{ "uniprot_canonical_ac": "P01588-1", "uniprot_ac": "P01588", "uniprot_id": "EPO_HUMAN", "mass": { "chemical_mass": 21307.0, "monoisotopic_mass": 21307.0 }, "refseq": { "ac": "NP_000790", "name": "erythropoietin precursor", "summary": "This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies. [provided by RefSeq, Aug 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" }, "gene_names": [ { "name": "EPO", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01588", "id": "P01588" }, { "name": "DBAL; ECYT5; EP; MVCD2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790", "id": "NP_000790" }, { "name": "EPO", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790", "id": "NP_000790" } ], "protein_names": [ { "name": "Erythropoietin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01588" }, { "name": "epoetin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790", "id": "NP_000790" }, { "name": "erythropoietin precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790", "id": "NP_000790" } ], "function": [ { "annotation": "Changes in serum hypoxia-inducible factor-1alpha and erythropoietin in allergic rhinitis patients: Correlation with the Th inflammatory profile and disease comorbidities.", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" }, { "database": "PubMed", "id": "37596741", "url": "https://glygen.org/publication/PubMed/37596741" } ] }, { "annotation": "EPO rs1617640 A>C is a Protective Factor for Chronic Obstructive Pulmonary Disease: A Case Control Study.", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" }, { "database": "PubMed", "id": "37796693", "url": "https://glygen.org/publication/PubMed/37796693" } ] }, { "annotation": "Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588#function" }, { "database": "PubMed", "id": "28283061", "url": "https://glygen.org/publication/PubMed/28283061" } ] }, { "annotation": "Serum Erythropoietin level in anemia of elderly with unclear etiology. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" }, { "database": "PubMed", "id": "37741889", "url": "https://glygen.org/publication/PubMed/37741889" } ] }, { "annotation": "This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies. [provided by RefSeq, Aug 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" } ] }, { "annotation": "[Related factors of endogenous erythropoietin and its association with 10-year risks of cardiovascular disease in a community-based Chinese study].", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" }, { "database": "PubMed", "id": "38101791", "url": "https://glygen.org/publication/PubMed/38101791" } ] } ], "disease": [ { "disease_id": "DOID:0080290", "recommended_name": { "id": "DOID:0080290", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080290", "name": "familial erythrocytosis 5", "description": "A primary polycythemia characterized by autosomal dominant inheritance that has_material_basis_in heterozygous mutation in the EPO gene on chromosome 7q21." }, "synonyms": [ { "id": "DOID:0080290", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080290", "name": "ECYT5", "description": "" }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "erythrocytosis, familial, 5", "description": "Any familial polycythemia in which the cause of the disease is a mutation in the EPO gene." }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "EPO familial polycythemia", "description": "" }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "erythrocytosis, familial, 5", "description": "" }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "familial polycythemia caused by mutation in EPO", "description": "" }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "ECYT5", "description": "" }, { "id": "MONDO:0033483", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033483", "name": "familial erythrocytosis 5", "description": "" }, { "id": "MIM:617907", "resource": "MIM", "url": "https://www.omim.org/entry/617907", "name": "Erythrocytosis, familial, 5", "description": "Erythrocytosis, familial, 5" } ], "evidence": [ { "id": "617907", "database": "MIM", "url": "https://www.omim.org/entry/617907" } ] }, { "disease_id": "MONDO:0012962", "recommended_name": { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "microvascular complications of diabetes, susceptibility to, 2", "description": "Any microvascular complications of diabetes, susceptibility in which the cause of the disease is a mutation in the EPO gene." }, "synonyms": [ { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "EPO microvascular complications of diabetes, susceptibility", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "microvascular complications of diabetes 2", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "microvascular complications of diabetes, susceptibility caused by mutation in EPO", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "microvascular complications of diabetes, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "microvascular complications of diabetes, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "MVCD2", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "end-stage renal disease, diabetic, susceptibility to", "description": "" }, { "id": "MONDO:0012962", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012962", "name": "proliferative retinopathy, diabetic, susceptibility to", "description": "" }, { "id": "MIM:612623", "resource": "MIM", "url": "https://www.omim.org/entry/612623", "name": "Microvascular complications of diabetes 2", "description": "Microvascular complications of diabetes 2" } ], "evidence": [ { "id": "612623", "database": "MIM", "url": "https://www.omim.org/entry/612623" } ] }, { "disease_id": "MONDO:0060662", "recommended_name": { "id": "MONDO:0060662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0060662", "name": "Diamond-Blackfan anemia-like", "description": "" }, "synonyms": [ { "id": "MONDO:0060662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0060662", "name": "Diamond-Blackfan anemia-like", "description": "" }, { "id": "MONDO:0060662", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0060662", "name": "DBAL", "description": "" }, { "id": "MIM:617911", "resource": "MIM", "url": "https://www.omim.org/entry/617911", "name": "Diamond-Blackfan anemia-like", "description": "Diamond-Blackfan anemia-like" } ], "evidence": [ { "id": "617911", "database": "MIM", "url": "https://www.omim.org/entry/617911" } ] } ], "snv": [ { "evidence": [ { "id": "rs747340501", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747340501" }, { "id": "rs747340501", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747340501" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 53, "end_pos": 53, "sequence_org": "T", "sequence_mut": "=", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NI=).", "chr_id": "7", "chr_pos": "100721703", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T53", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773895305", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773895305" }, { "id": "rs773895305", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773895305" }, { "id": "rs773895305", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773895305#frequency_tab" }, { "id": "rs773895305", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773895305" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 53, "end_pos": 53, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIM).", "chr_id": "7", "chr_pos": "100721702", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T53", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773895305", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773895305" }, { "id": "rs773895305", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773895305" }, { "id": "rs773895305", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773895305#frequency_tab" }, { "id": "rs773895305", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773895305" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 53, "end_pos": 53, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIR).", "chr_id": "7", "chr_pos": "100721702", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T53", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 127, "end_pos": 127, "sequence_org": "S", "sequence_mut": "E", "comment": "Decreased erythrocyte proliferation; impaired EPOR dimerization following binding.", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" }, { "database": "PubMed", "id": "28283061", "url": "https://glygen.org/publication/PubMed/28283061" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.89", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "62.95", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "63.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "37.84", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "52.31", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "38.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "63.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "58.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "43.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01588", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01588" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "common_name": "Human" } ], "gene": [ { "name": "EPO", "url": "https://www.uniprot.org/uniprot/P01588", "locus": { "chromosome": "7", "start_pos": 100723700, "end_pos": 100720468, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000130427", "url": "https://www.ensembl.org/id/ENSG00000130427" } ] } } ], "crossref": [ { "id": "ENSG00000130427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130427", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5837", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5837", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "EPO", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EPO", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2056", "url": "https://www.ncbi.nlm.nih.gov/gene/2056", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "3415", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3415", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01588", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01588*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001323", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001323", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003013", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003013", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019767", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019767", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2056", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2056", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "133170", "url": "http://www.omim.org/entry/133170", "database": "MIM", "categories": [ "Other" ] }, { "id": "612623", "url": "http://www.omim.org/entry/612623", "database": "MIM", "categories": [ "Other" ] }, { "id": "617907", "url": "http://www.omim.org/entry/617907", "database": "MIM", "categories": [ "Other" ] }, { "id": "617911", "url": "http://www.omim.org/entry/617911", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01588", "url": "https://www.nextprot.org/entry/NX_P01588", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "AMEFPRL", "url": "https://omabrowser.org/oma/group/AMEFPRL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4338688at2759", "url": "http://www.orthodb.org/?query=4338688at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10370", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10370", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10370:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10370:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BUY", "url": "https://www.rcsb.org/structure/1BUY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CN4", "url": "https://www.rcsb.org/structure/1CN4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EER", "url": "https://www.rcsb.org/structure/1EER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00758", "url": "http://pfam.xfam.org/family/PF00758", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01588", "url": "https://pharos.nih.gov/targets/P01588", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000051782", "url": "https://proconsortium.org/app/entry/PR:000051782", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051783", "url": "https://proconsortium.org/app/entry/PR:000051783", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051784", "url": "https://proconsortium.org/app/entry/PR:000051784", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051785", "url": "https://proconsortium.org/app/entry/PR:000051785", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051786", "url": "https://proconsortium.org/app/entry/PR:000051786", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051787", "url": "https://proconsortium.org/app/entry/PR:000051787", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051788", "url": "https://proconsortium.org/app/entry/PR:000051788", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051789", "url": "https://proconsortium.org/app/entry/PR:000051789", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051790", "url": "https://proconsortium.org/app/entry/PR:000051790", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051791", "url": "https://proconsortium.org/app/entry/PR:000051791", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051792", "url": "https://proconsortium.org/app/entry/PR:000051792", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051793", "url": "https://proconsortium.org/app/entry/PR:000051793", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051794", "url": "https://proconsortium.org/app/entry/PR:000051794", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051795", "url": "https://proconsortium.org/app/entry/PR:000051795", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051796", "url": "https://proconsortium.org/app/entry/PR:000051796", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051797", "url": "https://proconsortium.org/app/entry/PR:000051797", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051798", "url": "https://proconsortium.org/app/entry/PR:000051798", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051799", "url": "https://proconsortium.org/app/entry/PR:000051799", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051800", "url": "https://proconsortium.org/app/entry/PR:000051800", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051801", "url": "https://proconsortium.org/app/entry/PR:000051801", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051802", "url": "https://proconsortium.org/app/entry/PR:000051802", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051803", "url": "https://proconsortium.org/app/entry/PR:000051803", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051804", "url": "https://proconsortium.org/app/entry/PR:000051804", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051805", "url": "https://proconsortium.org/app/entry/PR:000051805", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051806", "url": "https://proconsortium.org/app/entry/PR:000051806", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051807", "url": "https://proconsortium.org/app/entry/PR:000051807", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051808", "url": "https://proconsortium.org/app/entry/PR:000051808", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051809", "url": "https://proconsortium.org/app/entry/PR:000051809", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051810", "url": "https://proconsortium.org/app/entry/PR:000051810", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051811", "url": "https://proconsortium.org/app/entry/PR:000051811", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051812", "url": "https://proconsortium.org/app/entry/PR:000051812", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051813", "url": "https://proconsortium.org/app/entry/PR:000051813", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051814", "url": "https://proconsortium.org/app/entry/PR:000051814", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051815", "url": "https://proconsortium.org/app/entry/PR:000051815", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051816", "url": "https://proconsortium.org/app/entry/PR:000051816", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051817", "url": "https://proconsortium.org/app/entry/PR:000051817", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051818", "url": "https://proconsortium.org/app/entry/PR:000051818", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051819", "url": "https://proconsortium.org/app/entry/PR:000051819", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051820", "url": "https://proconsortium.org/app/entry/PR:000051820", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051821", "url": "https://proconsortium.org/app/entry/PR:000051821", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051822", "url": "https://proconsortium.org/app/entry/PR:000051822", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051823", "url": "https://proconsortium.org/app/entry/PR:000051823", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051824", "url": "https://proconsortium.org/app/entry/PR:000051824", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051825", "url": "https://proconsortium.org/app/entry/PR:000051825", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051826", "url": "https://proconsortium.org/app/entry/PR:000051826", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051827", "url": "https://proconsortium.org/app/entry/PR:000051827", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051828", "url": "https://proconsortium.org/app/entry/PR:000051828", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051829", "url": "https://proconsortium.org/app/entry/PR:000051829", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051830", "url": "https://proconsortium.org/app/entry/PR:000051830", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051831", "url": "https://proconsortium.org/app/entry/PR:000051831", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051832", "url": "https://proconsortium.org/app/entry/PR:000051832", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051833", "url": "https://proconsortium.org/app/entry/PR:000051833", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051834", "url": "https://proconsortium.org/app/entry/PR:000051834", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051835", "url": "https://proconsortium.org/app/entry/PR:000051835", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051836", "url": "https://proconsortium.org/app/entry/PR:000051836", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051837", "url": "https://proconsortium.org/app/entry/PR:000051837", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051838", "url": "https://proconsortium.org/app/entry/PR:000051838", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051839", "url": "https://proconsortium.org/app/entry/PR:000051839", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051840", "url": "https://proconsortium.org/app/entry/PR:000051840", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051841", "url": "https://proconsortium.org/app/entry/PR:000051841", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051842", "url": "https://proconsortium.org/app/entry/PR:000051842", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051843", "url": "https://proconsortium.org/app/entry/PR:000051843", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051844", "url": "https://proconsortium.org/app/entry/PR:000051844", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051845", "url": "https://proconsortium.org/app/entry/PR:000051845", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051846", "url": "https://proconsortium.org/app/entry/PR:000051846", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051847", "url": "https://proconsortium.org/app/entry/PR:000051847", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051848", "url": "https://proconsortium.org/app/entry/PR:000051848", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051849", "url": "https://proconsortium.org/app/entry/PR:000051849", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051850", "url": "https://proconsortium.org/app/entry/PR:000051850", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051851", "url": "https://proconsortium.org/app/entry/PR:000051851", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051852", "url": "https://proconsortium.org/app/entry/PR:000051852", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051853", "url": "https://proconsortium.org/app/entry/PR:000051853", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051854", "url": "https://proconsortium.org/app/entry/PR:000051854", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051855", "url": "https://proconsortium.org/app/entry/PR:000051855", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051856", "url": "https://proconsortium.org/app/entry/PR:000051856", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051857", "url": "https://proconsortium.org/app/entry/PR:000051857", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051858", "url": "https://proconsortium.org/app/entry/PR:000051858", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051859", "url": "https://proconsortium.org/app/entry/PR:000051859", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051860", "url": "https://proconsortium.org/app/entry/PR:000051860", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051861", "url": "https://proconsortium.org/app/entry/PR:000051861", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051862", "url": "https://proconsortium.org/app/entry/PR:000051862", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051863", "url": "https://proconsortium.org/app/entry/PR:000051863", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051864", "url": "https://proconsortium.org/app/entry/PR:000051864", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051865", "url": "https://proconsortium.org/app/entry/PR:000051865", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051866", "url": "https://proconsortium.org/app/entry/PR:000051866", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051867", "url": "https://proconsortium.org/app/entry/PR:000051867", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051868", "url": "https://proconsortium.org/app/entry/PR:000051868", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051869", "url": "https://proconsortium.org/app/entry/PR:000051869", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051870", "url": "https://proconsortium.org/app/entry/PR:000051870", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051871", "url": "https://proconsortium.org/app/entry/PR:000051871", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051872", "url": "https://proconsortium.org/app/entry/PR:000051872", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051873", "url": "https://proconsortium.org/app/entry/PR:000051873", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051874", "url": "https://proconsortium.org/app/entry/PR:000051874", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051875", "url": "https://proconsortium.org/app/entry/PR:000051875", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051876", "url": "https://proconsortium.org/app/entry/PR:000051876", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051877", "url": "https://proconsortium.org/app/entry/PR:000051877", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051878", "url": "https://proconsortium.org/app/entry/PR:000051878", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051879", "url": "https://proconsortium.org/app/entry/PR:000051879", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051880", "url": "https://proconsortium.org/app/entry/PR:000051880", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051881", "url": "https://proconsortium.org/app/entry/PR:000051881", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051882", "url": "https://proconsortium.org/app/entry/PR:000051882", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051883", "url": "https://proconsortium.org/app/entry/PR:000051883", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051884", "url": "https://proconsortium.org/app/entry/PR:000051884", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051885", "url": "https://proconsortium.org/app/entry/PR:000051885", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051886", "url": "https://proconsortium.org/app/entry/PR:000051886", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051887", "url": "https://proconsortium.org/app/entry/PR:000051887", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051888", "url": "https://proconsortium.org/app/entry/PR:000051888", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051889", "url": "https://proconsortium.org/app/entry/PR:000051889", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051890", "url": "https://proconsortium.org/app/entry/PR:000051890", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051891", "url": "https://proconsortium.org/app/entry/PR:000051891", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051892", "url": "https://proconsortium.org/app/entry/PR:000051892", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051893", "url": "https://proconsortium.org/app/entry/PR:000051893", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051894", "url": "https://proconsortium.org/app/entry/PR:000051894", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051895", "url": "https://proconsortium.org/app/entry/PR:000051895", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051896", "url": "https://proconsortium.org/app/entry/PR:000051896", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051897", "url": "https://proconsortium.org/app/entry/PR:000051897", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051898", "url": "https://proconsortium.org/app/entry/PR:000051898", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051899", "url": "https://proconsortium.org/app/entry/PR:000051899", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051900", "url": "https://proconsortium.org/app/entry/PR:000051900", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051901", "url": "https://proconsortium.org/app/entry/PR:000051901", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051902", "url": "https://proconsortium.org/app/entry/PR:000051902", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051903", "url": "https://proconsortium.org/app/entry/PR:000051903", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051904", "url": "https://proconsortium.org/app/entry/PR:000051904", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051905", "url": "https://proconsortium.org/app/entry/PR:000051905", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051906", "url": "https://proconsortium.org/app/entry/PR:000051906", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051907", "url": "https://proconsortium.org/app/entry/PR:000051907", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051908", "url": "https://proconsortium.org/app/entry/PR:000051908", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051909", "url": "https://proconsortium.org/app/entry/PR:000051909", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051910", "url": "https://proconsortium.org/app/entry/PR:000051910", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051911", "url": "https://proconsortium.org/app/entry/PR:000051911", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051912", "url": "https://proconsortium.org/app/entry/PR:000051912", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051913", "url": "https://proconsortium.org/app/entry/PR:000051913", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051914", "url": "https://proconsortium.org/app/entry/PR:000051914", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051915", "url": "https://proconsortium.org/app/entry/PR:000051915", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051916", "url": "https://proconsortium.org/app/entry/PR:000051916", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051917", "url": "https://proconsortium.org/app/entry/PR:000051917", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051918", "url": "https://proconsortium.org/app/entry/PR:000051918", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051919", "url": "https://proconsortium.org/app/entry/PR:000051919", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051920", "url": "https://proconsortium.org/app/entry/PR:000051920", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051921", "url": "https://proconsortium.org/app/entry/PR:000051921", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051922", "url": "https://proconsortium.org/app/entry/PR:000051922", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051923", "url": "https://proconsortium.org/app/entry/PR:000051923", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051924", "url": "https://proconsortium.org/app/entry/PR:000051924", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051925", "url": "https://proconsortium.org/app/entry/PR:000051925", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051926", "url": "https://proconsortium.org/app/entry/PR:000051926", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051927", "url": "https://proconsortium.org/app/entry/PR:000051927", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051928", "url": "https://proconsortium.org/app/entry/PR:000051928", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051929", "url": "https://proconsortium.org/app/entry/PR:000051929", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051930", "url": "https://proconsortium.org/app/entry/PR:000051930", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051931", "url": "https://proconsortium.org/app/entry/PR:000051931", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051932", "url": "https://proconsortium.org/app/entry/PR:000051932", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051933", "url": "https://proconsortium.org/app/entry/PR:000051933", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051934", "url": "https://proconsortium.org/app/entry/PR:000051934", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051935", "url": "https://proconsortium.org/app/entry/PR:000051935", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051936", "url": "https://proconsortium.org/app/entry/PR:000051936", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051937", "url": "https://proconsortium.org/app/entry/PR:000051937", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051938", "url": "https://proconsortium.org/app/entry/PR:000051938", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051939", "url": "https://proconsortium.org/app/entry/PR:000051939", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051940", "url": "https://proconsortium.org/app/entry/PR:000051940", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051941", "url": "https://proconsortium.org/app/entry/PR:000051941", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051942", "url": "https://proconsortium.org/app/entry/PR:000051942", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051943", "url": "https://proconsortium.org/app/entry/PR:000051943", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051944", "url": "https://proconsortium.org/app/entry/PR:000051944", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051945", "url": "https://proconsortium.org/app/entry/PR:000051945", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051946", "url": "https://proconsortium.org/app/entry/PR:000051946", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051947", "url": "https://proconsortium.org/app/entry/PR:000051947", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051948", "url": "https://proconsortium.org/app/entry/PR:000051948", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051949", "url": "https://proconsortium.org/app/entry/PR:000051949", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051950", "url": "https://proconsortium.org/app/entry/PR:000051950", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051951", "url": "https://proconsortium.org/app/entry/PR:000051951", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051952", "url": "https://proconsortium.org/app/entry/PR:000051952", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051953", "url": "https://proconsortium.org/app/entry/PR:000051953", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051954", "url": "https://proconsortium.org/app/entry/PR:000051954", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051955", "url": "https://proconsortium.org/app/entry/PR:000051955", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051956", "url": "https://proconsortium.org/app/entry/PR:000051956", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000051957", "url": "https://proconsortium.org/app/entry/PR:000051957", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P01588", "url": "http://purl.obolibrary.org/obo/PR_P01588", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9027277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027277", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01588", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01588-1", "url": "https://www.uniprot.org/uniprot/P01588-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR", "length": 193, "header": "sp|P01588-1|EPO_HUMAN Isoform 1 of Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1 CANONICAL=P01588-1" }, "isoforms": [ { "isoform_ac": "P01588-1", "url": "", "sequence": { "sequence": "MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR", "length": 193, "header": "sp|P01588-1|EPO_HUMAN Isoform 1 of Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1 CANONICAL=P01588-1" }, "locus": { "chromosome": "7", "start_pos": 100723130, "end_pos": 100720981, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000252723.3", "url": "https://www.ensembl.org/id/ENST00000252723.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000252723.2", "url": "https://www.ensembl.org/id/ENSP00000252723.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G00551JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G00553AN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G01450UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G02311IE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G02561FC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G04959WS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G09176OA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G10148VG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G10228OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G11528MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G12436UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G13165FV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G13282WA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G14199EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16208YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16529MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G16873YG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G17155VX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G18639PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G19603RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G20218ZS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G22721QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G23165GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G25392ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G26777RD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G27844UM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G28103WK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G31665QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G33284WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G39643OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G39952PY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G40027VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G40194MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G43761WH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G45116BB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G47279LF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G48109OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G48488CO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G49446SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G50489VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G50888WV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G51057KO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G56516KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G56811US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G57248BB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G58598BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G62619LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G62765SF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G67610NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G68209WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G68892PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G71549MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G74859XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G75520NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G78166NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G80537QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G81107PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G82410AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G83108TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G83295QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G84331QL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G84390MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G86696LV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G86753CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G88696CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G88976TU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G90784AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G90789YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91152KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G91905FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G92574YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G92709EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G94974XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G96503EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G96719MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G98259QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "P01588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01588#ptm_processing" }, { "id": "3949763", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3949763" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G19399OS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G27945LI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G46831QF", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G47190LU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G47318KU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G47967RK", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G48809BS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G49644CL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G60554YG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G71838YU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "22678432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22678432" }, { "id": "P01588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01588#ptm_processing" }, { "id": "3949763", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3949763" } ] }, { "glytoucan_ac": "G00249IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G00551JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G01450UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G02311IE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G02561FC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G06330RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G09176OA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G10148VG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G10228OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G12436UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G13165FV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G13282WA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G14199EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G14796IU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16208YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16529MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G16873YG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G17155VX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G18639PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G19603RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G20218ZS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G22721QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G23869AA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7781780", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7781780" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G25379SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G25392ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G27290LL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G27844UM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G28103WK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G29501UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G31838XA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G33284WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G35364KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G39643OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G39952PY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G40027VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G40194MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G43761WH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G45116BB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G47279LF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G48109OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G48488CO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G49446SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G50489VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G50707YR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G50888WV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G51057KO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G52122ZD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G53492UE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G54639VI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G56516KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G56811US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G58598BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G60984DZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G61962FK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G62619LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G62765SF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G67610NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G68209WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G68796US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G68892PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G74859XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G75520NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G80537QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G81107PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G82410AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G83108TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G83295QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G83676GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G84390MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G86696LV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G86753CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G88696CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G88976TU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G90448RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G90784AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G90789YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91152KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G91905FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G92574YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G92709EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G93180LE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G94309NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G94974XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G96503EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G96719MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G97428EW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G98259QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "P01588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01588#ptm_processing" }, { "id": "3949763", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3949763" } ] }, { "glytoucan_ac": "G00249IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G00551JZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G01450UB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G02311IE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G02561FC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G05813WO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G09176OA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G10148VG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G10228OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G12436UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G13165FV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G13282WA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G14199EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16208YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G16529MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G16873YG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G17155VX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G18639PA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G19603RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G20218ZS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G22721QX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G25392ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G27844UM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G28103WK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G31153XO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G31665QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G33284WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G39643OJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G39952PY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G40027VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G40194MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G42459UQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G43761WH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G47279LF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G48109OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G48488CO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G49446SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G50489VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G50888WV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G51057KO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G52782YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G56516KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G56811US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G58598BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G60723SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G62619LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G62765SF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G67610NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G68209WQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G68892PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G74859XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G75520NV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G78166NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G80537QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G81107PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G82410AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G83108TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G83213GG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G83295QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G83676GD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G84390MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G86696LV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G86753CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G88696CU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G90448RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G90784AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G90789YQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91152KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G91905FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G92574YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G92709EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ] }, { "glytoucan_ac": "G93180LE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "glytoucan_ac": "G94974XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "G96503EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G96719MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110, S-153", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G98259QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "32578997", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-51, N-65, N-110", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "P01588", "database": "UniCarbKB", "url": "" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "10764840", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10764840" }, { "id": "P01588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01588#ptm_processing" }, { "id": "3949763", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3949763" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G02311IE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G05813WO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G07410AW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G09576QH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G10228OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G12436UO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" } ] }, { "glytoucan_ac": "G13282WA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G13441ZL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G14389GM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "glytoucan_ac": "G14950CY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G16208YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G16529MG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G16679DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" } ] }, { "glytoucan_ac": "G16873YG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G17155VX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "glytoucan_ac": "G18938DW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G19399OS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G19972YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "glytoucan_ac": "G23305TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G25392ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G26775OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G27844UM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G28948UC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G29097SS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G30460NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G31380TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G31991IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G36123IU", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G40027VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G40194MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G40428GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G45209NR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G47279LF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G48109OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" } ] }, { "glytoucan_ac": "G48488CO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G49446SO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G50489VC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G51562OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G53322JT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "11805077", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "glytoucan_ac": "G53752TA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G56516KW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "glytoucan_ac": "G57581QG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G57789QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G58039UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G59742GY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G62619LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G62765SF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G68892PJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G74859XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "glytoucan_ac": "G75154UG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G77149EE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "glytoucan_ac": "G79809MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" } ] }, { "glytoucan_ac": "G80537QW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8460945", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8460945" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G82410AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G84390MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G84756CG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G86696LV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G86753CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G88027AL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "2813359", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2813359" }, { "id": "3346214", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3346214" }, { "id": "8981093", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8981093" }, { "id": "3179269", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3179269" }, { "id": "2550193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "glytoucan_ac": "G90784AP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G91152KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G91413ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G91905FJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G92574YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "glytoucan_ac": "G94531EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "8054720", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8054720" }, { "id": "1907570", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1907570" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" }, { "id": "2124546", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2124546" }, { "id": "8477709", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8477709" }, { "id": "1443598", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1443598" }, { "id": "7527189", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "glytoucan_ac": "G94974XB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G96503EZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G96719MC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G98259QP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "glytoucan_ac": "G98568VG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "140", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/140" }, { "id": "7737204", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7737204" } ] } ], "phosphorylation": [ { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01588" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser111" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01588" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser127" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Erythropoietin induces the tyrosine phosphorylation of GAB1 and its association with SHC, SHP2, SHIP, and phosphatidylinositol 3-kinase.", "journal": "Blood", "date": "1999", "authors": "Lecoq-Lafon C, Verdier F, Fichelson S, Chretien S, Gisselbrecht S, Lacombe C, Mayeux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "10194437", "url": "https://glygen.org/publication/PubMed/10194437" } ] }, { "title": "Molecular mechanisms of transcription activation by HLF and HIF1alpha in response to hypoxia: their stabilization and redox signal-induced interaction with CBP/p300.", "journal": "The EMBO journal", "date": "1999", "authors": "Ema M, Hirota K, Mimura J, Abe H, Yodoi J, Sogawa K, Poellinger L, Fujii-Kuriyama Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "10202154", "url": "https://glygen.org/publication/PubMed/10202154" } ] }, { "title": "Engagement of Gab1 and Gab2 in erythropoietin signaling.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wickrema A, Uddin S, Sharma A, Chen F, Alsayed Y, Ahmad S, Sawyer ST, Krystal G, Yi T, Nishada K, Hibi M, Hirano T, Platanias LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "10455108", "url": "https://glygen.org/publication/PubMed/10455108" } ] }, { "title": "Erythropoietin receptor mutations associated with familial erythrocytosis cause hypersensitivity to erythropoietin in the heterozygous state.", "journal": "Blood", "date": "1999", "authors": "Watowich SS, Xie X, Klingmuller U, Kere J, Lindlof M, Berglund S, de la Chapelle A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "10498627", "url": "https://glygen.org/publication/PubMed/10498627" } ] }, { "title": "Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties.", "journal": "Glycobiology", "date": "2000", "authors": "Cointe D, Beliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "10764840", "url": "https://glygen.org/publication/PubMed/10764840" } ] }, { "title": "Signaling induced by erythropoietin and stem cell factor in UT-7/Epo cells: transient versus sustained proliferation.", "journal": "Stem cells (Dayton, Ohio)", "date": "2000", "authors": "Erickson-Miller CL, Pelus LM, Lord KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "11007921", "url": "https://glygen.org/publication/PubMed/11007921" } ] }, { "title": "Molecular mechanism of hypoxia-inducible factor 1alpha -p300 interaction. A leucine-rich interface regulated by a single cysteine.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gu J, Milligan J, Huang LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "11063749", "url": "https://glygen.org/publication/PubMed/11063749" } ] }, { "title": "Rap1 is activated by erythropoietin or interleukin-3 and is involved in regulation of beta1 integrin-mediated hematopoietic cell adhesion.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Arai A, Nosaka Y, Kanda E, Yamamoto K, Miyasaka N, Miura O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "11124936", "url": "https://glygen.org/publication/PubMed/11124936" } ] }, { "title": "Hypoxia-inducible expression of tumor-associated carbonic anhydrases.", "journal": "Cancer research", "date": "2000", "authors": "Wykoff CC, Beasley NJ, Watson PH, Turner KJ, Pastorek J, Sibtain A, Wilson GD, Turley H, Talks KL, Maxwell PH, Pugh CW, Ratcliffe PJ, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "11156414", "url": "https://glygen.org/publication/PubMed/11156414" } ] }, { "title": "Self assembly of the transmembrane domain promotes signal transduction through the erythropoietin receptor.", "journal": "Current biology : CB", "date": "2001", "authors": "Kubatzky KF, Ruan W, Gurezka R, Cohen J, Ketteler R, Watowich SS, Neumann D, Langosch D, Klingmuller U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "11231127", "url": "https://glygen.org/publication/PubMed/11231127" } ] }, { "title": "CrkL is recruited through its SH2 domain to the erythropoietin receptor and plays a role in Lyn-mediated receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Arai A, Kanda E, Nosaka Y, Miyasaka N, Miura O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "11443118", "url": "https://glygen.org/publication/PubMed/11443118" } ] }, { "title": "Src transduces erythropoietin-induced differentiation signals through phosphatidylinositol 3-kinase.", "journal": "The EMBO journal", "date": "2001", "authors": "Kubota Y, Tanaka T, Kitanaka A, Ohnishi H, Okutani Y, Waki M, Ishida T, Kamano H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "11598010", "url": "https://glygen.org/publication/PubMed/11598010" } ] }, { "title": "Sugar profiling proves that human serum erythropoietin differs from recombinant human erythropoietin.", "journal": "Blood", "date": "2001", "authors": "Skibeli V, Nissen-Lie G, Torjesen P", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "11739166", "url": "https://glygen.org/publication/PubMed/11739166" } ] }, { "title": "Structural analysis of sulfated N-linked oligosaccharides in erythropoietin.", "journal": "Glycobiology", "date": "2001", "authors": "Kawasaki N, Haishima Y, Ohta M, Itoh S, Hyuga M, Hyuga S, Hayakawa T", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "11805077", "url": "https://glygen.org/publication/PubMed/11805077" } ] }, { "title": "Structural basis for Hif-1 alpha /CBP recognition in the cellular hypoxic response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Dames SA, Martinez-Yamout M, De Guzman RN, Dyson HJ, Wright PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "11959977", "url": "https://glygen.org/publication/PubMed/11959977" } ] }, { "title": "Structural basis for recruitment of CBP/p300 by hypoxia-inducible factor-1 alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Freedman SJ, Sun ZY, Poy F, Kung AL, Livingston DM, Wagner G, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "11959990", "url": "https://glygen.org/publication/PubMed/11959990" } ] }, { "title": "Critical role for PI 3-kinase in the control of erythropoietin-induced erythroid progenitor proliferation.", "journal": "Blood", "date": "2003", "authors": "Bouscary D, Pene F, Claessens YE, Muller O, Chretien S, Fontenay-Roupie M, Gisselbrecht S, Mayeux P, Lacombe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "12506011", "url": "https://glygen.org/publication/PubMed/12506011" } ] }, { "title": "Erythropoietin induces the tyrosine phosphorylation of its own receptor in human erythropoietin-responsive cells.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Dusanter-Fourt I, Casadevall N, Lacombe C, Muller O, Billat C, Fischer S, Mayeux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "1375226", "url": "https://glygen.org/publication/PubMed/1375226" } ] }, { "title": "Erythropoietin rapidly induces tyrosine phosphorylation in the human erythropoietin-dependent cell line, UT-7.", "journal": "Blood", "date": "1992", "authors": "Komatsu N, Adamson JW, Yamamoto K, Altschuler D, Torti M, Marzocchini R, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "1377053", "url": "https://glygen.org/publication/PubMed/1377053" } ] }, { "title": "Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization.", "journal": "Analytical biochemistry", "date": "1992", "authors": "Rice KG, Takahashi N, Namiki Y, Tran AD, Lisi PJ, Lee YC", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "1443598", "url": "https://glygen.org/publication/PubMed/1443598" } ] }, { "title": "Structural basis for PAS domain heterodimerization in the basic helix--loop--helix-PAS transcription factor hypoxia-inducible factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Erbel PJ, Card PB, Karakuzu O, Bruick RK, Gardner KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "14668441", "url": "https://glygen.org/publication/PubMed/14668441" } ] }, { "title": "PI3 kinase is important for Ras, MEK and Erk activation of Epo-stimulated human erythroid progenitors.", "journal": "BMC biology", "date": "2004", "authors": "Schmidt EK, Fichelson S, Feller SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "15149544", "url": "https://glygen.org/publication/PubMed/15149544" } ] }, { "title": "Strict regulation of CAIX(G250/MN) by HIF-1alpha in clear cell renal cell carcinoma.", "journal": "Oncogene", "date": "2004", "authors": "Grabmaier K, A de Weijert MC, Verhaegh GW, Schalken JA, Oosterwijk E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "15184875", "url": "https://glygen.org/publication/PubMed/15184875" } ] }, { "title": "Pure red-cell aplasia and epoetin therapy.", "journal": "The New England journal of medicine", "date": "2004", "authors": "Bennett CL, Luminari S, Nissenson AR, Tallman MS, Klinge SA, McWilliams N, McKoy JM, Kim B, Lyons EA, Trifilio SM, Raisch DW, Evens AM, Kuzel TM, Schumock GT, Belknap SM, Locatelli F, Rossert J, Casadevall N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "15459301", "url": "https://glygen.org/publication/PubMed/15459301" } ] }, { "title": "A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach.", "journal": "Blood", "date": "2005", "authors": "Montoye T, Lemmens I, Catteeuw D, Eyckerman S, Tavernier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "15644415", "url": "https://glygen.org/publication/PubMed/15644415" } ] }, { "title": "Erythropoietin induces p21ras activation and p120GAP tyrosine phosphorylation in human erythroleukemia cells.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Torti M, Marti KB, Altschuler D, Yamamoto K, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "1569084", "url": "https://glygen.org/publication/PubMed/1569084" } ] }, { "title": "Correction of anemia with epoetin alfa in chronic kidney disease.", "journal": "The New England journal of medicine", "date": "2006", "authors": "Singh AK, Szczech L, Tang KL, Barnhart H, Sapp S, Wolfson M, Reddan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "17108343", "url": "https://glygen.org/publication/PubMed/17108343" } ] }, { "title": "The N-terminal transactivation domain confers target gene specificity of hypoxia-inducible factors HIF-1alpha and HIF-2alpha.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Hu CJ, Sataur A, Wang L, Chen H, Simon MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "17804822", "url": "https://glygen.org/publication/PubMed/17804822" } ] }, { "title": "Nuclear translocation of hypoxia-inducible factors (HIFs): involvement of the classical importin alpha/beta pathway.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Depping R, Steinhoff A, Schindler SG, Friedrich B, Fagerlund R, Metzen E, Hartmann E, Kohler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "18187047", "url": "https://glygen.org/publication/PubMed/18187047" } ] }, { "title": "Structures and functional roles of the sugar chains of human erythropoietins.", "journal": "Glycobiology", "date": "1991", "authors": "Takeuchi M, Kobata A", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "1820196", "url": "https://glygen.org/publication/PubMed/1820196" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P01588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01588" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Promoter polymorphism of the erythropoietin gene in severe diabetic eye and kidney complications.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Tong Zongzhong, Yang Zhenglin, Patel Shrena, Chen Haoyu, Gibbs Daniel, Yang Xian, Hau Vincent S, Kaminoh Yuuki, Harmon Jennifer, Pearson Erik, Buehler Jeanette, Chen Yuhong, Yu Baifeng, Tinkham Nicholas H, Zabriskie Norman A, Zeng Jiexi, Luo Ling, Sun Jennifer K, Prakash Manvi, Hamam Rola N, Tonna Stephen, Constantine Ryan, Ronquillo Cecinio C, Sadda SriniVas, Avery Robert L, Brand John M, London Nyall, Anduze Alfred L, King George L, Bernstein Paul S, Watkins Scott, , Jorde Lynn B, Li Dean Y, Aiello Lloyd Paul, Pollak Martin R, Zhang Kang", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "18458324", "url": "https://glygen.org/publication/PubMed/18458324" } ] }, { "title": "Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides.", "journal": "FEBS letters", "date": "1991", "authors": "Hokke CH, Kamerling JP, van Dedem GW, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "1907570", "url": "https://glygen.org/publication/PubMed/1907570" } ] }, { "title": "Gab1 transduces PI3K-mediated erythropoietin signals to the Erk pathway and regulates erythropoietin-dependent proliferation and survival of erythroid cells.", "journal": "Cellular signalling", "date": "2009", "authors": "Fukumoto T, Kubota Y, Kitanaka A, Yamaoka G, Ohara-Waki F, Imataki O, Ohnishi H, Ishida T, Tanaka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276" } ], "reference": [ { "type": "PubMed", "id": "19665053", "url": "https://glygen.org/publication/PubMed/19665053" } ] }, { "title": "Transport of hypoxia-inducible factor HIF-1alpha into the nucleus involves importins 4 and 7.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Chachami G, Paraskeva E, Mingot JM, Braliou GG, Gorlich D, Simos G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "19788888", "url": "https://glygen.org/publication/PubMed/19788888" } ] }, { "title": "Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid.", "journal": "FEBS letters", "date": "1990", "authors": "Hokke CH, Bergwerff AA, van Dedem GW, van Oostrum J, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "2124546", "url": "https://glygen.org/publication/PubMed/2124546" } ] }, { "title": "Roles of the human hypoxia-inducible factor (HIF)-3alpha variants in the hypoxia response.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Heikkila M, Pasanen A, Kivirikko KI, Myllyharju J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "21479871", "url": "https://glygen.org/publication/PubMed/21479871" } ] }, { "title": "Human erythropoietin receptor: cloning, expression, and biologic characterization.", "journal": "Blood", "date": "1990", "authors": "Jones SS, D'Andrea AD, Haines LL, Wong GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "2163696", "url": "https://glygen.org/publication/PubMed/2163696" } ] }, { "title": "Erythropoietin receptor signaling is membrane raft dependent.", "journal": "PloS one", "date": "2012", "authors": "McGraw KL, Fuhler GM, Johnson JO, Clark JA, Caceres GC, Sokol L, List AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "22509308", "url": "https://glygen.org/publication/PubMed/22509308" } ] }, { "title": "Determination of site-specific glycan heterogeneity on glycoproteins.", "journal": "Nature protocols", "date": "2012", "authors": "Kolarich D, Jensen PH, Altmann F, Packer NH", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "22678432", "url": "https://glygen.org/publication/PubMed/22678432" } ] }, { "title": "An open-label, sequential, dose-finding study of peginesatide for the maintenance treatment of anemia in chronic hemodialysis patients.", "journal": "BMC nephrology", "date": "2012", "authors": "Besarab A, Zeig SN, Martin ER, Pergola PE, Whittier FC, Zabaneh RI, Schiller B, Mayo M, Francisco CA, Polu KR, Duliege AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "22935486", "url": "https://glygen.org/publication/PubMed/22935486" } ] }, { "title": "Peginesatide to Manage Anemia in Chronic Kidney Disease Patients on Peritoneal Dialysis.", "journal": "Peritoneal dialysis international : journal of the International Society for Peritoneal Dialysis", "date": "2015", "authors": "Zabaneh R, Roger SD, El-Shahawy M, Roppolo M, Runyan G, O'Neil J, Qiu P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "24584613", "url": "https://glygen.org/publication/PubMed/24584613" } ] }, { "title": "Hypoxia-inducible factor 3 is an oxygen-dependent transcription activator and regulates a distinct transcriptional response to hypoxia.", "journal": "Cell reports", "date": "2014", "authors": "Zhang P, Yao Q, Lu L, Li Y, Chen PJ, Duan C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "24613356", "url": "https://glygen.org/publication/PubMed/24613356" } ] }, { "title": "RHEX, a novel regulator of human erythroid progenitor cell expansion and erythroblast development.", "journal": "The Journal of experimental medicine", "date": "2014", "authors": "Verma R, Su S, McCrann DJ, Green JM, Leu K, Young PR, Schatz PJ, Silva JC, Stokes MP, Wojchowski DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "25092874", "url": "https://glygen.org/publication/PubMed/25092874" } ] }, { "title": "Recombinant human erythropoietin produced by Namalwa cells.", "journal": "DNA (Mary Ann Liebert, Inc.)", "date": "1989", "authors": "Yanagi H, Yoshima T, Ogawa I, Okamoto M", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "2550193", "url": "https://glygen.org/publication/PubMed/2550193" } ] }, { "title": "The emerging role of biosimilar epoetins in nephrology in the United States.", "journal": "American journal of kidney diseases : the official journal of the National Kidney Foundation", "date": "2015", "authors": "Fishbane S, Shah HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "25582283", "url": "https://glygen.org/publication/PubMed/25582283" } ] }, { "title": "HIGD1A Regulates Oxygen Consumption, ROS Production, and AMPK Activity during Glucose Deprivation to Modulate Cell Survival and Tumor Growth.", "journal": "Cell reports", "date": "2015", "authors": "Ameri K, Jahangiri A, Rajah AM, Tormos KV, Nagarajan R, Pekmezci M, Nguyen V, Wheeler ML, Murphy MP, Sanders TA, Jeffrey SS, Yeghiazarians Y, Rinaudo PF, Costello JF, Aghi MK, Maltepe E", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "25683712", "url": "https://glygen.org/publication/PubMed/25683712" } ] }, { "title": "The action of HIF-3alpha variants on HIF-2alpha-HIF-1beta heterodimer formation is directly probed in live cells.", "journal": "Experimental cell research", "date": "2015", "authors": "Kim SH, Hwang D, Park H, Yang EG, Chung HS, Kim SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "26160453", "url": "https://glygen.org/publication/PubMed/26160453" } ] }, { "title": "Gene panel sequencing improves the diagnostic work-up of patients with idiopathic erythrocytosis and identifies new mutations.", "journal": "Haematologica", "date": "2016", "authors": "Camps C, Petousi N, Bento C, Cario H, Copley RR, McMullin MF, van Wijk R, Ratcliffe PJ, Robbins PA, Taylor JC", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "27651169", "url": "https://glygen.org/publication/PubMed/27651169" } ] }, { "title": "Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Takeuchi M, Inoue N, Strickland TW, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "2813359", "url": "https://glygen.org/publication/PubMed/2813359" } ] }, { "title": "History of Erythropoiesis-Stimulating Agents, the Development of Biosimilars, and the Future of Anemia Treatment in Nephrology.", "journal": "American journal of nephrology", "date": "2017", "authors": "Kalantar-Zadeh K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "28142147", "url": "https://glygen.org/publication/PubMed/28142147" } ] }, { "title": "Functional Selectivity in Cytokine Signaling Revealed Through a Pathogenic EPO Mutation.", "journal": "Cell", "date": "2017", "authors": "Kim AR, Ulirsch JC, Wilmes S, Unal E, Moraga I, Karakukcu M, Yuan D, Kazerounian S, Abdulhay NJ, King DS, Gupta N, Gabriel SB, Lander ES, Patiroglu T, Ozcan A, Ozdemir MA, Garcia KC, Piehler J, Gazda HT, Klein DE, Sankaran VG", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "28283061", "url": "https://glygen.org/publication/PubMed/28283061" } ] }, { "title": "A Gain-of-function mutation in EPO in familial erythrocytosis.", "journal": "N. Engl. J. Med.", "date": "2018", "authors": "Zmajkovic Jakub, Lundberg Pontus, Nienhold Ronny, Torgersen Maria L, Sundan Anders, Waage Anders, Skoda Radek C", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "29514032", "url": "https://glygen.org/publication/PubMed/29514032" } ] }, { "title": "Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins.", "journal": "Biochemistry", "date": "1988", "authors": "Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H, et al.", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "3179269", "url": "https://glygen.org/publication/PubMed/3179269" } ] }, { "title": "Site-specific glycosylation of human recombinant erythropoietin: analysis of glycopeptides or peptides at each glycosylation site by fast atom bombardment mass spectrometry.", "journal": "Biochemistry", "date": "1988", "authors": "Sasaki H, Ochi N, Dell A, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "3219367", "url": "https://glygen.org/publication/PubMed/3219367" } ] }, { "title": "Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin.", "journal": "Analytical chemistry", "date": "2020", "authors": "Lippold S, Buttner A, Choo MSF, Hook M, de Jong CJ, Nguyen-Khuong T, Haberger M, Reusch D, Wuhrer M, de Haan N", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "32578997", "url": "https://glygen.org/publication/PubMed/32578997" } ] }, { "title": "Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "3346214", "url": "https://glygen.org/publication/PubMed/3346214" } ] }, { "title": "Changes in serum hypoxia-inducible factor-1\u03b1 and erythropoietin in allergic rhinitis patients: Correlation with the Th inflammatory profile and disease comorbidities.", "journal": "International journal of immunopathology and pharmacology", "date": "2023", "authors": "Al-Rasheedi Abdullah N, Almaeen Abdulrahman H, Alotaibi Abdullah D, Alruwaili Abdulaziz S D, Alruwaili Sultan H H, Alruwaili Wadad M A, Alsakhry Aljoharah S, Alruwaili Ghuyudh M, ALkuwaykibi Hala M, Alrawili Noof N, Alabdullah Rahaf Z, Alatwi Reem S, Taher Ibrahim, El-Metwally Tarek H", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" } ], "reference": [ { "type": "PubMed", "id": "37596741", "url": "https://glygen.org/publication/PubMed/37596741" } ] }, { "title": "Serum Erythropoietin level in anemia of elderly with unclear etiology.", "journal": "Scientific reports", "date": "2023-09-23", "authors": "Seong Ju Yong, Shin Dong-Yeop, Byun Ja Min, Koh Youngil, Hong Junshik, Kim Inho, Yoon Sung-Soo", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" } ], "reference": [ { "type": "PubMed", "id": "37741889", "url": "https://glygen.org/publication/PubMed/37741889" } ] }, { "title": "EPO rs1617640 A>C is a Protective Factor for Chronic Obstructive Pulmonary Disease: A Case Control Study.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2023-09-24", "authors": "Wang Yunchao, Li Zhi, Zhang Xiaoyi, Lin Ao, Chen Cuiyi, Zeng Xiaobin, Pan Yujie, Mao Chun, Xie Chenli, Huang Dongsheng, Deng Yibin, Zhang Xuhui, Lu Jiachun, Wang Xinhua", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" } ], "reference": [ { "type": "PubMed", "id": "37796693", "url": "https://glygen.org/publication/PubMed/37796693" } ] }, { "title": "[Related factors of endogenous erythropoietin and its association with 10-year risks of cardiovascular disease in a community-based Chinese study].", "journal": "Beijing da xue xue bao. Yi xue ban = Journal of Peking University. Health sciences", "date": "2023-12-18", "authors": "Chen Chu Yun, Sun Peng Fei, Zhao Jing, Jia Jia, Fan Fang Fang, Wang Chun Yan, Li Jian Ping, Jiang Yi Meng, Huo Yong, Zhang Yan", "evidence": [ { "database": "RefSeq", "id": "NP_000790", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000790" } ], "reference": [ { "type": "PubMed", "id": "38101791", "url": "https://glygen.org/publication/PubMed/38101791" } ] }, { "title": "Isolation and characterization of genomic and cDNA clones of human erythropoietin.", "journal": "Nature", "date": "1985", "authors": "Jacobs K, Shoemaker C, Rudersdorf R, Neill S D, Kaufman R J, Mufson A, Seehra J, Jones S S, Hewick R, Fritsch E F", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "3838366", "url": "https://glygen.org/publication/PubMed/3838366" } ] }, { "title": "Cloning and expression of the human erythropoietin gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Lin F K, Suggs S, Lin C H, Browne J K, Smalling R, Egrie J C, Chen K K, Fox G M, Martin F, Stabinsky Z", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "3865178", "url": "https://glygen.org/publication/PubMed/3865178" } ] }, { "title": "Structural characterization of human erythropoietin.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Lai PH, Everett R, Wang FF, Arakawa T, Goldwasser E", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588#ptm_processing" }, { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "3949763", "url": "https://glygen.org/publication/PubMed/3949763" } ] }, { "title": "Isolation of human erythropoietin with monoclonal antibodies.", "journal": "J. Biol. Chem.", "date": "1984", "authors": "Yanagawa S, Hirade K, Ohnota H, Sasaki R, Chiba H, Ueda M, Goto M", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "6698989", "url": "https://glygen.org/publication/PubMed/6698989" } ] }, { "title": "A strategy for the mapping of N-glycans by high-performance capillary electrophoresis.", "journal": "Analytical biochemistry", "date": "1994", "authors": "Hermentin P, Doenges R, Witzel R, Hokke CH, Vliegenthart JF, Kamerling JP, Conradt HS, Nimtz M, Brazel D", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "7527189", "url": "https://glygen.org/publication/PubMed/7527189" } ] }, { "title": "Tyrosine phosphorylation of the proto-oncogene product Vav and its association with the adapter Grb2/Ash in a human leukemia cell line UT-7.", "journal": "Japanese journal of cancer research : Gann", "date": "1995", "authors": "Hanazono Y, Sasaki K, Odai H, Mimura T, Mitani K, Yazaki Y, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "7539782", "url": "https://glygen.org/publication/PubMed/7539782" } ] }, { "title": "Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Wang GL, Jiang BH, Rue EA, Semenza GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "7539918", "url": "https://glygen.org/publication/PubMed/7539918" } ] }, { "title": "Interleukin-3, erythropoietin, and prolactin activate a STAT5-like factor in lymphoid cells.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Pallard C, Gouilleux F, Charon M, Groner B, Gisselbrecht S, Dusanter-Fourt I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "7608147", "url": "https://glygen.org/publication/PubMed/7608147" } ] }, { "title": "Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Hokke CH, Bergwerff AA, Van Dedem GW, Kamerling JP, Vliegenthart JF", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "7737204", "url": "https://glygen.org/publication/PubMed/7737204" } ] }, { "title": "Prolactin, growth hormone, erythropoietin and granulocyte-macrophage colony stimulating factor induce MGF-Stat5 DNA binding activity.", "journal": "The EMBO journal", "date": "1995", "authors": "Gouilleux F, Pallard C, Dusanter-Fourt I, Wakao H, Haldosen LA, Norstedt G, Levy D, Groner B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "7744007", "url": "https://glygen.org/publication/PubMed/7744007" } ] }, { "title": "Identification and structural characterization of a mannose-6-phosphate containing oligomannosidic N-glycan from human erythropoietin secreted by recombinant BHK-21 cells.", "journal": "FEBS letters", "date": "1995", "authors": "Nimtz M, Wray V, Rudiger A, Conradt HS", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "7781780", "url": "https://glygen.org/publication/PubMed/7781780" } ] }, { "title": "Purification and characterization of hypoxia-inducible factor 1.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Wang GL, Semenza GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "7836384", "url": "https://glygen.org/publication/PubMed/7836384" } ] }, { "title": "Erythropoietin induces tyrosine phosphorylation and activation of phospholipase C-gamma 1 in a human erythropoietin-dependent cell line.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ren HY, Komatsu N, Shimizu R, Okada K, Miura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027277" } ], "reference": [ { "type": "PubMed", "id": "8034732", "url": "https://glygen.org/publication/PubMed/8034732" } ] }, { "title": "Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells.", "journal": "Glycobiology", "date": "1994", "authors": "Watson E, Bhide A, van Halbeek H", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "8054720", "url": "https://glygen.org/publication/PubMed/8054720" } ] }, { "title": "General involvement of hypoxia-inducible factor 1 in transcriptional response to hypoxia.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Wang GL, Semenza GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "8387214", "url": "https://glygen.org/publication/PubMed/8387214" } ] }, { "title": "Gene expression of mutant erythropoietin in hepatocellular carcinoma.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Funakoshi A, Muta H, Baba T, Shimizu S", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "8396923", "url": "https://glygen.org/publication/PubMed/8396923" } ] }, { "title": "Erythropoietin stimulates the tyrosine phosphorylation of Shc and its association with Grb2 and a 145-Kd tyrosine phosphorylated protein.", "journal": "Blood", "date": "1993", "authors": "Damen JE, Liu L, Cutler RL, Krystal G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "8400282", "url": "https://glygen.org/publication/PubMed/8400282" } ] }, { "title": "Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "8460945", "url": "https://glygen.org/publication/PubMed/8460945" } ] }, { "title": "Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells.", "journal": "European journal of biochemistry", "date": "1993", "authors": "Nimtz M, Martin W, Wray V, Kloppel KD, Augustin J, Conradt HS", "evidence": [ { "database": "UniCarbKB", "id": "P01588", "url": "" }, { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "8477709", "url": "https://glygen.org/publication/PubMed/8477709" } ] }, { "title": "Dimerization, DNA binding, and transactivation properties of hypoxia-inducible factor 1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jiang BH, Rue E, Wang GL, Roe R, Semenza GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "8663540", "url": "https://glygen.org/publication/PubMed/8663540" } ] }, { "title": "Proto-oncogene products Vav and c-Cbl are involved in the signal transduction through Grb2/Ash in hematopoietic cells.", "journal": "Acta haematologica", "date": "1996", "authors": "Hanazono Y, Odai H, Sasaki K, Iwamatsu A, Yazaki Y, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "8677749", "url": "https://glygen.org/publication/PubMed/8677749" } ] }, { "title": "Activation of vascular endothelial growth factor gene transcription by hypoxia-inducible factor 1.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Forsythe JA, Jiang BH, Iyer NV, Agani F, Leung SW, Koos RD, Semenza GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "8756616", "url": "https://glygen.org/publication/PubMed/8756616" } ] }, { "title": "Erythropoietin-induced erythroid differentiation of the human erythroleukemia cell line TF-1 correlates with impaired STAT5 activation.", "journal": "The EMBO journal", "date": "1996", "authors": "Chretien S, Varlet P, Verdier F, Gobert S, Cartron JP, Gisselbrecht S, Mayeux P, Lacombe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "8861946", "url": "https://glygen.org/publication/PubMed/8861946" } ] }, { "title": "An essential role for p300/CBP in the cellular response to hypoxia.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Arany Z, Huang LE, Eckner R, Bhattacharya S, Jiang C, Goldberg MA, Bunn HF, Livingston DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "8917528", "url": "https://glygen.org/publication/PubMed/8917528" } ] }, { "title": "Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase.", "journal": "Glycoconjugate journal", "date": "1996", "authors": "Morimoto K, Tsuda E, Said AA, Uchida E, Hatakeyama S, Ueda M, Hayakawa T", "evidence": [ { "database": "GlyConnect", "id": "140", "url": "https://glyconnect.expasy.org/browser/proteins/140" } ], "reference": [ { "type": "PubMed", "id": "8981093", "url": "https://glygen.org/publication/PubMed/8981093" } ] }, { "title": "Endothelial PAS domain protein 1 (EPAS1), a transcription factor selectively expressed in endothelial cells.", "journal": "Genes & development", "date": "1997", "authors": "Tian H, McKnight SL, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9000051", "url": "https://glygen.org/publication/PubMed/9000051" } ] }, { "title": "Erythropoietin gene regulation depends on heme-dependent oxygen sensing and assembly of interacting transcription factors.", "journal": "Kidney international", "date": "1997", "authors": "Huang LE, Ho V, Arany Z, Krainc D, Galson D, Tendler D, Livingston DM, Bunn HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9027736", "url": "https://glygen.org/publication/PubMed/9027736" } ] }, { "title": "Erythropoietin-induced activation of STAT5 is impaired in the myelodysplastic syndrome.", "journal": "Blood", "date": "1997", "authors": "Hoefsloot LH, van Amelsvoort MP, Broeders LC, van der Plas DC, van Lom K, Hoogerbrugge H, Touw IP, Lowenberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9057652", "url": "https://glygen.org/publication/PubMed/9057652" } ] }, { "title": "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Hogenesch JB, Chan WK, Jackiw VH, Brown RC, Gu YZ, Pray-Grant M, Perdew GH, Bradfield CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9079689", "url": "https://glygen.org/publication/PubMed/9079689" } ] }, { "title": "Role of the vav proto-oncogene product (Vav) in erythropoietin-mediated cell proliferation and phosphatidylinositol 3-kinase activity.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Shigematsu H, Iwasaki H, Otsuka T, Ohno Y, Arima F, Niho Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "9162069", "url": "https://glygen.org/publication/PubMed/9162069" } ] }, { "title": "The signal transduction through Grb2/Ash in hematopoietic cells.", "journal": "Leukemia", "date": "1997", "authors": "Odai H, Hanazono Y, Sasaki K, Iwamatu A, Yazaki Y, Hirai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027284", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284" } ], "reference": [ { "type": "PubMed", "id": "9209406", "url": "https://glygen.org/publication/PubMed/9209406" } ] }, { "title": "Erythropoietin induces the tyrosine phosphorylation of insulin receptor substrate-2. An alternate pathway for erythropoietin-induced phosphatidylinositol 3-kinase activation.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Verdier F, Chretien S, Billat C, Gisselbrecht S, Lacombe C, Mayeux P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "9334184", "url": "https://glygen.org/publication/PubMed/9334184" } ] }, { "title": "Lyn physically associates with the erythropoietin receptor and may play a role in activation of the Stat5 pathway.", "journal": "Blood", "date": "1998", "authors": "Chin H, Arai A, Wakao H, Kamiyama R, Miyasaka N, Miura O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "9573010", "url": "https://glygen.org/publication/PubMed/9573010" } ] }, { "title": "Regulation of both erythroid and megakaryocytic differentiation of a human leukemia cell line, UT-7.", "journal": "Acta haematologica", "date": "1998", "authors": "Miura Y, Kirito K, Komatsu N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9587401", "url": "https://glygen.org/publication/PubMed/9587401" } ] }, { "title": "Regulation of transcription by hypoxia requires a multiprotein complex that includes hypoxia-inducible factor 1, an adjacent transcription factor, and p300/CREB binding protein.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Ebert BL, Bunn HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9632793", "url": "https://glygen.org/publication/PubMed/9632793" } ] }, { "title": "Erythropoietin induces tyrosine phosphorylation of Jak2, STAT5A, and STAT5B in primary cultured human erythroid precursors.", "journal": "Blood", "date": "1998", "authors": "Oda A, Sawada K, Druker BJ, Ozaki K, Takano H, Koizumi K, Fukada Y, Handa M, Koike T, Ikeda Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9657743", "url": "https://glygen.org/publication/PubMed/9657743" } ] }, { "title": "Insulin-like growth factor-I augments erythropoietin-induced proliferation through enhanced tyrosine phosphorylation of STAT5.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Okajima Y, Matsumura I, Nishiura T, Hashimoto K, Yoshida H, Ishikawa J, Wakao H, Yoshimura A, Kanakura Y, Tomiyama Y, Matsuzawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9722506", "url": "https://glygen.org/publication/PubMed/9722506" } ] }, { "title": "Efficiency of signalling through cytokine receptors depends critically on receptor orientation.", "journal": "Nature", "date": "1998", "authors": "Syed RS, Reid SW, Li C, Cheetham JC, Aoki KH, Liu B, Zhan H, Osslund TD, Chirino AJ, Zhang J, Finer-Moore J, Elliott S, Sitney K, Katz BA, Matthews DJ, Wendoloski JJ, Egrie J, Stroud RM", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" }, { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "9774108", "url": "https://glygen.org/publication/PubMed/9774108" } ] }, { "title": "NMR structure of human erythropoietin and a comparison with its receptor bound conformation.", "journal": "Nat. Struct. Biol.", "date": "1998", "authors": "Cheetham J C, Smith D M, Aoki K H, Stevenson J L, Hoeffel T J, Syed R S, Egrie J, Harvey T S", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "9783743", "url": "https://glygen.org/publication/PubMed/9783743" } ] }, { "title": "Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.", "journal": "Genome Res.", "date": "1998", "authors": "Glockner G, Scherer S, Schattevoy R, Boright A, Weber J, Tsui LC, Rosenthal A", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "reference": [ { "type": "PubMed", "id": "9799793", "url": "https://glygen.org/publication/PubMed/9799793" } ] }, { "title": "Signal transduction in hypoxic cells: inducible nuclear translocation and recruitment of the CBP/p300 coactivator by the hypoxia-inducible factor-1alpha.", "journal": "The EMBO journal", "date": "1998", "authors": "Kallio PJ, Okamoto K, O'Brien S, Carrero P, Makino Y, Tanaka H, Poellinger L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9822602", "url": "https://glygen.org/publication/PubMed/9822602" } ] }, { "title": "Association of CrkL with STAT5 in hematopoietic cells stimulated by granulocyte-macrophage colony-stimulating factor or erythropoietin.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Ota J, Kimura F, Sato K, Wakimoto N, Nakamura Y, Nagata N, Suzu S, Yamada M, Shimamura S, Motoyoshi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9837784", "url": "https://glygen.org/publication/PubMed/9837784" } ] }, { "title": "Molecular characterization and chromosomal localization of a third alpha-class hypoxia inducible factor subunit, HIF3alpha.", "journal": "Gene expression", "date": "1998", "authors": "Gu YZ, Moran SM, Hogenesch JB, Wartman L, Bradfield CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158" } ], "reference": [ { "type": "PubMed", "id": "9840812", "url": "https://glygen.org/publication/PubMed/9840812" } ] }, { "title": "A human erythropoietin receptor gene mutant causing familial erythrocytosis is associated with deregulation of the rates of Jak2 and Stat5 inactivation.", "journal": "Experimental hematology", "date": "1999", "authors": "Arcasoy MO, Harris KW, Forget BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9027283", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283" } ], "reference": [ { "type": "PubMed", "id": "9923445", "url": "https://glygen.org/publication/PubMed/9923445" } ] }, { "title": "Erythropoietin receptor activation by a ligand-induced conformation change.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Remy I, Wilson IA, Michnick SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9006335", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335" } ], "reference": [ { "type": "PubMed", "id": "9974393", "url": "https://glygen.org/publication/PubMed/9974393" } ] } ], "pathway": [ { "id": "hsa:2056", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2056", "resource": "KEGG Pathway" }, { "id": "R-HSA-1234158", "name": "Regulation of gene expression by Hypoxia-inducible Factor", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234158", "resource": "Reactome", "description": "Regulation of gene expression by Hypoxia-inducible Factor" }, { "id": "R-HSA-9006335", "name": "Signaling by Erythropoietin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9006335", "resource": "Reactome", "description": "Signaling by Erythropoietin" }, { "id": "R-HSA-9027276", "name": "Erythropoietin activates Phosphoinositide-3-kinase (PI3K)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027276", "resource": "Reactome", "description": "Erythropoietin activates Phosphoinositide-3-kinase (PI3K)" }, { "id": "R-HSA-9027277", "name": "Erythropoietin activates Phospholipase C gamma (PLCG)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027277", "resource": "Reactome", "description": "Erythropoietin activates Phospholipase C gamma (PLCG)" }, { "id": "R-HSA-9027283", "name": "Erythropoietin activates STAT5", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027283", "resource": "Reactome", "description": "Erythropoietin activates STAT5" }, { "id": "R-HSA-9027284", "name": "Erythropoietin activates RAS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9027284", "resource": "Reactome", "description": "Erythropoietin activates RAS" } ], "orthologs": [ { "uniprot_canonical_ac": "P07321-1", "protein_name": "Erythropoietin", "gene_name": "Epo", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLKLYTGEVCRRGDR", "length": 192 }, "evidence": [ { "id": "45921212", "url": "http://www.informatics.jax.org/homology/45921212", "database": "MGI" }, { "id": "P01588", "url": "https://omabrowser.org/oma/group/P01588/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P29676-1", "protein_name": "Erythropoietin", "gene_name": "Epo", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR", "length": 192 }, "evidence": [ { "id": "45921212", "url": "http://www.informatics.jax.org/homology/45921212", "database": "MGI" }, { "id": "P01588", "url": "https://omabrowser.org/oma/group/P01588/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P49157-1", "protein_name": "Erythropoietin", "gene_name": "EPO", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGARECPARLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR", "length": 194 }, "evidence": [ { "id": "P01588", "url": "https://omabrowser.org/oma/group/P01588/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 34, "go_terms": [ { "name": "positive regulation of Ras protein signal transduction", "id": "GO:0046579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046579", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "erythrocyte maturation", "id": "GO:0043249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043249", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of neuron differentiation", "id": "GO:0045666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045666", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "acute-phase response", "id": "GO:0006953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006953", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "blood circulation", "id": "GO:0008015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008015", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "erythrocyte differentiation", "id": "GO:0030218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030218", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to vitamin A", "id": "GO:0033189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033189", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to salt stress", "id": "GO:0009651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009651", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to estrogen", "id": "GO:0043627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043627", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to axon injury", "id": "GO:0048678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048678", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to electrical stimulus", "id": "GO:0051602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051602", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to interleukin-1", "id": "GO:0070555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070555", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "myeloid cell apoptotic process", "id": "GO:0033028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033028", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "cellular hyperosmotic response", "id": "GO:0071474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071474", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress", "id": "GO:1902219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902219", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "embryo implantation", "id": "GO:0007566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007566", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of activated T cell proliferation", "id": "GO:0042104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042104", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "positive regulation of tyrosine phosphorylation of STAT protein", "id": "GO:0042531", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042531", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to hyperoxia", "id": "GO:0055093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055093", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "erythropoietin-mediated signaling pathway", "id": "GO:0038162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038162", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "hemoglobin biosynthetic process", "id": "GO:0042541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042541", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "negative regulation of erythrocyte apoptotic process", "id": "GO:1902251", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902251", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "negative regulation of cation channel activity", "id": "GO:2001258", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001258", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "negative regulation of calcium ion transport into cytosol", "id": "GO:0010523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010523", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to testosterone", "id": "GO:0033574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033574", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "response to dexamethasone", "id": "GO:0071548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071548", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "cell body", "id": "GO:0044297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044297", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein kinase activator activity", "id": "GO:0030295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030295", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" }, { "name": "erythropoietin receptor binding", "id": "GO:0005128", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005128", "evidence": [ { "database": "UniProtKB", "id": "P01588", "url": "https://www.uniprot.org/uniprot/P01588" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "erythropoietin N-glycosylated 1 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G00551JZ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G00551JZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051782", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051782" } ] }, { "name": "erythropoietin N-glycosylated 2 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02311IE. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G02311IE. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051783", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051783" } ] }, { "name": "erythropoietin N-glycosylated 3 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02561FC. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G02561FC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051784", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051784" } ] }, { "name": "erythropoietin N-glycosylated 4 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G04959WS. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G04959WS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051785", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051785" } ] }, { "name": "erythropoietin N-glycosylated 5 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G09176OA. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G09176OA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051786", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051786" } ] }, { "name": "erythropoietin N-glycosylated 6 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G10228OD. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G10228OD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051787", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051787" } ] }, { "name": "erythropoietin N-glycosylated 7 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G11528MV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G11528MV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051788", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051788" } ] }, { "name": "erythropoietin N-glycosylated 8 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G12436UO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G12436UO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051789", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051789" } ] }, { "name": "erythropoietin N-glycosylated 9 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G13165FV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G13165FV. [PRO:DNx, PMID:22678432]", "evidence": [ { "id": "PR:000051790", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051790" } ] }, { "name": "erythropoietin N-glycosylated 10 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G13282WA. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G13282WA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051791", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051791" } ] }, { "name": "erythropoietin N-glycosylated 11 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16529MG. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G16529MG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051792", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051792" } ] }, { "name": "erythropoietin N-glycosylated 12 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16873YG. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G16873YG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051793", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051793" } ] }, { "name": "erythropoietin N-glycosylated 13 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17155VX. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G17155VX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051794", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051794" } ] }, { "name": "erythropoietin N-glycosylated 14 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051795", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051795" } ] }, { "name": "erythropoietin N-glycosylated 15 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G18938DW. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G18938DW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051796", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051796" } ] }, { "name": "erythropoietin N-glycosylated 16 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G20218ZS. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G20218ZS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051797", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051797" } ] }, { "name": "erythropoietin N-glycosylated 17 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G25392ZR. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G25392ZR. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051798", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051798" } ] }, { "name": "erythropoietin N-glycosylated 18 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G26777RD. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G26777RD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051799", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051799" } ] }, { "name": "erythropoietin N-glycosylated 19 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G27844UM. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G27844UM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051800", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051800" } ] }, { "name": "erythropoietin N-glycosylated 20 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051801", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051801" } ] }, { "name": "erythropoietin N-glycosylated 21 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G30460NZ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G30460NZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051802", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051802" } ] }, { "name": "erythropoietin N-glycosylated 22 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G33284WZ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G33284WZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051803", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051803" } ] }, { "name": "erythropoietin N-glycosylated 23 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051804", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051804" } ] }, { "name": "erythropoietin N-glycosylated 24 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40027VO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G40027VO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051805", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051805" } ] }, { "name": "erythropoietin N-glycosylated 25 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40194MN. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G40194MN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051806", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051806" } ] }, { "name": "erythropoietin N-glycosylated 26 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G43761WH. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G43761WH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051807", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051807" } ] }, { "name": "erythropoietin N-glycosylated 27 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051808", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051808" } ] }, { "name": "erythropoietin N-glycosylated 28 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G47279LF. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G47279LF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051809", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051809" } ] }, { "name": "erythropoietin N-glycosylated 29 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G48109OV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G48109OV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051810", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051810" } ] }, { "name": "erythropoietin N-glycosylated 30 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G49446SO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G49446SO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051811", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051811" } ] }, { "name": "erythropoietin N-glycosylated 31 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50489VC. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G50489VC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051812", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051812" } ] }, { "name": "erythropoietin N-glycosylated 32 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50888WV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G50888WV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051813", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051813" } ] }, { "name": "erythropoietin N-glycosylated 33 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G51057KO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G51057KO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051814", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051814" } ] }, { "name": "erythropoietin N-glycosylated 34 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051815", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051815" } ] }, { "name": "erythropoietin N-glycosylated 35 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G56516KW. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G56516KW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051816", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051816" } ] }, { "name": "erythropoietin N-glycosylated 36 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62619LG. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G62619LG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051817", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051817" } ] }, { "name": "erythropoietin N-glycosylated 37 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62765SF. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G62765SF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051818", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051818" } ] }, { "name": "erythropoietin N-glycosylated 38 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051819", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051819" } ] }, { "name": "erythropoietin N-glycosylated 39 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G67610NV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G67610NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051820", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051820" } ] }, { "name": "erythropoietin N-glycosylated 40 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G68892PJ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G68892PJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051821", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051821" } ] }, { "name": "erythropoietin N-glycosylated 41 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G71549MK. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G71549MK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051822", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051822" } ] }, { "name": "erythropoietin N-glycosylated 42 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G74859XI. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G74859XI. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051823", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051823" } ] }, { "name": "erythropoietin N-glycosylated 43 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G75520NV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G75520NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051824", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051824" } ] }, { "name": "erythropoietin N-glycosylated 44 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051825", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051825" } ] }, { "name": "erythropoietin N-glycosylated 45 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051826", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051826" } ] }, { "name": "erythropoietin N-glycosylated 46 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G80537QW. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G80537QW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051827", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051827" } ] }, { "name": "erythropoietin N-glycosylated 47 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G81107PN. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G81107PN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051828", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051828" } ] }, { "name": "erythropoietin N-glycosylated 48 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G82410AF. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G82410AF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051829", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051829" } ] }, { "name": "erythropoietin N-glycosylated 49 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G84390MS. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G84390MS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051830", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051830" } ] }, { "name": "erythropoietin N-glycosylated 50 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051831", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051831" } ] }, { "name": "erythropoietin N-glycosylated 51 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86696LV. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G86696LV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051832", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051832" } ] }, { "name": "erythropoietin N-glycosylated 52 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86753CK. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G86753CK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051833", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051833" } ] }, { "name": "erythropoietin N-glycosylated 53 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G88696CU. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G88696CU. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051834", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051834" } ] }, { "name": "erythropoietin N-glycosylated 54 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G90784AP. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G90784AP. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051835", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051835" } ] }, { "name": "erythropoietin N-glycosylated 55 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051836", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051836" } ] }, { "name": "erythropoietin N-glycosylated 56 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91905FJ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G91905FJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051837", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051837" } ] }, { "name": "erythropoietin N-glycosylated 57 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92574YO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G92574YO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051838", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051838" } ] }, { "name": "erythropoietin N-glycosylated 58 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92709EO. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G92709EO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051839", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051839" } ] }, { "name": "erythropoietin N-glycosylated 59 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051840", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051840" } ] }, { "name": "erythropoietin N-glycosylated 60 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96503EZ. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G96503EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051841", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051841" } ] }, { "name": "erythropoietin N-glycosylated 61 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-110 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96719MC. Example: UniProtKB:P01588-1, Asn-110, MOD:00160~GNO:G96719MC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051842", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051842" } ] }, { "name": "erythropoietin N-glycosylated 62 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G00551JZ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G00551JZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051843", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051843" } ] }, { "name": "erythropoietin N-glycosylated 63 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02311IE. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G02311IE. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051844", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051844" } ] }, { "name": "erythropoietin N-glycosylated 64 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02561FC. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G02561FC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051845", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051845" } ] }, { "name": "erythropoietin N-glycosylated 65 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G09176OA. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G09176OA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051846", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051846" } ] }, { "name": "erythropoietin N-glycosylated 66 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G10228OD. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G10228OD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051847", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051847" } ] }, { "name": "erythropoietin N-glycosylated 67 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G12436UO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G12436UO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051848", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051848" } ] }, { "name": "erythropoietin N-glycosylated 68 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G13282WA. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G13282WA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051849", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051849" } ] }, { "name": "erythropoietin N-glycosylated 69 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16529MG. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G16529MG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051850", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051850" } ] }, { "name": "erythropoietin N-glycosylated 70 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16873YG. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G16873YG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051851", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051851" } ] }, { "name": "erythropoietin N-glycosylated 71 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17155VX. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G17155VX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051852", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051852" } ] }, { "name": "erythropoietin N-glycosylated 72 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051853", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051853" } ] }, { "name": "erythropoietin N-glycosylated 73 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G18938DW. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G18938DW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051854", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051854" } ] }, { "name": "erythropoietin N-glycosylated 74 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G20218ZS. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G20218ZS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051855", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051855" } ] }, { "name": "erythropoietin N-glycosylated 75 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G25392ZR. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G25392ZR. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051856", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051856" } ] }, { "name": "erythropoietin N-glycosylated 76 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G27844UM. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G27844UM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051857", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051857" } ] }, { "name": "erythropoietin N-glycosylated 77 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051858", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051858" } ] }, { "name": "erythropoietin N-glycosylated 78 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G30460NZ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G30460NZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051859", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051859" } ] }, { "name": "erythropoietin N-glycosylated 79 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G33284WZ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G33284WZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051860", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051860" } ] }, { "name": "erythropoietin N-glycosylated 80 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051861", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051861" } ] }, { "name": "erythropoietin N-glycosylated 81 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40027VO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G40027VO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051862", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051862" } ] }, { "name": "erythropoietin N-glycosylated 82 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40194MN. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G40194MN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051863", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051863" } ] }, { "name": "erythropoietin N-glycosylated 83 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G43761WH. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G43761WH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051864", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051864" } ] }, { "name": "erythropoietin N-glycosylated 84 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051865", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051865" } ] }, { "name": "erythropoietin N-glycosylated 85 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G47279LF. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G47279LF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051866", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051866" } ] }, { "name": "erythropoietin N-glycosylated 86 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G48109OV. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G48109OV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051867", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051867" } ] }, { "name": "erythropoietin N-glycosylated 87 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G49446SO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G49446SO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051868", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051868" } ] }, { "name": "erythropoietin N-glycosylated 88 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50489VC. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G50489VC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051869", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051869" } ] }, { "name": "erythropoietin N-glycosylated 89 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50888WV. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G50888WV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051870", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051870" } ] }, { "name": "erythropoietin N-glycosylated 90 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G51057KO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G51057KO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051871", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051871" } ] }, { "name": "erythropoietin N-glycosylated 91 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051872", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051872" } ] }, { "name": "erythropoietin N-glycosylated 92 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G56516KW. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G56516KW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051873", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051873" } ] }, { "name": "erythropoietin N-glycosylated 93 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62619LG. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G62619LG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051874", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051874" } ] }, { "name": "erythropoietin N-glycosylated 94 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62765SF. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G62765SF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051875", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051875" } ] }, { "name": "erythropoietin N-glycosylated 95 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051876", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051876" } ] }, { "name": "erythropoietin N-glycosylated 96 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G67610NV. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G67610NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051877", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051877" } ] }, { "name": "erythropoietin N-glycosylated 97 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G68892PJ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G68892PJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051878", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051878" } ] }, { "name": "erythropoietin N-glycosylated 98 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G74859XI. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G74859XI. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051879", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051879" } ] }, { "name": "erythropoietin N-glycosylated 99 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G75520NV. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G75520NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051880", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051880" } ] }, { "name": "erythropoietin N-glycosylated 100 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051881", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051881" } ] }, { "name": "erythropoietin N-glycosylated 101 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051882", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051882" } ] }, { "name": "erythropoietin N-glycosylated 102 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G80537QW. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G80537QW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051883", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051883" } ] }, { "name": "erythropoietin N-glycosylated 103 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G81107PN. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G81107PN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051884", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051884" } ] }, { "name": "erythropoietin N-glycosylated 104 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G82410AF. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G82410AF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051885", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051885" } ] }, { "name": "erythropoietin N-glycosylated 105 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G84390MS. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G84390MS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051886", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051886" } ] }, { "name": "erythropoietin N-glycosylated 106 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051887", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051887" } ] }, { "name": "erythropoietin N-glycosylated 107 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86696LV. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G86696LV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051888", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051888" } ] }, { "name": "erythropoietin N-glycosylated 108 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86753CK. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G86753CK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051889", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051889" } ] }, { "name": "erythropoietin N-glycosylated 109 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G88696CU. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G88696CU. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051890", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051890" } ] }, { "name": "erythropoietin N-glycosylated 110 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G90784AP. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G90784AP. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051891", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051891" } ] }, { "name": "erythropoietin N-glycosylated 111 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051892", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051892" } ] }, { "name": "erythropoietin N-glycosylated 112 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91905FJ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G91905FJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051893", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051893" } ] }, { "name": "erythropoietin N-glycosylated 113 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92574YO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G92574YO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051894", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051894" } ] }, { "name": "erythropoietin N-glycosylated 114 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92709EO. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G92709EO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051895", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051895" } ] }, { "name": "erythropoietin N-glycosylated 115 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051896", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051896" } ] }, { "name": "erythropoietin N-glycosylated 116 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96503EZ. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G96503EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051897", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051897" } ] }, { "name": "erythropoietin N-glycosylated 117 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-51 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96719MC. Example: UniProtKB:P01588-1, Asn-51, MOD:00160~GNO:G96719MC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051898", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051898" } ] }, { "name": "erythropoietin N-glycosylated 118 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G00551JZ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G00551JZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051899", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051899" } ] }, { "name": "erythropoietin N-glycosylated 119 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02311IE. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G02311IE. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051900", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051900" } ] }, { "name": "erythropoietin N-glycosylated 120 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G02561FC. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G02561FC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051901", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051901" } ] }, { "name": "erythropoietin N-glycosylated 121 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G09176OA. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G09176OA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051902", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051902" } ] }, { "name": "erythropoietin N-glycosylated 122 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G10228OD. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G10228OD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051903", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051903" } ] }, { "name": "erythropoietin N-glycosylated 123 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G12436UO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G12436UO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051904", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051904" } ] }, { "name": "erythropoietin N-glycosylated 124 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G13282WA. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G13282WA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051905", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051905" } ] }, { "name": "erythropoietin N-glycosylated 125 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16529MG. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G16529MG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051906", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051906" } ] }, { "name": "erythropoietin N-glycosylated 126 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G16873YG. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G16873YG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051907", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051907" } ] }, { "name": "erythropoietin N-glycosylated 127 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17155VX. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G17155VX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051908", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051908" } ] }, { "name": "erythropoietin N-glycosylated 128 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051909", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051909" } ] }, { "name": "erythropoietin N-glycosylated 129 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G18938DW. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G18938DW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051910", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051910" } ] }, { "name": "erythropoietin N-glycosylated 130 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G20218ZS. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G20218ZS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051911", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051911" } ] }, { "name": "erythropoietin N-glycosylated 131 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G25392ZR. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G25392ZR. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051912", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051912" } ] }, { "name": "erythropoietin N-glycosylated 132 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G27844UM. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G27844UM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051913", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051913" } ] }, { "name": "erythropoietin N-glycosylated 133 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G29857RC. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G29857RC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051914", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051914" } ] }, { "name": "erythropoietin N-glycosylated 134 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G30460NZ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G30460NZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051915", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051915" } ] }, { "name": "erythropoietin N-glycosylated 135 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G33284WZ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G33284WZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051916", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051916" } ] }, { "name": "erythropoietin N-glycosylated 136 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051917", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051917" } ] }, { "name": "erythropoietin N-glycosylated 137 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40027VO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G40027VO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051918", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051918" } ] }, { "name": "erythropoietin N-glycosylated 138 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G40194MN. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G40194MN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051919", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051919" } ] }, { "name": "erythropoietin N-glycosylated 139 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G43761WH. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G43761WH. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051920", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051920" } ] }, { "name": "erythropoietin N-glycosylated 140 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051921", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051921" } ] }, { "name": "erythropoietin N-glycosylated 141 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G47279LF. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G47279LF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051922", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051922" } ] }, { "name": "erythropoietin N-glycosylated 142 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G48109OV. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G48109OV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051923", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051923" } ] }, { "name": "erythropoietin N-glycosylated 143 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G49446SO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G49446SO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051924", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051924" } ] }, { "name": "erythropoietin N-glycosylated 144 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50489VC. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G50489VC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051925", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051925" } ] }, { "name": "erythropoietin N-glycosylated 145 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G50888WV. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G50888WV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051926", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051926" } ] }, { "name": "erythropoietin N-glycosylated 146 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G51057KO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G51057KO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051927", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051927" } ] }, { "name": "erythropoietin N-glycosylated 147 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G53752TA. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G53752TA. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051928", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051928" } ] }, { "name": "erythropoietin N-glycosylated 148 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G56516KW. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G56516KW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051929", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051929" } ] }, { "name": "erythropoietin N-glycosylated 149 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62619LG. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G62619LG. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051930", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051930" } ] }, { "name": "erythropoietin N-glycosylated 150 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G62765SF. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G62765SF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051931", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051931" } ] }, { "name": "erythropoietin N-glycosylated 151 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051932", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051932" } ] }, { "name": "erythropoietin N-glycosylated 152 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G67610NV. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G67610NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051933", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051933" } ] }, { "name": "erythropoietin N-glycosylated 153 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G68892PJ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G68892PJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051934", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051934" } ] }, { "name": "erythropoietin N-glycosylated 154 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G74859XI. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G74859XI. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051935", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051935" } ] }, { "name": "erythropoietin N-glycosylated 155 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G75520NV. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G75520NV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051936", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051936" } ] }, { "name": "erythropoietin N-glycosylated 156 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051937", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051937" } ] }, { "name": "erythropoietin N-glycosylated 157 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G79809MM. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G79809MM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051938", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051938" } ] }, { "name": "erythropoietin N-glycosylated 158 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G80537QW. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G80537QW. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051939", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051939" } ] }, { "name": "erythropoietin N-glycosylated 159 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G81107PN. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G81107PN. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051940", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051940" } ] }, { "name": "erythropoietin N-glycosylated 160 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G82410AF. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G82410AF. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051941", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051941" } ] }, { "name": "erythropoietin N-glycosylated 161 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G84390MS. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G84390MS. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051942", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051942" } ] }, { "name": "erythropoietin N-glycosylated 162 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051943", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051943" } ] }, { "name": "erythropoietin N-glycosylated 163 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86696LV. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G86696LV. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051944", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051944" } ] }, { "name": "erythropoietin N-glycosylated 164 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G86753CK. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G86753CK. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051945", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051945" } ] }, { "name": "erythropoietin N-glycosylated 165 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G88696CU. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G88696CU. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051946", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051946" } ] }, { "name": "erythropoietin N-glycosylated 166 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G90784AP. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G90784AP. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051947", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051947" } ] }, { "name": "erythropoietin N-glycosylated 167 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91413ZX. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G91413ZX. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051948", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051948" } ] }, { "name": "erythropoietin N-glycosylated 168 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G91905FJ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G91905FJ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051949", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051949" } ] }, { "name": "erythropoietin N-glycosylated 169 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92574YO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G92574YO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051950", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051950" } ] }, { "name": "erythropoietin N-glycosylated 170 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G92709EO. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G92709EO. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051951", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051951" } ] }, { "name": "erythropoietin N-glycosylated 171 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G94531EZ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G94531EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051952", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051952" } ] }, { "name": "erythropoietin N-glycosylated 172 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96503EZ. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G96503EZ. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051953", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051953" } ] }, { "name": "erythropoietin N-glycosylated 173 (human)", "definition": "An erythropoietin (human) that has been N-glycosylated at the residue equivalent to Asn-65 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G96719MC. Example: UniProtKB:P01588-1, Asn-65, MOD:00160~GNO:G96719MC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051954", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051954" } ] }, { "name": "erythropoietin O-glycosylated 1 (human)", "definition": "An erythropoietin (human) that has been O-glycosylated at the residue equivalent to Ser-153 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P01588-1, Ser-153, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:22678432]", "evidence": [ { "id": "PR:000051955", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051955" } ] }, { "name": "erythropoietin O-glycosylated 2 (human)", "definition": "An erythropoietin (human) that has been O-glycosylated at the residue equivalent to Ser-153 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G01614ZM. Example: UniProtKB:P01588-1, Ser-153, MOD:00002~GNO:G01614ZM. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051956", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051956" } ] }, { "name": "erythropoietin O-glycosylated 3 (human)", "definition": "An erythropoietin (human) that has been O-glycosylated at the residue equivalent to Ser-153 of the amino acid sequence represented by UniProtKB:P01588-1, in which the glycan structure is represented by GlyTouCan:G56682BC. Example: UniProtKB:P01588-1, Ser-153, MOD:00002~GNO:G56682BC. [PRO:DNx, PMID:10764840, PMID:11805077, PMID:2550193, PMID:2813359, PMID:3179269, PMID:8460945, PMID:8477709]", "evidence": [ { "id": "PR:000051957", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000051957" } ] } ], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 51, "end_pos": 53, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 51, 65, 110 ], "o_linked_sites": [ 153 ], "snv_sites": [ 53 ], "glycation_sites": [], "phosphorylation_sites": [ 111, 127 ], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 51, "end_pos": 53 }, { "start_pos": 65, "end_pos": 67 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 480 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 190 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 19 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 476 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 190 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 19 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 106 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }