{ "uniprot_canonical_ac": "P01589-1", "uniprot_ac": "P01589", "uniprot_id": "IL2RA_HUMAN", "mass": { "chemical_mass": 30819.0, "monoisotopic_mass": 30819.0 }, "refseq": { "ac": "NP_000408", "name": "interleukin-2 receptor subunit alpha isoform 1 precursor", "summary": "The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency. Patients with severe Coronavirus Disease 2019 (COVID-19), the disease caused by the novel severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), have significantly elevated levels of IL2R in their plasma. Similarly, serum IL-2R levels are found to be elevated in patients with different types of carcinomas. Certain IL2RA and IL2RB gene polymorphisms have been associated with lung cancer risk. [provided by RefSeq, Jul 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, "gene_names": [ { "name": "IL2RA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01589", "id": "P01589" }, { "name": "CD25; IDDM10; IL2R; IMD41; p55; TCGFR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408", "id": "NP_000408" }, { "name": "IL2RA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408", "id": "NP_000408" }, { "name": "hCG_23482", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01589", "id": "P01589" } ], "protein_names": [ { "name": "Interleukin-2 receptor subunit alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01589" }, { "name": "IL-2 receptor subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" }, { "name": "IL-2-RA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" }, { "name": "IL-2R subunit alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" }, { "name": "IL2-RA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" }, { "name": "TAC antigen; IL-2R subunit alpha; IL-2 receptor subunit alpha; interleukin 2 receptor, alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408", "id": "NP_000408" }, { "name": "TAC antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" }, { "name": "interleukin-2 receptor subunit alpha isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408", "id": "NP_000408" }, { "name": "p55", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01589" } ], "function": [ { "annotation": "A great disturbance in the force: IL-2 receptor defects disrupt immune homeostasis. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, { "database": "PubMed", "id": "36165614", "url": "https://glygen.org/publication/PubMed/36165614" } ] }, { "annotation": "An association study of IL2RA polymorphisms with cerebral palsy in a Chinese population. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, { "database": "PubMed", "id": "36195861", "url": "https://glygen.org/publication/PubMed/36195861" } ] }, { "annotation": "CD4+CD25+CD127[lo]FOXP3+ cell in food allergy: Does it predict anaphylaxis? Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, { "database": "PubMed", "id": "37169554", "url": "https://glygen.org/publication/PubMed/37169554" } ] }, { "annotation": "DNA methylation differences within INS, PTPN22 and IL2RA promoters in lymphocyte subsets in children with type 1 diabetes and controls.", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, { "database": "PubMed", "id": "37724526", "url": "https://glygen.org/publication/PubMed/37724526" } ] }, { "annotation": "Evaluation of gene-gene interaction between the interleukin (IL)-2 and IL-2RA gene polymorphisms in schizophrenia patients in the Turkish Population.", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" }, { "database": "PubMed", "id": "38195135", "url": "https://glygen.org/publication/PubMed/38195135" } ] }, { "annotation": "Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589#function" }, { "database": "PubMed", "id": "23416241", "url": "https://glygen.org/publication/PubMed/23416241" }, { "database": "PubMed", "id": "24116927", "url": "https://glygen.org/publication/PubMed/24116927" }, { "database": "UniProtKB", "id": "H0Y5Z0", "url": "https://www.uniprot.org/uniprot/H0Y5Z0#function" }, { "database": "UniProtKB", "id": "ARBA00002381", "url": "https://www.uniprot.org/uniprot/ARBA00002381#function" }, { "database": "UniProtKB", "id": "A0A8V8TMM2", "url": "https://www.uniprot.org/uniprot/A0A8V8TMM2#function" }, { "database": "UniProtKB", "id": "Q5W005", "url": "https://www.uniprot.org/uniprot/Q5W005#function" }, { "database": "UniProtKB", "id": "Q5W006", "url": "https://www.uniprot.org/uniprot/Q5W006#function" } ] }, { "annotation": "The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency. Patients with severe Coronavirus Disease 2019 (COVID-19), the disease caused by the novel severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), have significantly elevated levels of IL2R in their plasma. Similarly, serum IL-2R levels are found to be elevated in patients with different types of carcinomas. Certain IL2RA and IL2RB gene polymorphisms have been associated with lung cancer risk. [provided by RefSeq, Jul 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ] } ], "disease": [ { "disease_id": "DOID:0110749", "recommended_name": { "id": "DOID:0110749", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110749", "name": "type 1 diabetes mellitus 10", "description": "A type 1 diabetes mellitus that has_material_basis_in mutation of the IL2RA gene on chromosome 10p15.1." }, "synonyms": [ { "id": "DOID:0110749", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110749", "name": "IDDM10", "description": "" }, { "id": "DOID:0110749", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110749", "name": "Insulin-Dependent Diabetes Mellitus 10", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "type 1 diabetes mellitus 10", "description": "An inherited susceptibility or predisposition to developing type 1 diabetes mellitus in which the cause of the disease is a mutation in the IL2RA gene." }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "IDDM10", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "IL2RA type 1 diabetes mellitus", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "diabetes mellitus, insulin-dependent, type 10", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "insulin-dependent diabetes mellitus 10", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "type 1 diabetes mellitus caused by mutation in IL2RA", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "diabetes mellitus, insulin-dependent, 10", "description": "" }, { "id": "MONDO:0011168", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011168", "name": "diabetes, mellitus, insulin-dependent, susceptibility to, 10", "description": "" }, { "id": "MIM:601942", "resource": "MIM", "url": "https://www.omim.org/entry/601942", "name": "Type 1 diabetes mellitus 10", "description": "Type 1 diabetes mellitus 10" } ], "evidence": [ { "id": "601942", "database": "MIM", "url": "https://www.omim.org/entry/601942" } ] }, { "disease_id": "DOID:0111968", "recommended_name": { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency 41", "description": "A combined immunodeficiency characterized by a defect in T cell regulation with proliferation of CD8+ T cells, impaired antibody specific responses, and elevated cytokines resulting in recurrent viral, fungal, and bacterial infections, lymphadenopathy, and variable autoimmune features that has_material_basis_in homozygous or compound heterozygous mutation in the IL2RA gene on chromosome 10p15.1." }, "synonyms": [ { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "CD25 deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "IL2RA deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "IMD41", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "interleukin-2 receptor alpha chain deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "Interleukin-2 receptor alpha chain deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "IL2RA deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "IMD41", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "Interleukin 2 receptor, alpha, deficiency of", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "" }, { "id": "MIM:606367", "resource": "MIM", "url": "https://www.omim.org/entry/606367", "name": "Immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "Immunodeficiency 41 with lymphoproliferation and autoimmunity" } ], "evidence": [ { "id": "606367", "database": "MIM", "url": "https://www.omim.org/entry/606367" } ] } ], "snv": [ { "evidence": [ { "id": "rs1464759420", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1464759420" }, { "id": "rs1464759420", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1464759420" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 135, "end_pos": 135, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEA->NET).", "chr_id": "10", "chr_pos": "6021658", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A135", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1277473513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1277473513" }, { "id": "rs1277473513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1277473513" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 218, "end_pos": 218, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "10", "chr_pos": "6019872", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T218", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769734470", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769734470" }, { "id": "rs769734470", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769734470" }, { "id": "rs769734470", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769734470" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 237, "end_pos": 237, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "10", "chr_pos": "6019446", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T237", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1489675522", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1489675522" }, { "id": "rs1489675522", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1489675522" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "10", "chr_pos": "6025911", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S60", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1172654832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172654832" }, { "id": "rs1172654832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172654832" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 70, "end_pos": 70, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->ISS).", "chr_id": "10", "chr_pos": "6025881", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N70", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1172654832", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172654832" }, { "id": "rs1172654832", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172654832" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 70, "end_pos": 70, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->TSS).", "chr_id": "10", "chr_pos": "6025881", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N70", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01589", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01589" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 72, "end_pos": 72, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->NSG).", "chr_id": "10", "chr_pos": "6025876", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S72", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1462904435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1462904435" }, { "id": "rs1462904435", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1462904435" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 72, "end_pos": 72, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSR).", "chr_id": "10", "chr_pos": "6025874", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S72", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P01589", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01589" }, { "id": "rs753853235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753853235" }, { "id": "rs753853235", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753853235" }, { "id": "rs753853235", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753853235" }, { "id": "rs753853235", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753853235" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 91, "end_pos": 91, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->NTA).", "chr_id": "10", "chr_pos": "6024340", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T91", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs72650666", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs72650666" }, { "id": "rs72650666", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs72650666" }, { "id": "rs72650666", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs72650666" }, { "id": "rs72650666", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs72650666#frequency_tab" }, { "id": "rs72650666", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs72650666" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 91, "end_pos": 91, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTM).", "chr_id": "10", "chr_pos": "6024339", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "T91", "disease": [ { "disease_id": "DOID:0111968", "recommended_name": { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency 41", "description": "A combined immunodeficiency characterized by a defect in T cell regulation with proliferation of CD8+ T cells, impaired antibody specific responses, and elevated cytokines resulting in recurrent viral, fungal, and bacterial infections, lymphadenopathy, and variable autoimmune features that has_material_basis_in homozygous or compound heterozygous mutation in the IL2RA gene on chromosome 10p15.1." }, "synonyms": [ { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "CD25 deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "IL2RA deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "IMD41", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "interleukin-2 receptor alpha chain deficiency", "description": "" }, { "id": "DOID:0111968", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111968", "name": "immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "Interleukin-2 receptor alpha chain deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency due to CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "CD25 deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "IL2RA deficiency", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "IMD41", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "Interleukin 2 receptor, alpha, deficiency of", "description": "" }, { "id": "MONDO:0011664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011664", "name": "immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "" }, { "id": "MIM:606367", "resource": "MIM", "url": "https://www.omim.org/entry/606367", "name": "Immunodeficiency 41 with lymphoproliferation and autoimmunity", "description": "Immunodeficiency 41 with lymphoproliferation and autoimmunity" } ] } ], "keywords": [ "ebi", "germline", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "61.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "55.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "71.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "54.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "61.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "64.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "50.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.93", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01589" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "common_name": "Human" } ], "gene": [ { "name": "IL2RA", "url": "https://www.uniprot.org/uniprot/P01589", "locus": { "chromosome": "10", "start_pos": 56616, "end_pos": 4940, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_73", "url": "https://www.ensembl.org/id/LRG_73" } ] } } ], "crossref": [ { "id": "ENSG00000134460", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000134460", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01589", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P01589", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00033", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00033", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1778", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1778", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "IL2RA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IL2RA", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3559", "url": "https://www.ncbi.nlm.nih.gov/gene/3559", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6008", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6008", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01589", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01589*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015486", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015486", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035976", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035976", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3559", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3559", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "147730", "url": "http://www.omim.org/entry/147730", "database": "MIM", "categories": [ "Other" ] }, { "id": "601942", "url": "http://www.omim.org/entry/601942", "database": "MIM", "categories": [ "Other" ] }, { "id": "606367", "url": "http://www.omim.org/entry/606367", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01589", "url": "https://www.nextprot.org/entry/NX_P01589", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P01589", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01589", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DFCGPPK", "url": "https://omabrowser.org/oma/group/DFCGPPK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5262142at2759", "url": "http://www.orthodb.org/?query=5262142at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10573", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10573", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10573:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10573:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1Z92", "url": "https://www.rcsb.org/structure/1Z92", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B5I", "url": "https://www.rcsb.org/structure/2B5I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ERJ", "url": "https://www.rcsb.org/structure/2ERJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IU3", "url": "https://www.rcsb.org/structure/3IU3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NFP", "url": "https://www.rcsb.org/structure/3NFP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VWU", "url": "https://www.rcsb.org/structure/6VWU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6YIO", "url": "https://www.rcsb.org/structure/6YIO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7F9W", "url": "https://www.rcsb.org/structure/7F9W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZMZ", "url": "https://www.rcsb.org/structure/7ZMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00084", "url": "http://pfam.xfam.org/family/PF00084", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01589", "url": "https://pharos.nih.gov/targets/P01589", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01589", "url": "http://purl.obolibrary.org/obo/PR_P01589", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TMM2", "url": "https://www.uniprot.org/uniprot/A0A8V8TMM2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TMM2-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TMM2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5Z0", "url": "https://www.uniprot.org/uniprot/H0Y5Z0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5Z0-1", "url": "https://www.uniprot.org/uniprot/H0Y5Z0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01589-1", "url": "https://www.uniprot.org/uniprot/P01589-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W005", "url": "https://www.uniprot.org/uniprot/Q5W005", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W005-1", "url": "https://www.uniprot.org/uniprot/Q5W005-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W006", "url": "https://www.uniprot.org/uniprot/Q5W006", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W006-1", "url": "https://www.uniprot.org/uniprot/Q5W006-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 272, "header": "sp|P01589-1|IL2RA_HUMAN Isoform 1 of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1 CANONICAL=P01589-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TMM2-1", "url": "", "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 248, "header": "tr|A0A8V8TMM2-1|A0A8V8TMM2_HUMAN Computationally mapped isoform of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1 CANONICAL=P01589-1" }, "locus": { "chromosome": "10", "start_pos": 6062151, "end_pos": 6012875, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000697424.1", "url": "https://www.ensembl.org/id/ENST00000697424.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513307.1", "url": "https://www.ensembl.org/id/ENSP00000513307.1" } ] } }, { "isoform_ac": "H0Y5Z0-1", "url": "", "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 176, "header": "tr|H0Y5Z0-1|H0Y5Z0_HUMAN Computationally mapped isoform of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=2 CANONICAL=P01589-1" }, "locus": { "chromosome": "10", "start_pos": 6062151, "end_pos": 6012875, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000447847.2", "url": "https://www.ensembl.org/id/ENST00000447847.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000402024.2", "url": "https://www.ensembl.org/id/ENSP00000402024.2" } ] } }, { "isoform_ac": "P01589-1", "url": "", "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 272, "header": "sp|P01589-1|IL2RA_HUMAN Isoform 1 of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1 CANONICAL=P01589-1" }, "locus": { "chromosome": "10", "start_pos": 6062151, "end_pos": 6012875, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000379959.8", "url": "https://www.ensembl.org/id/ENST00000379959.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000369293.3", "url": "https://www.ensembl.org/id/ENSP00000369293.3" } ] } }, { "isoform_ac": "Q5W005-1", "url": "", "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 200, "header": "tr|Q5W005-1|Q5W005_HUMAN Computationally mapped isoform of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1 CANONICAL=P01589-1" }, "locus": { "chromosome": "10", "start_pos": 6062151, "end_pos": 6012875, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000379954.5", "url": "https://www.ensembl.org/id/ENST00000379954.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000369287.1", "url": "https://www.ensembl.org/id/ENSP00000369287.1" } ] } }, { "isoform_ac": "Q5W006-1", "url": "", "sequence": { "sequence": "MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI", "length": 263, "header": "tr|Q5W006-1|Q5W006_HUMAN Computationally mapped isoform of Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1 CANONICAL=P01589-1" }, "locus": { "chromosome": "10", "start_pos": 6062151, "end_pos": 6012875, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000256876.10", "url": "https://www.ensembl.org/id/ENST00000256876.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000256876.6", "url": "https://www.ensembl.org/id/ENSP00000256876.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 218, "start_aa": "Thr", "end_pos": 218, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr218", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 224, "start_aa": "Thr", "end_pos": 224, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr224", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 229, "start_aa": "Thr", "end_pos": 229, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr229", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 237, "start_aa": "Thr", "end_pos": 237, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr237", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 60, "start_aa": "Ser", "end_pos": 60, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser60", "evidence": [ { "id": "P01589", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01589" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 62, "start_aa": "Ser", "end_pos": 62, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser62", "evidence": [ { "id": "P01589", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01589" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" }, { "id": "3IU3", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3IU3" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 89, "start_aa": "Asn", "end_pos": 89, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn89", "evidence": [ { "id": "P01589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "id": "3134887", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3134887" } ] } ], "phosphorylation": [ { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" }, { "database": "PubMed", "id": "2941417", "url": "https://glygen.org/publication/PubMed/2941417" }, { "database": "PubMed", "id": "2303462", "url": "https://glygen.org/publication/PubMed/2303462" } ], "site_lbl": "Ser268" }, { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" }, { "database": "PubMed", "id": "2941417", "url": "https://glygen.org/publication/PubMed/2941417" }, { "database": "phospho.ELM", "id": "P01589", "url": "http://phospho.elm.eu.org/byAccession/P01589.html" } ], "site_lbl": "Ser268" }, { "start_pos": 271, "end_pos": 271, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" }, { "database": "PubMed", "id": "2303462", "url": "https://glygen.org/publication/PubMed/2303462" } ], "site_lbl": "Thr271" }, { "start_pos": 271, "end_pos": 271, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" }, { "database": "PubMed", "id": "2941417", "url": "https://glygen.org/publication/PubMed/2941417" }, { "database": "phospho.ELM", "id": "P01589", "url": "http://phospho.elm.eu.org/byAccession/P01589.html" } ], "site_lbl": "Thr271" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The src homology domain 2-containing inositol phosphatase SHIP forms a ternary complex with Shc and Grb2 in antigen receptor-stimulated B lymphocytes.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Harmer SL, DeFranco AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "10207047", "url": "https://glygen.org/publication/PubMed/10207047" } ] }, { "title": "Engagement of Gab1 and Gab2 in erythropoietin signaling.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wickrema A, Uddin S, Sharma A, Chen F, Alsayed Y, Ahmad S, Sawyer ST, Krystal G, Yi T, Nishada K, Hibi M, Hirano T, Platanias LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "10455108", "url": "https://glygen.org/publication/PubMed/10455108" } ] }, { "title": "Two co-existing mechanisms for nuclear import of MAP kinase: passive diffusion of a monomer and active transport of a dimer.", "journal": "The EMBO journal", "date": "1999", "authors": "Adachi M, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10508167", "url": "https://glygen.org/publication/PubMed/10508167" } ] }, { "title": "AML1, the target of chromosomal rearrangements in human leukemia, regulates the expression of human complement receptor type 1 (CR1) gene.", "journal": "The international journal of biochemistry & cell biology", "date": "1999", "authors": "Kim JH, Lee S, Rho JK, Choe SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330" } ], "reference": [ { "type": "PubMed", "id": "10533284", "url": "https://glygen.org/publication/PubMed/10533284" } ] }, { "title": "Tyrosine phosphorylation of shc in response to B cell antigen receptor engagement depends on the SHIP inositol phosphatase.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Ingham RJ, Okada H, Dang-Lawson M, Dinglasan J, van Der Geer P, Kurosaki T, Gold MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "10570274", "url": "https://glygen.org/publication/PubMed/10570274" } ] }, { "title": "Hierarchy of protein tyrosine kinases in interleukin-2 (IL-2) signaling: activation of syk depends on Jak3; however, neither Syk nor Lck is required for IL-2-mediated STAT activation.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhou YJ, Magnuson KS, Cheng TP, Gadina M, Frucht DM, Galon J, Candotti F, Geahlen RL, Changelian PS, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "10825200", "url": "https://glygen.org/publication/PubMed/10825200" } ] }, { "title": "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Shao H, Andres DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10869344", "url": "https://glygen.org/publication/PubMed/10869344" } ] }, { "title": "New role for Shc in activation of the phosphatidylinositol 3-kinase/Akt pathway.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Gu H, Maeda H, Moon JJ, Lord JD, Yoakim M, Nelson BH, Neel BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "10982827", "url": "https://glygen.org/publication/PubMed/10982827" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Flt3 mutations from patients with acute myeloid leukemia induce transformation of 32D cells mediated by the Ras and STAT5 pathways.", "journal": "Blood", "date": "2000", "authors": "Mizuki M, Fenski R, Halfter H, Matsumura I, Schmidt R, Muller C, Gruning W, Kratz-Albers K, Serve S, Steur C, Buchner T, Kienast J, Kanakura Y, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11090077", "url": "https://glygen.org/publication/PubMed/11090077" } ] }, { "title": "Crystal structure and functional analysis of Ras binding to its effector phosphoinositide 3-kinase gamma.", "journal": "Cell", "date": "2000", "authors": "Pacold ME, Suire S, Perisic O, Lara-Gonzalez S, Davis CT, Walker EH, Hawkins PT, Stephens L, Eccleston JF, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11136978", "url": "https://glygen.org/publication/PubMed/11136978" } ] }, { "title": "A novel potential effector of M-Ras and p21 Ras negatively regulates p21 Ras-mediated gene induction and cell growth.", "journal": "Oncogene", "date": "2001", "authors": "Ehrhardt GR, Korherr C, Wieler JS, Knaus M, Schrader JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11313946", "url": "https://glygen.org/publication/PubMed/11313946" } ] }, { "title": "Gab2 is phosphorylated on tyrosine upon interleukin-2/interleukin-15 stimulation in mycosis-fungoides-derived tumor T cells and associates inducibly with SHP-2 and Stat5a.", "journal": "Experimental and clinical immunogenetics", "date": "2001", "authors": "Brockdorff JL, Gu H, Mustelin T, Kaltoft K, Geisler C, Ropke C, Odum N", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "11340297", "url": "https://glygen.org/publication/PubMed/11340297" } ] }, { "title": "Evidence for existence of a nuclear pore complex-mediated, cytosol-independent pathway of nuclear translocation of ERK MAP kinase in permeabilized cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Matsubayashi Y, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11546808", "url": "https://glygen.org/publication/PubMed/11546808" } ] }, { "title": "PEA-15 mediates cytoplasmic sequestration of ERK MAP kinase.", "journal": "Developmental cell", "date": "2001", "authors": "Formstecher E, Ramos JW, Fauquet M, Calderwood DA, Hsieh JC, Canton B, Nguyen XT, Barnier JV, Camonis J, Ginsberg MH, Chneiweiss H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11702783", "url": "https://glygen.org/publication/PubMed/11702783" } ] }, { "title": "ERK2 enters the nucleus by a carrier-independent mechanism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Whitehurst AW, Wilsbacher JL, You Y, Luby-Phelps K, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12032311", "url": "https://glygen.org/publication/PubMed/12032311" } ] }, { "title": "The phosphatidylinositol 3-Kinase AKT pathway in human cancer.", "journal": "Nature reviews. Cancer", "date": "2002", "authors": "Vivanco I, Sawyers CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12094235", "url": "https://glygen.org/publication/PubMed/12094235" } ] }, { "title": "Activation of phosphoinositide 3-kinase gamma by Ras.", "journal": "Current biology : CB", "date": "2002", "authors": "Suire S, Hawkins P, Stephens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12121613", "url": "https://glygen.org/publication/PubMed/12121613" } ] }, { "title": "Correlation between cellular localization of TEL/AML1 fusion protein and repression of AML1-mediated transactivation of CR1 gene.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Rho JK, Kim JH, Yu J, Choe SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330" } ], "reference": [ { "type": "PubMed", "id": "12220513", "url": "https://glygen.org/publication/PubMed/12220513" } ] }, { "title": "PEA-15 binding to ERK1/2 MAPKs is required for its modulation of integrin activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chou FL, Hill JM, Hsieh JC, Pouyssegur J, Brunet A, Glading A, Uberall F, Ramos JW, Werner MH, Ginsberg MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14506247", "url": "https://glygen.org/publication/PubMed/14506247" } ] }, { "title": "Association of the Shc and Grb2/Sem5 SH2-containing proteins is implicated in activation of the Ras pathway by tyrosine kinases.", "journal": "Nature", "date": "1992", "authors": "Rozakis-Adcock M, McGlade J, Mbamalu G, Pelicci G, Daly R, Li W, Batzer A, Thomas S, Brugge J, Pelicci PG, Schlessinger J, Pawson T, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "1465135", "url": "https://glygen.org/publication/PubMed/1465135" } ] }, { "title": "The death effector domain protein PEA-15 prevents nuclear entry of ERK2 by inhibiting required interactions.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Whitehurst AW, Robinson FL, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14707138", "url": "https://glygen.org/publication/PubMed/14707138" } ] }, { "title": "Compensatory energetic mechanisms mediating the assembly of signaling complexes between interleukin-2 and its alpha, beta, and gamma(c) receptors.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Rickert M, Boulanger MJ, Goriatcheva N, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "15178252", "url": "https://glygen.org/publication/PubMed/15178252" } ] }, { "title": "Recombinant interleukin-2 analogs. Dynamic probes for receptor structure.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Landgraf BE, Goldstein B, Williams DP, Murphy JR, Sana TR, Smith KA, Ciardelli TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "1526987", "url": "https://glygen.org/publication/PubMed/1526987" } ] }, { "title": "Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Arnaud M, Crouin C, Deon C, Loyaux D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15356145", "url": "https://glygen.org/publication/PubMed/15356145" } ] }, { "title": "Nuclear localization and regulation of erk- and rsk-encoded protein kinases.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Chen RH, Sarnecki C, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1545823", "url": "https://glygen.org/publication/PubMed/1545823" } ] }, { "title": "Live Cell Imaging of ERK and MEK: simple binding equilibrium explains the regulated nucleocytoplasmic distribution of ERK.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burack WR, Shaw AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15546878", "url": "https://glygen.org/publication/PubMed/15546878" } ] }, { "title": "Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors.", "journal": "Science", "date": "2005", "authors": "Wang X, Rickert M, Garcia KC", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "16293754", "url": "https://glygen.org/publication/PubMed/16293754" } ] }, { "title": "Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Stauber DJ, Debler EW, Horton PA, Smith KA, Wilson IA", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" }, { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "16477002", "url": "https://glygen.org/publication/PubMed/16477002" } ] }, { "title": "Roles of tyrosine 589 and 591 in STAT5 activation and transformation mediated by FLT3-ITD.", "journal": "Blood", "date": "2006", "authors": "Rocnik JL, Okabe R, Yu JC, Lee BH, Giese N, Schenkein DP, Gilliland DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16627759", "url": "https://glygen.org/publication/PubMed/16627759" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "FOXP3 controls regulatory T cell function through cooperation with NFAT.", "journal": "Cell", "date": "2006", "authors": "Wu Y, Borde M, Heissmeyer V, Feuerer M, Lapan AD, Stroud JC, Bates DL, Guo L, Han A, Ziegler SF, Mathis D, Benoist C, Chen L, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330" } ], "reference": [ { "type": "PubMed", "id": "16873067", "url": "https://glygen.org/publication/PubMed/16873067" } ] }, { "title": "Association of p21ras with phosphatidylinositol 3-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Sjolander A, Yamamoto K, Huber BE, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1716764", "url": "https://glygen.org/publication/PubMed/1716764" } ] }, { "title": "Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.", "journal": "Nature", "date": "2007", "authors": "Ono M, Yaguchi H, Ohkura N, Kitabayashi I, Nagamura Y, Nomura T, Miyachi Y, Tsukada T, Sakaguchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330" } ], "reference": [ { "type": "PubMed", "id": "17377532", "url": "https://glygen.org/publication/PubMed/17377532" } ] }, { "title": "Large-scale genetic fine mapping and genotype-phenotype associations implicate polymorphism in the IL2RA region in type 1 diabetes.", "journal": "Nat. Genet.", "date": "2007", "authors": "Lowe Christopher E, Cooper Jason D, Brusko Todd, Walker Neil M, Smyth Deborah J, Bailey Rebecca, Bourget Kirsi, Plagnol Vincent, Field Sarah, Atkinson Mark, Clayton David G, Wicker Linda S, Todd John A", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "17676041", "url": "https://glygen.org/publication/PubMed/17676041" } ] }, { "title": "Oncogenic signaling of class I PI3K isoforms.", "journal": "Oncogene", "date": "2008", "authors": "Denley A, Kang S, Karst U, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "17998941", "url": "https://glygen.org/publication/PubMed/17998941" } ] }, { "title": "Essential role of ERK dimers in the activation of cytoplasmic but not nuclear substrates by ERK-scaffold complexes.", "journal": "Molecular cell", "date": "2008", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "18775330", "url": "https://glygen.org/publication/PubMed/18775330" } ] }, { "title": "The GTPase superfamily: conserved structure and molecular mechanism.", "journal": "Nature", "date": "1991", "authors": "Bourne HR, Sanders DA, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1898771", "url": "https://glygen.org/publication/PubMed/1898771" } ] }, { "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19279408", "url": "https://glygen.org/publication/PubMed/19279408" } ] }, { "title": "Indispensable role of the Runx1-Cbfbeta transcription complex for in vivo-suppressive function of FoxP3+ regulatory T cells.", "journal": "Immunity", "date": "2009", "authors": "Kitoh A, Ono M, Naoe Y, Ohkura N, Yamaguchi T, Yaguchi H, Kitabayashi I, Tsukada T, Nomura T, Miyachi Y, Taniuchi I, Sakaguchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8877330", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330" } ], "reference": [ { "type": "PubMed", "id": "19800266", "url": "https://glygen.org/publication/PubMed/19800266" } ] }, { "title": "ERK nuclear translocation is dimerization-independent but controlled by the rate of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lidke DS, Huang F, Post JN, Rieger B, Wilsbacher J, Thomas JL, Pouyssegur J, Jovin TM, Lenormand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19920141", "url": "https://glygen.org/publication/PubMed/19920141" } ] }, { "title": "RalGDS family members couple Ras to Ral signalling and that's not all.", "journal": "Cellular signalling", "date": "2010", "authors": "Ferro E, Trabalzini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "20478380", "url": "https://glygen.org/publication/PubMed/20478380" } ] }, { "title": "Ras superfamily GEFs and GAPs: validated and tractable targets for cancer therapy?", "journal": "Nature reviews. Cancer", "date": "2010", "authors": "Vigil D, Cherfils J, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21102635", "url": "https://glygen.org/publication/PubMed/21102635" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "RAS Interaction with PI3K: More Than Just Another Effector Pathway.", "journal": "Genes & cancer", "date": "2011", "authors": "Castellano E, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779497", "url": "https://glygen.org/publication/PubMed/21779497" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "RAS oncogenes: weaving a tumorigenic web.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21993244", "url": "https://glygen.org/publication/PubMed/21993244" } ] }, { "title": "ERK1/2 MAP kinases: structure, function, and regulation.", "journal": "Pharmacological research", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22569528", "url": "https://glygen.org/publication/PubMed/22569528" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "Probing the GTPase cycle with real-time NMR: GAP and GEF activities in cell extracts.", "journal": "Methods (San Diego, Calif.)", "date": "2012", "authors": "Marshall CB, Meiri D, Smith MJ, Mazhab-Jafari MT, Gasmi-Seabrook GM, Rottapel R, Stambolic V, Ikura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22750304", "url": "https://glygen.org/publication/PubMed/22750304" } ] }, { "title": "Interleukin 2-induced tyrosine phosphorylation. Interleukin 2 receptor beta is tyrosine phosphorylated.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Mills GB, May C, McGill M, Fung M, Baker M, Sutherland R, Greene WC", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" } ], "reference": [ { "type": "PubMed", "id": "2303462", "url": "https://glygen.org/publication/PubMed/2303462" } ] }, { "title": "The protein tyrosine phosphatase, Shp2, positively contributes to FLT3-ITD-induced hematopoietic progenitor hyperproliferation and malignant disease in vivo.", "journal": "Leukemia", "date": "2013", "authors": "Nabinger SC, Li XJ, Ramdas B, He Y, Zhang X, Zeng L, Richine B, Bowling JD, Fukuda S, Goenka S, Liu Z, Feng GS, Yu M, Sandusky GE, Boswell HS, Zhang ZY, Kapur R, Chan RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23103841", "url": "https://glygen.org/publication/PubMed/23103841" } ] }, { "title": "Regulation of small GTPases by GEFs, GAPs, and GDIs.", "journal": "Physiological reviews", "date": "2013", "authors": "Cherfils J, Zeghouf M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23303910", "url": "https://glygen.org/publication/PubMed/23303910" } ] }, { "title": "Human IL2RA null mutation mediates immunodeficiency with lymphoproliferation and autoimmunity.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2013", "authors": "Goudy K, Aydin D, Barzaghi F, Gambineri E, Vignoli M, Ciullini Mannurita S, Doglioni C, Ponzoni M, Cicalese MP, Assanelli A, Tommasini A, Brigida I, Dellepiane RM, Martino S, Olek S, Aiuti A, Ciceri F, Roncarolo MG, Bacchetta R", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "23416241", "url": "https://glygen.org/publication/PubMed/23416241" } ] }, { "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.", "journal": "Science signaling", "date": "2013", "authors": "King PD, Lubeck BA, Lapinski PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23443682", "url": "https://glygen.org/publication/PubMed/23443682" } ] }, { "title": "Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.", "journal": "Nature communications", "date": "2013", "authors": "Mace PD, Wallez Y, Egger MF, Dobaczewska MK, Robinson H, Pasquale EB, Riedl SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23575685", "url": "https://glygen.org/publication/PubMed/23575685" } ] }, { "title": "Follicular bronchiolitis as phenotype associated with CD25 deficiency.", "journal": "Clinical and experimental immunology", "date": "2014", "authors": "Bezrodnik L, Caldirola MS, Seminario AG, Moreira I, Gaillard MI", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "24116927", "url": "https://glygen.org/publication/PubMed/24116927" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "PI3K/AKT signaling pathway and cancer: an updated review.", "journal": "Annals of medicine", "date": "2014", "authors": "Martini M, De Santis MC, Braccini L, Gulluni F, Hirsch E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24897931", "url": "https://glygen.org/publication/PubMed/24897931" } ] }, { "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.", "journal": "FEBS letters", "date": "2014", "authors": "Cseh B, Doma E, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24937142", "url": "https://glygen.org/publication/PubMed/24937142" } ] }, { "title": "Ral small GTPase signaling and oncogenesis: More than just 15minutes of fame.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Gentry LR, Martin TD, Reiner DJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25219551", "url": "https://glygen.org/publication/PubMed/25219551" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Identification of lymphocyte integral membrane proteins as substrates for protein kinase C. Phosphorylation of the interleukin-2 receptor, class I HLA antigens, and T200 glycoprotein.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Shackelford DA, Trowbridge IS", "evidence": [ { "database": "iPTMnet", "id": "P01589", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01589" } ], "reference": [ { "type": "PubMed", "id": "2941417", "url": "https://glygen.org/publication/PubMed/2941417" } ] }, { "title": "Structure of the human interleukin-2 receptor gene.", "journal": "Science", "date": "1985", "authors": "Leonard W J, Depper J M, Kanehisa M, Kr\u00f6nke M, Peffer N J, Svetlik P B, Sullivan M, Greene W C", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "2996141", "url": "https://glygen.org/publication/PubMed/2996141" } ] }, { "title": "Molecular cloning and structure of the human interleukin 2 receptor gene.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Ishida N, Kanamori H, Noma T, Nikaido T, Sabe H, Suzuki N, Shimizu A, Honjo T", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "2999698", "url": "https://glygen.org/publication/PubMed/2999698" } ] }, { "title": "Regulation of the human interleukin-2 receptor alpha chain promoter: activation of a nonfunctional promoter by the transactivator gene of HTLV-I.", "journal": "Cell", "date": "1987", "authors": "Cross S L, Feinberg M B, Wolf J B, Holbrook N J, Wong-Staal F, Leonard W J", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "3030566", "url": "https://glygen.org/publication/PubMed/3030566" } ] }, { "title": "The structural basis for Ras activation of PI3Kalpha lipid kinase.", "journal": "Physical chemistry chemical physics : PCCP", "date": "2019", "authors": "Zhang M, Jang H, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "31135801", "url": "https://glygen.org/publication/PubMed/31135801" } ] }, { "title": "Structural analysis of recombinant soluble human interleukin-2 receptor. Primary structure, assignment of disulfide bonds and core IL-2 binding structure.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Miedel MC, Hulmes JD, Weber DV, Bailon P, Pan YC", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589#ptm_processing" }, { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "3134887", "url": "https://glygen.org/publication/PubMed/3134887" } ] }, { "title": "A great disturbance in the force: IL-2 receptor defects disrupt immune homeostasis.", "journal": "Current opinion in pediatrics", "date": "2022-12-01", "authors": "Hernandez Joseph D, Hsieh Elena W Y", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ], "reference": [ { "type": "PubMed", "id": "36165614", "url": "https://glygen.org/publication/PubMed/36165614" } ] }, { "title": "An association study of IL2RA polymorphisms with cerebral palsy in a Chinese population.", "journal": "BMC medical genomics", "date": "2022", "authors": "Qiao Y, Wang Y, Xu Y, Zhang J, Su Y, Cheng Y, Bi D, Song J, Xia L, Li M, Zhang X, Zhu D, Wang T, Ding J, Wang X, Zhu C, Xing Q", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ], "reference": [ { "type": "PubMed", "id": "36195861", "url": "https://glygen.org/publication/PubMed/36195861" } ] }, { "title": "CD4+CD25+CD127loFOXP3+ cell in food allergy: Does it predict anaphylaxis?", "journal": "Allergologia et immunopathologia", "date": "2023", "authors": "Erdem Semiha Bahceci, Genel Ferah, Nacaroglu Hikmet Tekin, Karaman Sait, Kark\u0131ner Canan Sule Unsal, S\u00fcr\u00fcc\u00fc Murat, Can Demet", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ], "reference": [ { "type": "PubMed", "id": "37169554", "url": "https://glygen.org/publication/PubMed/37169554" } ] }, { "title": "DNA methylation differences within INS, PTPN22 and IL2RA promoters in lymphocyte subsets in children with type 1 diabetes and controls.", "journal": "Autoimmunity", "date": "2023-12", "authors": "Pahkuri Sirpa, Ekman Ilse, Vandamme C\u00e9line, N\u00e4nt\u00f6-Salonen Kirsti, Toppari Jorma, Veijola Riitta, Knip Mikael, Kinnunen Tuure, Ilonen Jorma, Lempainen Johanna", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ], "reference": [ { "type": "PubMed", "id": "37724526", "url": "https://glygen.org/publication/PubMed/37724526" } ] }, { "title": "Evaluation of gene-gene interaction between the interleukin (IL)-2 and IL-2RA gene polymorphisms in schizophrenia patients in the Turkish Population.", "journal": "Neurosciences (Riyadh, Saudi Arabia)", "date": "2024-01", "authors": "Ozdilli Kursat, Mervan Aytac Hasan, Ceren Tuncel Fatima, Oyaci Yasemin, Pehlivan Mustafa, Pehlivan Sacide", "evidence": [ { "database": "RefSeq", "id": "NP_000408", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000408" } ], "reference": [ { "type": "PubMed", "id": "38195135", "url": "https://glygen.org/publication/PubMed/38195135" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "P01589", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01589" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "Molecular cloning and expression of cDNAs for the human interleukin-2 receptor.", "journal": "Nature", "date": "1984", "authors": "Leonard W J, Depper J M, Crabtree G R, Rudikoff S, Pumphrey J, Robb R J, Kr\u00f6nke M, Svetlik P B, Peffer N J, Waldmann T A", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "6090948", "url": "https://glygen.org/publication/PubMed/6090948" } ] }, { "title": "Molecular cloning of cDNA encoding human interleukin-2 receptor.", "journal": "Nature", "date": "1984", "authors": "Nikaido T, Shimizu A, Ishida N, Sabe H, Teshigawara K, Maeda M, Uchiyama T, Yodoi J, Honjo T", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "6090949", "url": "https://glygen.org/publication/PubMed/6090949" } ] }, { "title": "Intrinsic GTPase activity distinguishes normal and oncogenic ras p21 molecules.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Gibbs JB, Sigal IS, Poe M, Scolnick EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "6148751", "url": "https://glygen.org/publication/PubMed/6148751" } ] }, { "title": "Analysis of interleukin-2-dependent signal transduction through the Shc/Grb2 adapter pathway. Interleukin-2-dependent mitogenesis does not require Shc phosphorylation or receptor association.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Evans GA, Goldsmith MA, Johnston JA, Xu W, Weiler SR, Erwin R, Howard OM, Abraham RT, O'Shea JJ, Greene WC, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "7499411", "url": "https://glygen.org/publication/PubMed/7499411" } ] }, { "title": "The interleukin-2 and interleukin-4 receptors studied by molecular modelling.", "journal": "Structure", "date": "1994", "authors": "Bamborough P, Hedgecock CJ, Richards WG", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "reference": [ { "type": "PubMed", "id": "7529123", "url": "https://glygen.org/publication/PubMed/7529123" } ] }, { "title": "Tyrosine phosphorylation and activation of STAT5, STAT3, and Janus kinases by interleukins 2 and 15.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Johnston JA, Bacon CM, Finbloom DS, Rees RC, Kaplan D, Shibuya K, Ortaldo JR, Gupta S, Chen YQ, Giri JD, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "7568001", "url": "https://glygen.org/publication/PubMed/7568001" } ] }, { "title": "Protein tyrosine kinase Syk is associated with and activated by the IL-2 receptor: possible link with the c-myc induction pathway.", "journal": "Immunity", "date": "1995", "authors": "Minami Y, Nakagawa Y, Kawahara A, Miyazaki T, Sada K, Yamamura H, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "7600304", "url": "https://glygen.org/publication/PubMed/7600304" } ] }, { "title": "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Spaargaren M, Bischoff JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7809086", "url": "https://glygen.org/publication/PubMed/7809086" } ] }, { "title": "ralGDS family members interact with the effector loop of ras p21.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kikuchi A, Demo SD, Ye ZH, Chen YW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7935463", "url": "https://glygen.org/publication/PubMed/7935463" } ] }, { "title": "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Hofer F, Fields S, Schneider C, Martin GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7972015", "url": "https://glygen.org/publication/PubMed/7972015" } ] }, { "title": "Interaction of IL-2R beta and gamma c chains with Jak1 and Jak3: implications for XSCID and XCID.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Russell SM, Johnston JA, Noguchi M, Kawamura M, Bacon CM, Friedmann M, Berg M, McVicar DW, Witthuhn BA, Silvennoinen O, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "7973658", "url": "https://glygen.org/publication/PubMed/7973658" } ] }, { "title": "Phosphorylation and activation of the Jak-3 Janus kinase in response to interleukin-2.", "journal": "Nature", "date": "1994", "authors": "Johnston JA, Kawamura M, Kirken RA, Chen YQ, Blake TB, Shibuya K, Ortaldo JR, McVicar DW, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8022485", "url": "https://glygen.org/publication/PubMed/8022485" } ] }, { "title": "Phosphatidylinositol-3-OH kinase as a direct target of Ras.", "journal": "Nature", "date": "1994", "authors": "Rodriguez-Viciana P, Warne PH, Dhand R, Vanhaesebroeck B, Gout I, Fry MJ, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8052307", "url": "https://glygen.org/publication/PubMed/8052307" } ] }, { "title": "Formation of Shc-Grb2 complexes is necessary to induce neoplastic transformation by overexpression of Shc proteins.", "journal": "Oncogene", "date": "1994", "authors": "Salcini AE, McGlade J, Pelicci G, Nicoletti I, Pawson T, Pelicci PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "8084588", "url": "https://glygen.org/publication/PubMed/8084588" } ] }, { "title": "The adapter protein Shc interacts with the interleukin-2 (IL-2) receptor upon IL-2 stimulation.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ravichandran KS, Burakoff SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8294403", "url": "https://glygen.org/publication/PubMed/8294403" } ] }, { "title": "Growth factors induce nuclear translocation of MAP kinases (p42mapk and p44mapk) but not of their activator MAP kinase kinase (p45mapkk) in fibroblasts.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Lenormand P, Sardet C, Pages G, L'Allemain G, Brunet A, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8394845", "url": "https://glygen.org/publication/PubMed/8394845" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lin JX, Mietz J, Modi WS, John S, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8631883", "url": "https://glygen.org/publication/PubMed/8631883" } ] }, { "title": "Evidence for a role for the phosphotyrosine-binding domain of Shc in interleukin 2 signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Ravichandran KS, Igras V, Shoelson SE, Fesik SW, Burakoff SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8643566", "url": "https://glygen.org/publication/PubMed/8643566" } ] }, { "title": "Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.", "journal": "The EMBO journal", "date": "1996", "authors": "Rodriguez-Viciana P, Warne PH, Vanhaesebroeck B, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8665852", "url": "https://glygen.org/publication/PubMed/8665852" } ] }, { "title": "Different interleukin 2 receptor beta-chain tyrosines couple to at least two signaling pathways and synergistically mediate interleukin 2-induced proliferation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Friedmann MC, Migone TS, Russell SM, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8700888", "url": "https://glygen.org/publication/PubMed/8700888" } ] }, { "title": "Distinct tyrosine residues within the interleukin-2 receptor beta chain drive signal transduction specificity, redundancy, and diversity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gaffen SL, Lai SY, Ha M, Liu X, Hennighausen L, Greene WC, Goldsmith MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "8702919", "url": "https://glygen.org/publication/PubMed/8702919" } ] }, { "title": "RalGDS-like factor (Rlf) is a novel Ras and Rap 1A-associating protein.", "journal": "Oncogene", "date": "1996", "authors": "Wolthuis RM, Bauer B, van 't Veer LJ, de Vries-Smits AM, Cool RH, Spaargaren M, Wittinghofer A, Burgering BM, Bos JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8710374", "url": "https://glygen.org/publication/PubMed/8710374" } ] }, { "title": "Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Peterson SN, Trabalzini L, Brtva TR, Fischer T, Altschuler DL, Martelli P, Lapetina EG, Der CJ, White GC 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8939933", "url": "https://glygen.org/publication/PubMed/8939933" } ] }, { "title": "A single STAT recruitment module in a chimeric cytokine receptor complex is sufficient for STAT activation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Behrmann I, Janzen C, Gerhartz C, Schmitz-Van de Leur H, Hermanns H, Heesel B, Graeve L, Horn F, Tavernier J, Heinrich PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "9030599", "url": "https://glygen.org/publication/PubMed/9030599" } ] }, { "title": "Shc interaction with Src homology 2 domain containing inositol phosphatase (SHIP) in vivo requires the Shc-phosphotyrosine binding domain and two specific phosphotyrosines on SHIP.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Lamkin TD, Walk SF, Liu L, Damen JE, Krystal G, Ravichandran KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "9099679", "url": "https://glygen.org/publication/PubMed/9099679" } ] }, { "title": "Purification and molecular cloning of SH2- and SH3-containing inositol polyphosphate-5-phosphatase, which is involved in the signaling pathway of granulocyte-macrophage colony-stimulating factor, erythropoietin, and Bcr-Abl.", "journal": "Blood", "date": "1997", "authors": "Odai H, Sasaki K, Iwamatsu A, Nakamoto T, Ueno H, Yamagata T, Mitani K, Yazaki Y, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "9108392", "url": "https://glygen.org/publication/PubMed/9108392" } ] }, { "title": "Pyk2 is a downstream mediator of the IL-2 receptor-coupled Jak signaling pathway.", "journal": "Genes & development", "date": "1998", "authors": "Miyazaki T, Takaoka A, Nogueira L, Dikic I, Fujii H, Tsujino S, Mitani Y, Maeda M, Schlessinger J, Taniguchi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558" } ], "reference": [ { "type": "PubMed", "id": "9512511", "url": "https://glygen.org/publication/PubMed/9512511" } ] }, { "title": "Phosphorylation of the MAP kinase ERK2 promotes its homodimerization and nuclear translocation.", "journal": "Cell", "date": "1998", "authors": "Khokhlatchev AV, Canagarajah B, Wilsbacher J, Robinson M, Atkinson M, Goldsmith E, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9604935", "url": "https://glygen.org/publication/PubMed/9604935" } ] }, { "title": "Cloning of p97/Gab2, the major SHP2-binding protein in hematopoietic cells, reveals a novel pathway for cytokine-induced gene activation.", "journal": "Molecular cell", "date": "1998", "authors": "Gu H, Pratt JC, Burakoff SJ, Neel BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526" } ], "reference": [ { "type": "PubMed", "id": "9885561", "url": "https://glygen.org/publication/PubMed/9885561" } ] }, { "title": "Nuclear translocation of p42/p44 mitogen-activated protein kinase is required for growth factor-induced gene expression and cell cycle entry.", "journal": "The EMBO journal", "date": "1999", "authors": "Brunet A, Roux D, Lenormand P, Dowd S, Keyse S, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9927426", "url": "https://glygen.org/publication/PubMed/9927426" } ] } ], "pathway": [ { "id": "hsa:3559", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3559", "resource": "KEGG Pathway" }, { "id": "R-HSA-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" }, { "id": "R-HSA-8877330", "name": "RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8877330", "resource": "Reactome", "description": "RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)" }, { "id": "R-HSA-9020558", "name": "Interleukin-2 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020558", "resource": "Reactome", "description": "Interleukin-2 signaling" }, { "id": "R-HSA-912526", "name": "Interleukin receptor SHC signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-912526", "resource": "Reactome", "description": "Interleukin receptor SHC signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P01590-1", "protein_name": "Interleukin-2 receptor subunit alpha", "gene_name": "Il2ra", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVASCLFLLISILLLSGLTWQHRWRKSRRTI", "length": 268 }, "evidence": [ { "id": "45934137", "url": "http://www.informatics.jax.org/homology/45934137", "database": "MGI" }, { "id": "P01589", "url": "https://omabrowser.org/oma/group/P01589/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P26897-1", "protein_name": "Interleukin-2 receptor subunit alpha", "gene_name": "Il2ra", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPHLLMLGFLSFTIVPGCWAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI", "length": 267 }, "evidence": [ { "id": "45934137", "url": "http://www.informatics.jax.org/homology/45934137", "database": "MGI" }, { "id": "P01589", "url": "https://omabrowser.org/oma/group/P01589/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "interleukin-2 receptor complex", "id": "GO:0005893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005893", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "interleukin-2 receptor activity", "id": "GO:0004911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004911", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "interleukin-2 binding", "id": "GO:0019976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019976", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "regulation of T cell tolerance induction", "id": "GO:0002664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002664", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "interleukin-2-mediated signaling pathway", "id": "GO:0038110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038110", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "regulation of T cell homeostatic proliferation", "id": "GO:0046013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046013", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "inflammatory response to antigenic stimulus", "id": "GO:0002437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002437", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "negative regulation of T cell proliferation", "id": "GO:0042130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042130", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "activated T cell proliferation", "id": "GO:0050798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050798", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "activation-induced cell death of T cells", "id": "GO:0006924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006924", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "positive regulation of activated T cell proliferation", "id": "GO:0042104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042104", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "positive regulation of T cell differentiation", "id": "GO:0045582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045582", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" }, { "name": "regulation of CD4-positive, alpha-beta T cell proliferation", "id": "GO:2000561", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000561", "evidence": [ { "database": "UniProtKB", "id": "P01589", "url": "https://www.uniprot.org/uniprot/P01589" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 89, "end_pos": 91, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 70, 89 ], "o_linked_sites": [ 60, 62, 218, 224, 229, 237 ], "snv_sites": [ 60, 70, 72, 91, 135, 218, 237 ], "glycation_sites": [], "phosphorylation_sites": [ 268, 271 ], "sequon_annotation_sites": [ { "start_pos": 70, "end_pos": 72 }, { "start_pos": 89, "end_pos": 91 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 107 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }