO:0033674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033674", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of monocyte differentiation", "id": "GO:0045657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045657", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of viral entry into host cell", "id": "GO:0046598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046598", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of calcium-mediated signaling", "id": "GO:0050850", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050850", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "cellular response to granulocyte macrophage colony-stimulating factor stimulus", "id": "GO:0097011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097011", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of interleukin-2 production", "id": "GO:0032743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032743", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "positive regulation of T cell activation", "id": "GO:0050870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050870", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "T cell differentiation", "id": "GO:0030217", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030217", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "regulation of T cell activation", "id": "GO:0050863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050863", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "macrophage differentiation", "id": "GO:0030225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030225", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "enzyme-linked receptor protein signaling pathway", "id": "GO:0007167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007167", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "helper T cell enhancement of adaptive immune response", "id": "GO:0035397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035397", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "interleukin-15-mediated signaling pathway", "id": "GO:0035723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035723", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "T cell selection", "id": "GO:0045058", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045058", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 16, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "MHC class II protein complex binding", "id": "GO:0023026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023026", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent", "id": "GO:0005201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005201", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "protein tyrosine kinase binding", "id": "GO:1990782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990782", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "MHC class II protein binding", "id": "GO:0042289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042289", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "interleukin-16 binding", "id": "GO:0042011", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042011", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "interleukin-16 receptor activity", "id": "GO:0042012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042012", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "T-cell surface glycoprotein CD4 N-glycosylated 1 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G03860PZ. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G03860PZ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051990", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051990" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 2 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G05950HG. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G05950HG. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051991", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051991" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 3 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G07995VK. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G07995VK. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051992", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051992" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 4 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051993", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051993" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 5 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G18188WJ. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G18188WJ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051994", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051994" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 6 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G20779SK. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G20779SK. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051995", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051995" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 7 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G20966IA. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G20966IA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051996", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051996" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 8 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G27561QX. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G27561QX. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051997", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051997" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 9 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G30460NZ. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G30460NZ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051998", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051998" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 10 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G35599NO. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G35599NO. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000051999", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051999" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 11 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052000", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052000" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 12 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G37166HP. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G37166HP. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052001", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052001" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 13 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G38756OC. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G38756OC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052002", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052002" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 14 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G44276EF. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G44276EF. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052003", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052003" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 15 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G45498YC. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G45498YC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052004", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052004" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 16 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052005", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052005" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 17 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G52622SW. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G52622SW. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052006", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052006" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 18 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53450AF. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G53450AF. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052007", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052007" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 19 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052008", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052008" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 20 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53962WT. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G53962WT. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052009", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052009" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 21 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G57413FT. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G57413FT. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052010", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052010" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 22 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G64132UH. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G64132UH. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052011", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052011" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 23 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G65890UA. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G65890UA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052012", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052012" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 24 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052013", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052013" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 25 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052014", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052014" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 26 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-296 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G87633UQ. Example: UniProtKB:P01730-1, Asn-296, MOD:00160~GNO:G87633UQ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052015", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052015" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 27 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G03860PZ. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G03860PZ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052016", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052016" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 28 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G05950HG. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G05950HG. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052017", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052017" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 29 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G07995VK. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G07995VK. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052018", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052018" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 30 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052019", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052019" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 31 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G18188WJ. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G18188WJ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052020", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052020" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 32 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G20779SK. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G20779SK. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052021", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052021" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 33 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G20966IA. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G20966IA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052022", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052022" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 34 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G27561QX. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G27561QX. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052023", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052023" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 35 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G30460NZ. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G30460NZ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052024", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052024" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 36 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G35599NO. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G35599NO. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052025", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052025" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 37 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052026", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052026" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 38 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G37166HP. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G37166HP. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052027", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052027" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 39 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G38756OC. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G38756OC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052028", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052028" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 40 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G44276EF. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G44276EF. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052029", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052029" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 41 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G45498YC. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G45498YC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052030", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052030" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 42 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G45560HM. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G45560HM. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052031", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052031" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 43 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G52622SW. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G52622SW. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052032", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052032" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 44 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53450AF. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G53450AF. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052033", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052033" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 45 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052034", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052034" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 46 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G53962WT. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G53962WT. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052035", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052035" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 47 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G57413FT. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G57413FT. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052036", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052036" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 48 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G64132UH. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G64132UH. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052037", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052037" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 49 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G65890UA. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G65890UA. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052038", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052038" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 50 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052039", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052039" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 51 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052040", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052040" } ] }, { "name": "T-cell surface glycoprotein CD4 N-glycosylated 52 (human)", "definition": "A T-cell surface glycoprotein CD4 (human) that has been N-glycosylated at the residue equivalent to Asn-325 of the amino acid sequence represented by UniProtKB:P01730-1, in which the glycan structure is represented by GlyTouCan:G87633UQ. Example: UniProtKB:P01730-1, Asn-325, MOD:00160~GNO:G87633UQ. [PRO:DNx, PMID:2592374]", "evidence": [ { "id": "PR:000052041", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000052041" } ] } ], "site_annotation": [ { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 325, "end_pos": 327, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylation and association with LCK contribute to the enrichment of CD4 in lipid rafts.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "1618861", "url": "https://glygen.org/publication/PubMed/1618861" } ] }, { "annotation": "Phosphorylated by PKC; phosphorylation at Ser-433 plays an important role for CD4 internalization.", "evidence": [ { "database": "UniProtKB", "id": "P01730", "url": "https://www.uniprot.org/uniprot/P01730" }, { "database": "PubMed", "id": "2105883", "url": "https://glygen.org/publication/PubMed/2105883" }, { "database": "PubMed", "id": "2512251", "url": "https://glygen.org/publication/PubMed/2512251" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 98, 296, 325 ], "o_linked_sites": [], "snv_sites": [ 93, 179, 296, 327, 350 ], "glycation_sites": [], "phosphorylation_sites": [ 433, 440, 456 ], "sequon_annotation_sites": [ { "start_pos": 296, "end_pos": 298 }, { "start_pos": 325, "end_pos": 327 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 109 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 54 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 106 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 54 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 399 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }