{ "uniprot_canonical_ac": "P01583-1", "uniprot_ac": "P01583", "uniprot_id": "IL1A_HUMAN", "mass": { "chemical_mass": 30607.0, "monoisotopic_mass": 30607.0 }, "refseq": { "ac": "NP_000566", "name": "interleukin-1 alpha precursor", "summary": "The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, "gene_names": [ { "name": "IL1A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P01583", "id": "P01583" }, { "name": "IL-1 alpha; IL-1A; IL1; IL1-ALPHA; IL1F1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566", "id": "NP_000566" }, { "name": "IL1A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566", "id": "NP_000566" }, { "name": "IL1F1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P01583", "id": "P01583" } ], "protein_names": [ { "name": "Interleukin-1 alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P01583" }, { "name": "Hematopoietin-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01583" }, { "name": "IL-1 alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P01583" }, { "name": "interleukin-1 alpha precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566", "id": "NP_000566" }, { "name": "preinterleukin 1 alpha; hematopoietin-1; pro-interleukin-1-alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566", "id": "NP_000566" } ], "function": [ { "annotation": "Association between Polymorphism of Genes IL-1A, NFKB1, PAR1, TP53, and UCP2 and Susceptibility to Non-Small Cell Lung Cancer in the Brazilian Amazon. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, { "database": "PubMed", "id": "36833388", "url": "https://glygen.org/publication/PubMed/36833388" } ] }, { "annotation": "Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems (PubMed:26439902). After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex (PubMed:2950091, PubMed:17507369). Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4 (PubMed:17507369). In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways (PubMed:14687581). Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage (PubMed:15679580). In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as a signal for genotoxic stress without loss of cell integrity (PubMed:26439902).", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583#function" }, { "database": "PubMed", "id": "26439902", "url": "https://glygen.org/publication/PubMed/26439902" }, { "database": "PubMed", "id": "3258335", "url": "https://glygen.org/publication/PubMed/3258335" }, { "database": "PubMed", "id": "2950091", "url": "https://glygen.org/publication/PubMed/2950091" }, { "database": "PubMed", "id": "14687581", "url": "https://glygen.org/publication/PubMed/14687581" }, { "database": "PubMed", "id": "17507369", "url": "https://glygen.org/publication/PubMed/17507369" }, { "database": "PubMed", "id": "15679580", "url": "https://glygen.org/publication/PubMed/15679580" } ] }, { "annotation": "IFI16 Induced by Direct Interaction between Esophageal Squamous Cell Carcinomas and Macrophages Promotes Tumor Progression via Secretion of IL-1alpha. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, { "database": "PubMed", "id": "37998338", "url": "https://glygen.org/publication/PubMed/37998338" } ] }, { "annotation": "Interleukin 1alpha and interleukin 18 in patients with vitiligo - Results of a case-control study.", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, { "database": "PubMed", "id": "36739764", "url": "https://glygen.org/publication/PubMed/36739764" } ] }, { "annotation": "Role of ErbB and IL-1 signaling pathways in the dermonecrotic lesion induced by Loxosceles sphingomyelinases D.", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, { "database": "PubMed", "id": "37707622", "url": "https://glygen.org/publication/PubMed/37707622" } ] }, { "annotation": "Serum interleukin-1 is a new biomarker to predict the risk of rebleeding of ruptured intracranial aneurysm after admission. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" }, { "database": "PubMed", "id": "37195327", "url": "https://glygen.org/publication/PubMed/37195327" } ] }, { "annotation": "The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs79919093", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79919093" }, { "id": "rs79919093", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs79919093" }, { "id": "rs79919093", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79919093" }, { "id": "rs79919093", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs79919093#frequency_tab" }, { "id": "rs79919093", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs79919093" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 102, "end_pos": 102, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->SDS).", "chr_id": "2", "chr_pos": "112781618", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N102", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1304599072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1304599072" }, { "id": "rs1304599072", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1304599072" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 127, "end_pos": 127, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NFM->NFT).", "chr_id": "2", "chr_pos": "112779606", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M127", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766602023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766602023" }, { "id": "rs766602023", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766602023" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 139, "end_pos": 139, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "2", "chr_pos": "112779571", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A139", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs190193834", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs190193834" }, { "id": "rs190193834", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs190193834" }, { "id": "rs190193834", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs190193834" }, { "id": "rs190193834", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs190193834#frequency_tab" }, { "id": "rs190193834", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs190193834" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->SQS).", "chr_id": "2", "chr_pos": "112779564", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1372188181", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1372188181" }, { "id": "rs1372188181", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1372188181#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 141, "end_pos": 141, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->YQS).", "chr_id": "2", "chr_pos": "112779565", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N141", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1048278740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1048278740" }, { "id": "rs1048278740", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1048278740#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 143, "end_pos": 143, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->NQR).", "chr_id": "2", "chr_pos": "112779557", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S143", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1391872788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1391872788" }, { "id": "rs1391872788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1391872788#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 217, "end_pos": 217, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SET->NET).", "chr_id": "2", "chr_pos": "112775233", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S217", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755667464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755667464" }, { "id": "rs755667464", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755667464" }, { "id": "rs755667464", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755667464" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "2", "chr_pos": "112782747", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S22", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 82, "end_pos": 82, "sequence_org": "K", "sequence_mut": "Q", "comment": "About 50% loss of cytokine secretion after DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "PubMed", "id": "26439902", "url": "https://glygen.org/publication/PubMed/26439902" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "46.47", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "87.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "27.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "56.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "61.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "43.84", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "34.53", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "28.17", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "33.52", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01583", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01583" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "common_name": "Human" } ], "gene": [ { "name": "IL1A", "url": "https://www.uniprot.org/uniprot/P01583", "locus": { "chromosome": "2", "start_pos": 112773925, "end_pos": 112784493, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000115008", "url": "https://www.ensembl.org/id/ENSG00000115008" } ] } } ], "crossref": [ { "id": "ENSG00000115008", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000115008", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00100", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00100", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3580496", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3580496", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "IL1A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IL1A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3552", "url": "https://www.ncbi.nlm.nih.gov/gene/3552", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5991", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=5991", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P01583", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01583*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000975", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000975", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003295", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003295", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008996", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008996", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020877", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020877", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3552", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3552", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "147760", "url": "http://www.omim.org/entry/147760", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P01583", "url": "https://www.nextprot.org/entry/NX_P01583", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "SNMKYNF", "url": "https://omabrowser.org/oma/group/SNMKYNF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4640109at2759", "url": "http://www.orthodb.org/?query=4640109at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10078", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10078", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10078:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10078:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2ILA", "url": "https://www.rcsb.org/structure/2ILA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KKI", "url": "https://www.rcsb.org/structure/2KKI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L5X", "url": "https://www.rcsb.org/structure/2L5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UC6", "url": "https://www.rcsb.org/structure/5UC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00340", "url": "http://pfam.xfam.org/family/PF00340", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02394", "url": "http://pfam.xfam.org/family/PF02394", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P01583", "url": "https://pharos.nih.gov/targets/P01583", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P01583", "url": "http://purl.obolibrary.org/obo/PR_P01583", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01583-1", "url": "https://www.uniprot.org/uniprot/P01583-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA", "length": 271, "header": "sp|P01583-1|IL1A_HUMAN Isoform 1 of Interleukin-1 alpha OS=Homo sapiens OX=9606 GN=IL1A PE=1 SV=1 CANONICAL=P01583-1" }, "isoforms": [ { "isoform_ac": "P01583-1", "url": "", "sequence": { "sequence": "MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA", "length": 271, "header": "sp|P01583-1|IL1A_HUMAN Isoform 1 of Interleukin-1 alpha OS=Homo sapiens OX=9606 GN=IL1A PE=1 SV=1 CANONICAL=P01583-1" }, "locus": { "chromosome": "2", "start_pos": 112783770, "end_pos": 112775070, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000263339.4", "url": "https://www.ensembl.org/id/ENST00000263339.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000263339.3", "url": "https://www.ensembl.org/id/ENSP00000263339.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "P01583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01583#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 141, "start_aa": "Asn", "end_pos": 141, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn141", "evidence": [ { "id": "P01583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01583#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "iPTMnet", "id": "P01583", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01583" }, { "database": "PubMed", "id": "3126184", "url": "https://glygen.org/publication/PubMed/3126184" } ], "site_lbl": "Ser87" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Inducible degradation of IkappaBalpha by the proteasome requires interaction with the F-box protein h-betaTrCP.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kroll M, Margottin F, Kohl A, Renard P, Durand H, Concordet JP, Bachelerie F, Arenzana-Seisdedos F, Benarous R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10075690", "url": "https://glygen.org/publication/PubMed/10075690" } ] }, { "title": "Modulation of formyl peptide receptor expression by IL-10 in human monocytes and neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Thivierge M, Parent JL, Stankova J, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10092818", "url": "https://glygen.org/publication/PubMed/10092818" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Regulation of macrophage chemokine expression by lipopolysaccharide in vitro and in vivo.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Kopydlowski KM, Salkowski CA, Cody MJ, van Rooijen N, Major J, Hamilton TA, Vogel SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10415057", "url": "https://glygen.org/publication/PubMed/10415057" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "The interleukin-10 signal transduction pathway and regulation of gene expression in mononuclear phagocytes.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "1999", "authors": "Donnelly RP, Dickensheets H, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "10433356", "url": "https://glygen.org/publication/PubMed/10433356" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "Molecular dissection of the interactions among IkappaBalpha, FWD1, and Skp1 required for ubiquitin-mediated proteolysis of IkappaBalpha.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hattori K, Hatakeyama S, Shirane M, Matsumoto M, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10514433", "url": "https://glygen.org/publication/PubMed/10514433" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.", "journal": "Nature cell biology", "date": "2000", "authors": "Burns K, Clatworthy J, Martin L, Martinon F, Plumpton C, Maschera B, Lewis A, Ray K, Tschopp J, Volpe F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10854325", "url": "https://glygen.org/publication/PubMed/10854325" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.", "journal": "Molecular cell", "date": "2000", "authors": "Takaesu G, Kishida S, Hiyama A, Yamaguchi K, Shibuya H, Irie K, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10882101", "url": "https://glygen.org/publication/PubMed/10882101" } ] }, { "title": "SCF(beta-TRCP) and phosphorylation dependent ubiquitinationof I kappa B alpha catalyzed by Ubc3 and Ubc4.", "journal": "Oncogene", "date": "2000", "authors": "Strack P, Caligiuri M, Pelletier M, Boisclair M, Theodoras A, Beer-Romero P, Glass S, Parsons T, Copeland RA, Auger KR, Benfield P, Brizuela L, Rolfe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "10918611", "url": "https://glygen.org/publication/PubMed/10918611" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Physiologic role of interleukin-1 receptor antagonist.", "journal": "Arthritis research", "date": "2000", "authors": "Arend WP, Gabay C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "11094434", "url": "https://glygen.org/publication/PubMed/11094434" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "Differential assembly of rat purinergic P2X7 receptor in immune cells of the brain and periphery.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kim M, Spelta V, Sim J, North RA, Surprenant A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "11313357", "url": "https://glygen.org/publication/PubMed/11313357" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "IRAK-4: a novel member of the IRAK family with the properties of an IRAK-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Li S, Strelow A, Fontana EJ, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "11960013", "url": "https://glygen.org/publication/PubMed/11960013" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "A sequence-based map of the nine genes of the human interleukin-1 cluster.", "journal": "Genomics", "date": "2002", "authors": "Nicklin Martin J H, Barton Jenny L, Nguyen Minh, FitzGerald Michael G, Duff Gordon W, Kornman Ken", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "11991722", "url": "https://glygen.org/publication/PubMed/11991722" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jiang Z, Johnson HJ, Nie H, Qin J, Bird TA, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12496252", "url": "https://glygen.org/publication/PubMed/12496252" } ] }, { "title": "Inhibition of interleukin 1 receptor/Toll-like receptor signaling through the alternatively spliced, short form of MyD88 is due to its failure to recruit IRAK-4.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Burns K, Janssens S, Brissoni B, Olivos N, Beyaert R, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12538665", "url": "https://glygen.org/publication/PubMed/12538665" } ] }, { "title": "New microRNAs from mouse and human.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Lagos-Quintana M, Rauhut R, Meyer J, Borkhardt A, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12554859", "url": "https://glygen.org/publication/PubMed/12554859" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Activation of STAT3 by IL-6 and IL-10 in primary human macrophages is differentially modulated by suppressor of cytokine signaling 3.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Niemand C, Nimmesgern A, Haan S, Fischer P, Schaper F, Rossaint R, Heinrich PC, Muller-Newen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12626585", "url": "https://glygen.org/publication/PubMed/12626585" } ] }, { "title": "Differential phosphorylation of the signal-responsive domain of I kappa B alpha and I kappa B beta by I kappa B kinases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wu C, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12791687", "url": "https://glygen.org/publication/PubMed/12791687" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "Characterization of Pellino2, a substrate of IRAK1 and IRAK4.", "journal": "FEBS letters", "date": "2003", "authors": "Strelow A, Kollewe C, Wesche H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "12860405", "url": "https://glygen.org/publication/PubMed/12860405" } ] }, { "title": "IL-10 stimulates monocyte Fc gamma R surface expression and cytotoxic activity. Distinct regulation of antibody-dependent cellular cytotoxicity by IFN-gamma, IL-4, and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1992", "authors": "te Velde AA, de Waal Malefijt R, Huijbens RJ, de Vries JE, Figdor CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1460289", "url": "https://glygen.org/publication/PubMed/1460289" } ] }, { "title": "Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kollewe C, Mackensen AC, Neumann D, Knop J, Cao P, Li S, Wesche H, Martin MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "14625308", "url": "https://glygen.org/publication/PubMed/14625308" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A(2) in primary human bronchial epithelial cells.", "journal": "Cytokine", "date": "2004-01-07", "authors": "Wu Tong, Han Chang, Shelhamer James H", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "14687581", "url": "https://glygen.org/publication/PubMed/14687581" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Induction of cytokine (interleukin-1alpha and tumor necrosis factor-alpha) and chemokine (CCL20, CCL27, and CXCL8) alarm signals after allergen and irritant exposure.", "journal": "Experimental dermatology", "date": "2005-02", "authors": "Spiekstra S W, Toebak M J, Sampat-Sardjoepersad S, van Beek P J, Boorsma D M, Stoof T J, von Blomberg B M E, Scheper R J, Bruynzeel D P, Rustemeyer T, Gibbs S", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "15679580", "url": "https://glygen.org/publication/PubMed/15679580" } ] }, { "title": "A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.", "journal": "Nature", "date": "1992", "authors": "Thornberry NA, Bull HG, Calaycay JR, Chapman KT, Howard AD, Kostura MJ, Miller DK, Molineaux SM, Weidner JR, Aunins J, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706" } ], "reference": [ { "type": "PubMed", "id": "1574116", "url": "https://glygen.org/publication/PubMed/1574116" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Pellino3 is a novel upstream regulator of p38 MAPK and activates CREB in a p38-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Butler MP, Hanly JA, Moynagh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "15917247", "url": "https://glygen.org/publication/PubMed/15917247" } ] }, { "title": "STAT3 nuclear import is independent of tyrosine phosphorylation and mediated by importin-alpha3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Liu L, McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "15919823", "url": "https://glygen.org/publication/PubMed/15919823" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "The potential role of DFNA5, a hearing impairment gene, in p53-mediated cellular response to DNA damage.", "journal": "Journal of human genetics", "date": "2006", "authors": "Masuda Y, Futamura M, Kamino H, Nakamura Y, Kitamura N, Ohnishi S, Miyamoto Y, Ichikawa H, Ohta T, Ohki M, Kiyono T, Egami H, Baba H, Arakawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "16897187", "url": "https://glygen.org/publication/PubMed/16897187" } ] }, { "title": "Conformational changes mediate interleukin-10 receptor 2 (IL-10R2) binding to IL-10 and assembly of the signaling complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yoon SI, Logsdon NJ, Sheikh F, Donnelly RP, Walter MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "16982608", "url": "https://glygen.org/publication/PubMed/16982608" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "Regulation of IRAK-4 kinase activity via autophosphorylation within its activation loop.", "journal": "Biochemical and biophysical research communications", "date": "2007", "authors": "Cheng H, Addona T, Keshishian H, Dahlstrand E, Lu C, Dorsch M, Li Z, Wang A, Ocain TD, Li P, Parsons TF, Jaffee B, Xu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17141195", "url": "https://glygen.org/publication/PubMed/17141195" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "Mass spectrometric analysis of the endogenous type I interleukin-1 (IL-1) receptor signaling complex formed after IL-1 binding identifies IL-1RAcP, MyD88, and IRAK-4 as the stable components.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Brikos C, Wait R, Begum S, O'Neill LA, Saklatvala J", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17507369", "url": "https://glygen.org/publication/PubMed/17507369" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Nonclassical IL-1 beta secretion stimulated by P2X7 receptors is dependent on inflammasome activation and correlated with exosome release in murine macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Qu Y, Franchi L, Nunez G, Dubyak GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706" } ], "reference": [ { "type": "PubMed", "id": "17641058", "url": "https://glygen.org/publication/PubMed/17641058" } ] }, { "title": "Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Butler MP, Hanly JA, Moynagh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17675297", "url": "https://glygen.org/publication/PubMed/17675297" } ] }, { "title": "IRAK1: a critical signaling mediator of innate immunity.", "journal": "Cellular signalling", "date": "2008", "authors": "Gottipati S, Rao NL, Fung-Leung WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17890055", "url": "https://glygen.org/publication/PubMed/17890055" } ] }, { "title": "Polymorphisms in apoptosis- and proliferation-related genes, ionizing radiation exposure, and risk of breast cancer among U.S. Radiologic Technologists.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2007", "authors": "Sigurdson AJ, Bhatti P, Doody MM, Hauptmann M, Bowen L, Simon SL, Weinstock RM, Linet MS, Rosenstein M, Stovall M, Alexander BH, Preston DL, Struewing JP, Rajaraman P", "evidence": [ { "database": "Entrez", "id": "3552", "url": "https://www.ncbi.nlm.nih.gov/gene/3552" } ], "reference": [ { "type": "PubMed", "id": "17932347", "url": "https://glygen.org/publication/PubMed/17932347" } ] }, { "title": "The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.", "journal": "The Biochemical journal", "date": "2008", "authors": "Ordureau A, Smith H, Windheim M, Peggie M, Carrick E, Morrice N, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "17997719", "url": "https://glygen.org/publication/PubMed/17997719" } ] }, { "title": "TRAF6 distinctively mediates MyD88- and IRAK-1-induced activation of NF-kappaB.", "journal": "Journal of leukocyte biology", "date": "2008", "authors": "Muroi M, Tanamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18070982", "url": "https://glygen.org/publication/PubMed/18070982" } ] }, { "title": "Interleukin-1 (IL-1) induces the Lys63-linked polyubiquitination of IL-1 receptor-associated kinase 1 to facilitate NEMO binding and the activation of IkappaBalpha kinase.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Windheim M, Stafford M, Peggie M, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18180283", "url": "https://glygen.org/publication/PubMed/18180283" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "Interleukin-1 (IL-1) receptor antagonist binds to the 80-kDa IL-1 receptor but does not initiate IL-1 signal transduction.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dripps DJ, Brandhuber BJ, Thompson RC, Eisenberg SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "1828071", "url": "https://glygen.org/publication/PubMed/1828071" } ] }, { "title": "A novel IL-1 receptor, cloned from B cells by mammalian expression, is expressed in many cell types.", "journal": "The EMBO journal", "date": "1991", "authors": "McMahan CJ, Slack JL, Mosley B, Cosman D, Lupton SD, Brunton LL, Grubin CE, Wignall JM, Jenkins NA, Brannan CI, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "1833184", "url": "https://glygen.org/publication/PubMed/1833184" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.", "journal": "Nature immunology", "date": "2008", "authors": "Kawagoe T, Sato S, Matsushita K, Kato H, Matsui K, Kumagai Y, Saitoh T, Kawai T, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "18438411", "url": "https://glygen.org/publication/PubMed/18438411" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "Identification of the phosphorylation sites on the E3 ubiquitin ligase Pellino that are critical for activation by IRAK1 and IRAK4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Smith H, Peggie M, Campbell DG, Vandermoere F, Carrick E, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "19264966", "url": "https://glygen.org/publication/PubMed/19264966" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "IL-10 inhibits cytokine production by activated macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1991", "authors": "Fiorentino DF, Zlotnik A, Mosmann TR, Howard M, O'Garra A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940369", "url": "https://glygen.org/publication/PubMed/1940369" } ] }, { "title": "Interleukin 10(IL-10) inhibits cytokine synthesis by human monocytes: an autoregulatory role of IL-10 produced by monocytes.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "de Waal Malefyt R, Abrams J, Bennett B, Figdor CG, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "1940799", "url": "https://glygen.org/publication/PubMed/1940799" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "Genomic screening for genes upregulated by demethylation revealed novel targets of epigenetic silencing in breast cancer.", "journal": "Breast cancer research and treatment", "date": "2010", "authors": "Fujikane T, Nishikawa N, Toyota M, Suzuki H, Nojima M, Maruyama R, Ashida M, Ohe-Toyota M, Kai M, Nishidate T, Sasaki Y, Ohmura T, Hirata K, Tokino T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "19859801", "url": "https://glygen.org/publication/PubMed/19859801" } ] }, { "title": "PB1 domain interaction of p62/sequestosome 1 and MEKK3 regulates NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Nakamura K, Kimple AJ, Siderovski DP, Johnson GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "19903815", "url": "https://glygen.org/publication/PubMed/19903815" } ] }, { "title": "Cyclooxygenase-2 is a novel transcriptional target of the nuclear EGFR-STAT3 and EGFRvIII-STAT3 signaling axes.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Lo HW, Cao X, Zhu H, Ali-Osman F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "20145033", "url": "https://glygen.org/publication/PubMed/20145033" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Identification of calcium-activated neutral protease as a processing enzyme of human interleukin 1 alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Kobayashi Y, Yamamoto K, Saido T, Kawasaki H, Oppenheim JJ, Matsushima K", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2115174", "url": "https://glygen.org/publication/PubMed/2115174" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Mohan Sepuru K, Yu Chin", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "21270123", "url": "https://glygen.org/publication/PubMed/21270123" } ] }, { "title": "Purification, cloning, expression and biological characterization of an interleukin-1 receptor antagonist protein.", "journal": "Nature", "date": "1990", "authors": "Carter DB, Deibel MR Jr, Dunn CJ, Tomich CS, Laborde AL, Slightom JL, Berger AE, Bienkowski MJ, Sun FF, McEwan RN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2139180", "url": "https://glygen.org/publication/PubMed/2139180" } ] }, { "title": "Natural and recombinant human IL-1 receptor antagonists block the effects of IL-1 on bone resorption and prostaglandin production.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1990", "authors": "Seckinger P, Klein-Nulend J, Alander C, Thompson RC, Dayer JM, Raisz LG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2147937", "url": "https://glygen.org/publication/PubMed/2147937" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Structure of interleukin 1 alpha at 2.7-A resolution.", "journal": "Biochemistry", "date": "1990", "authors": "Graves BJ, Hatada MH, Hendrickson WA, Miller JK, Madison VS, Satow Y", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2346741", "url": "https://glygen.org/publication/PubMed/2346741" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "Cutting edge: the NLRP3 inflammasome links complement-mediated inflammation and IL-1beta release.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2013", "authors": "Laudisi F, Spreafico R, Evrard M, Hughes TR, Mandriani B, Kandasamy M, Morgan BP, Sivasankar B, Mortellaro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "23817414", "url": "https://glygen.org/publication/PubMed/23817414" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "C3a modulates IL-1beta secretion in human monocytes by regulating ATP efflux and subsequent NLRP3 inflammasome activation.", "journal": "Blood", "date": "2013", "authors": "Asgari E, Le Friec G, Yamamoto H, Perucha E, Sacks SS, Kohl J, Cook HT, Kemper C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "23878142", "url": "https://glygen.org/publication/PubMed/23878142" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "IL-1beta production is dependent on the activation of purinergic receptors and NLRP3 pathway in human macrophages.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2015", "authors": "Gicquel T, Robert S, Loyer P, Victoni T, Bodin A, Ribault C, Gleonnec F, Couillin I, Boichot E, Lagente V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660826", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826" } ], "reference": [ { "type": "PubMed", "id": "26116704", "url": "https://glygen.org/publication/PubMed/26116704" } ] }, { "title": "Cloning of the cDNA coding for human prointerleukin-1 alpha and prointerleukin-1 beta.", "journal": "Dokl. Akad. Nauk SSSR", "date": "1989", "authors": "Kotenko S V, Bulenkov M T, Ve\u012dko V P, Epishin S M, Lomakin I B", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2635664", "url": "https://glygen.org/publication/PubMed/2635664" } ] }, { "title": "Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death.", "journal": "Nature", "date": "2015", "authors": "Shi J, Zhao Y, Wang K, Shi X, Wang Y, Huang H, Zhuang Y, Cai T, Wang F, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "26375003", "url": "https://glygen.org/publication/PubMed/26375003" } ] }, { "title": "IL-1alpha is a DNA damage sensor linking genotoxic stress signaling to sterile inflammation and innate immunity.", "journal": "Scientific reports", "date": "2015", "authors": "Cohen I, Rider P, Vornov E, Tomas M, Tudor C, Wegner M, Brondani L, Freudenberg M, Mittler G, Ferrando-May E, Dinarello CA, Apte RN, Schneider R", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "26439902", "url": "https://glygen.org/publication/PubMed/26439902" } ] }, { "title": "Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.", "journal": "Nature communications", "date": "2015", "authors": "Vigano E, Diamond CE, Spreafico R, Balachander A, Sobota RM, Mortellaro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "26508369", "url": "https://glygen.org/publication/PubMed/26508369" } ] }, { "title": "Pore-forming activity and structural autoinhibition of the gasdermin family.", "journal": "Nature", "date": "2016", "authors": "Ding J, Wang K, Liu W, She Y, Sun Q, Shi J, Sun H, Wang DC, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27281216", "url": "https://glygen.org/publication/PubMed/27281216" } ] }, { "title": "Inflammasome-activated gasdermin D causes pyroptosis by forming membrane pores.", "journal": "Nature", "date": "2016", "authors": "Liu X, Zhang Z, Ruan J, Pan Y, Magupalli VG, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27383986", "url": "https://glygen.org/publication/PubMed/27383986" } ] }, { "title": "GSDMD membrane pore formation constitutes the mechanism of pyroptotic cell death.", "journal": "The EMBO journal", "date": "2016", "authors": "Sborgi L, Ruhl S, Mulvihill E, Pipercevic J, Heilig R, Stahlberg H, Farady CJ, Muller DJ, Broz P, Hiller S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "27418190", "url": "https://glygen.org/publication/PubMed/27418190" } ] }, { "title": "Multicenter Study of a Novel Topical Interleukin-1 Receptor Inhibitor, Isunakinra, in Subjects With Moderate to Severe Dry Eye Disease.", "journal": "Eye & contact lens", "date": "2017", "authors": "Goldstein MH, Martel JR, Sall K, Goldberg DF, Abrams M, Rubin J, Sheppard J, Tauber J, Korenfeld M, Agahigian J, Durham TA, Furfine E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "27466718", "url": "https://glygen.org/publication/PubMed/27466718" } ] }, { "title": "Cleavage of DFNA5 by caspase-3 during apoptosis mediates progression to secondary necrotic/pyroptotic cell death.", "journal": "Nature communications", "date": "2017", "authors": "Rogers C, Fernandes-Alnemri T, Mayes L, Alnemri D, Cingolani G, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28045099", "url": "https://glygen.org/publication/PubMed/28045099" } ] }, { "title": "Pyroptosis and Apoptosis Pathways Engage in Bidirectional Crosstalk in Monocytes and Macrophages.", "journal": "Cell chemical biology", "date": "2017", "authors": "Taabazuing CY, Okondo MC, Bachovchin DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28392147", "url": "https://glygen.org/publication/PubMed/28392147" } ] }, { "title": "Chemotherapy drugs induce pyroptosis through caspase-3 cleavage of a gasdermin.", "journal": "Nature", "date": "2017", "authors": "Wang Y, Gao W, Shi X, Ding J, Liu W, He H, Wang K, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "28459430", "url": "https://glygen.org/publication/PubMed/28459430" } ] }, { "title": "Inflammatory Caspases: Activation and Cleavage of Gasdermin-D In Vitro and During Pyroptosis.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2018", "authors": "Zhao Y, Shi J, Shao F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29177860", "url": "https://glygen.org/publication/PubMed/29177860" } ] }, { "title": "The cell surface receptors for interleukin-1 alpha and interleukin-1 beta are identical.", "journal": "Nature", "date": "1986", "authors": "Dower SK, Kronheim SR, Hopp TP, Cantrell M, Deeley M, Gillis S, Henney CS, Urdal DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "2946959", "url": "https://glygen.org/publication/PubMed/2946959" } ] }, { "title": "The interleukin-1 receptor binds the human interleukin-1 alpha precursor but not the interleukin-1 beta precursor.", "journal": "The Journal of biological chemistry", "date": "1987-03-05", "authors": "Mosley B, Urdal D L, Prickett K S, Larsen A, Cosman D, Conlon P J, Gillis S, Dower S K", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2950091", "url": "https://glygen.org/publication/PubMed/2950091" } ] }, { "title": "Gasdermin D Exerts Anti-inflammatory Effects by Promoting Neutrophil Death.", "journal": "Cell reports", "date": "2018", "authors": "Kambara H, Liu F, Zhang X, Liu P, Bajrami B, Teng Y, Zhao L, Zhou S, Yu H, Zhou W, Silberstein LE, Cheng T, Han M, Xu Y, Luo HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29539421", "url": "https://glygen.org/publication/PubMed/29539421" } ] }, { "title": "Mechanism of gasdermin D recognition by inflammatory caspases and their inhibition by a gasdermin D-derived peptide inhibitor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Yang J, Liu Z, Wang C, Yang R, Rathkey JK, Pinkard OW, Shi W, Chen Y, Dubyak GR, Abbott DW, Xiao TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29891674", "url": "https://glygen.org/publication/PubMed/29891674" } ] }, { "title": "Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.", "journal": "Nature", "date": "1985", "authors": "March C J, Mosley B, Larsen A, Cerretti D P, Braedt G, Price V, Gillis S, Henney C S, Kronheim S R, Grabstein K", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2989698", "url": "https://glygen.org/publication/PubMed/2989698" } ] }, { "title": "Mechanism of membrane pore formation by human gasdermin-D.", "journal": "The EMBO journal", "date": "2018", "authors": "Mulvihill E, Sborgi L, Mari SA, Pfreundschuh M, Hiller S, Muller DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29898893", "url": "https://glygen.org/publication/PubMed/29898893" } ] }, { "title": "Cloning and characterization of the cDNAs for human and rabbit interleukin-1 precursor.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Furutani Y, Notake M, Yamayoshi M, Yamagishi J, Nomura H, Ohue M, Furuta R, Fukui T, Yamada M, Nakamura S", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "2994016", "url": "https://glygen.org/publication/PubMed/2994016" } ] }, { "title": "Mechanisms of Gasdermin Family Members in Inflammasome Signaling and Cell Death.", "journal": "Journal of molecular biology", "date": "2018", "authors": "Feng S, Fox D, Man SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "29990470", "url": "https://glygen.org/publication/PubMed/29990470" } ] }, { "title": "Gasdermin D plays a vital role in the generation of neutrophil extracellular traps.", "journal": "Science immunology", "date": "2018", "authors": "Sollberger G, Choidas A, Burn GL, Habenberger P, Di Lucrezia R, Kordes S, Menninger S, Eickhoff J, Nussbaumer P, Klebl B, Kruger R, Herzig A, Zychlinsky A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "30143555", "url": "https://glygen.org/publication/PubMed/30143555" } ] }, { "title": "Gasdermin pores permeabilize mitochondria to augment caspase-3 activation during apoptosis and inflammasome activation.", "journal": "Nature communications", "date": "2019", "authors": "Rogers C, Erkes DA, Nardone A, Aplin AE, Fernandes-Alnemri T, Alnemri ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "30976076", "url": "https://glygen.org/publication/PubMed/30976076" } ] }, { "title": "IRF2 transcriptionally induces GSDMD expression for pyroptosis.", "journal": "Science signaling", "date": "2019", "authors": "Kayagaki N, Lee BL, Stowe IB, Kornfeld OS, O'Rourke K, Mirrashidi KM, Haley B, Watanabe C, Roose-Girma M, Modrusan Z, Kummerfeld S, Reja R, Zhang Y, Cho V, Andrews TD, Morris LX, Goodnow CC, Bertram EM, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "31113851", "url": "https://glygen.org/publication/PubMed/31113851" } ] }, { "title": "The precursor of interleukin-1 alpha is phosphorylated at residue serine 90.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Beuscher HU, Nickells MW, Colten HR", "evidence": [ { "database": "iPTMnet", "id": "P01583", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01583" } ], "reference": [ { "type": "PubMed", "id": "3126184", "url": "https://glygen.org/publication/PubMed/3126184" } ] }, { "title": "Structural Mechanism for GSDMD Targeting by Autoprocessed Caspases in Pyroptosis.", "journal": "Cell", "date": "2020", "authors": "Wang K, Sun Q, Zhong X, Zeng M, Zeng H, Shi X, Li Z, Wang Y, Zhao Q, Shao F, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32109412", "url": "https://glygen.org/publication/PubMed/32109412" } ] }, { "title": "Gasdermin E suppresses tumour growth by activating anti-tumour immunity.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Zhang Y, Xia S, Kong Q, Li S, Liu X, Junqueira C, Meza-Sosa KF, Mok TMY, Ansara J, Sengupta S, Yao Y, Wu H, Lieberman J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32188940", "url": "https://glygen.org/publication/PubMed/32188940" } ] }, { "title": "A Translocation Pathway for Vesicle-Mediated Unconventional Protein Secretion.", "journal": "Cell", "date": "2020", "authors": "Zhang Min, Liu Lei, Lin Xubo, Wang Yang, Li Ying, Guo Qing, Li Shulin, Sun Yuxin, Tao Xuan, Zhang Di, Lv Xiachen, Zheng Li, Ge Liang", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "32272059", "url": "https://glygen.org/publication/PubMed/32272059" } ] }, { "title": "FDA-approved disulfiram inhibits pyroptosis by blocking gasdermin D pore formation.", "journal": "Nature immunology", "date": "2020", "authors": "Hu JJ, Liu X, Xia S, Zhang Z, Zhang Y, Zhao J, Ruan J, Luo X, Lou X, Bai Y, Wang J, Hollingsworth LR, Magupalli VG, Zhao L, Luo HR, Kim J, Lieberman J, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32367036", "url": "https://glygen.org/publication/PubMed/32367036" } ] }, { "title": "Phosphorylation of intracellular precursors of human IL-1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1988", "authors": "Kobayashi Y, Appella E, Yamada M, Copeland TD, Oppenheim JJ, Matsushima K", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "3258335", "url": "https://glygen.org/publication/PubMed/3258335" } ] }, { "title": "Effects of hematopoietin-1 and interleukin 1 activities on early hematopoietic cells of the bone marrow.", "journal": "Blood", "date": "1988", "authors": "Zsebo K M, Wypych J, Yuschenkoff V N, Lu H, Hunt P, Dukes P P, Langley K E", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "3281727", "url": "https://glygen.org/publication/PubMed/3281727" } ] }, { "title": "Succination inactivates gasdermin D and blocks pyroptosis.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Humphries F, Shmuel-Galia L, Ketelut-Carneiro N, Li S, Wang B, Nemmara VV, Wilson R, Jiang Z, Khalighinejad F, Muneeruddin K, Shaffer SA, Dutta R, Ionete C, Pesiridis S, Yang S, Thompson PR, Fitzgerald KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620971", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971" } ], "reference": [ { "type": "PubMed", "id": "32820063", "url": "https://glygen.org/publication/PubMed/32820063" } ] }, { "title": "Recombinant human interleukin 1 alpha: purification and biological characterization.", "journal": "J. Immunol.", "date": "1986", "authors": "Gubler U, Chua A O, Stern A S, Hellmann C P, Vitek M P, DeChiara T M, Benjamin W R, Collier K J, Dukovich M, Familletti P C", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "3485152", "url": "https://glygen.org/publication/PubMed/3485152" } ] }, { "title": "Complete nucleotide sequence of the gene for human interleukin 1 alpha.", "journal": "Nucleic Acids Res.", "date": "1986", "authors": "Furutani Y, Notake M, Fukui T, Ohue M, Nomura H, Yamada M, Nakamura S", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "3486405", "url": "https://glygen.org/publication/PubMed/3486405" } ] }, { "title": "cDNA cloning of IL-1 alpha and IL-1 beta from mRNA of U937 cell line.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1987", "authors": "Nishida T, Nishino N, Takano M, Kawai K, Bando K, Masui Y, Nakai S, Hirai Y", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "3493774", "url": "https://glygen.org/publication/PubMed/3493774" } ] }, { "title": "Interleukin 1\u03b1 and interleukin 18 in patients with vitiligo\u00a0- Results of a case-control study.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2023-04", "authors": "Nieradko-Iwanicka Barbara, Przybylska Daria, Borz\u0119cki Andrzej", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ], "reference": [ { "type": "PubMed", "id": "36739764", "url": "https://glygen.org/publication/PubMed/36739764" } ] }, { "title": "Association between Polymorphism of Genes IL-1A, NFKB1, PAR1, TP53, and UCP2 and Susceptibility to Non-Small Cell Lung Cancer in the Brazilian Amazon.", "journal": "Genes", "date": "2023-02-10", "authors": "Pereira Esdras E B, Modesto Ant\u00f4nio A C, Fernandes Bruno M, Burbano Rommel M R, Assump\u00e7\u00e3o Paulo P, Fernandes Marianne R, Guerreiro Jo\u00e3o F, Santos Sidney E B Dos, Santos Ney P C Dos", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ], "reference": [ { "type": "PubMed", "id": "36833388", "url": "https://glygen.org/publication/PubMed/36833388" } ] }, { "title": "Serum interleukin-1 is a new biomarker to predict the risk of rebleeding of ruptured intracranial aneurysm after admission.", "journal": "Neurosurgical review", "date": "2023-05-17", "authors": "Wen Zheng, Liu Qingyuan, Jiang Pengjun, Zhu Chengcheng, Li Jiangan, Wu Jun, Wang Shuo, Ning Bo", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ], "reference": [ { "type": "PubMed", "id": "37195327", "url": "https://glygen.org/publication/PubMed/37195327" } ] }, { "title": "Role of ErbB and IL-1 signaling pathways in the dermonecrotic lesion induced by Loxosceles sphingomyelinases D.", "journal": "Archives of toxicology", "date": "2023-12", "authors": "Pinto Bruna Fernandes, Lopes Priscila Hess, Trufen Carlos Eduardo Madureira, Ching Ana Tung Ching, De Azevedo In\u00e1cio de Loiola Meirelles Junqueira, Nishiyama Milton Yutaka, Pohl Paula Cristiane, Tambourgi Denise V", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ], "reference": [ { "type": "PubMed", "id": "37707622", "url": "https://glygen.org/publication/PubMed/37707622" } ] }, { "title": "IFI16 Induced by Direct Interaction between Esophageal Squamous Cell Carcinomas and Macrophages Promotes Tumor Progression via Secretion of IL-1\u03b1.", "journal": "Cells", "date": "2023-11-10", "authors": "Azumi Yuki, Koma Yu-Ichiro, Tsukamoto Shuichi, Kitamura Yu, Ishihara Nobuaki, Yamanaka Keitaro, Nakanishi Takashi, Miyako Shoji, Urakami Satoshi, Tanigawa Kohei, Kodama Takayuki, Nishio Mari, Shigeoka Manabu, Kakeji Yoshihiro, Yokozaki Hiroshi", "evidence": [ { "database": "RefSeq", "id": "NP_000566", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000566" } ], "reference": [ { "type": "PubMed", "id": "37998338", "url": "https://glygen.org/publication/PubMed/37998338" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interleukin-10 inhibits B7 and intercellular adhesion molecule-1 expression on human monocytes.", "journal": "European journal of immunology", "date": "1994", "authors": "Willems F, Marchant A, Delville JP, Gerard C, Delvaux A, Velu T, de Boer M, Goldman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512027", "url": "https://glygen.org/publication/PubMed/7512027" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "Interleukin 12 synergizes with B7/CD28 interaction in inducing efficient proliferation and cytokine production of human T cells.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Kubin M, Kamoun M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7516408", "url": "https://glygen.org/publication/PubMed/7516408" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "IL-10 induces the tyrosine phosphorylation of tyk2 and Jak1 and the differential assembly of STAT1 alpha and STAT3 complexes in human T cells and monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Finbloom DS, Winestock KD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7543512", "url": "https://glygen.org/publication/PubMed/7543512" } ] }, { "title": "IL-10 inhibits metalloproteinase and stimulates TIMP-1 production in human mononuclear phagocytes.", "journal": "The Journal of clinical investigation", "date": "1995", "authors": "Lacraz S, Nicod LP, Chicheportiche R, Welgus HG, Dayer JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7593617", "url": "https://glygen.org/publication/PubMed/7593617" } ] }, { "title": "Inhibition of macrophage inflammatory protein-1 alpha expression by IL-10. Differential sensitivities in human blood monocytes and alveolar macrophages.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Berkman N, John M, Roesems G, Jose PJ, Barnes PJ, Chung KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7594602", "url": "https://glygen.org/publication/PubMed/7594602" } ] }, { "title": "Signal-induced site-specific phosphorylation targets I kappa B alpha to the ubiquitin-proteasome pathway.", "journal": "Genes & development", "date": "1995", "authors": "Chen Z, Hagler J, Palombella VJ, Melandri F, Scherer D, Ballard D, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "7628694", "url": "https://glygen.org/publication/PubMed/7628694" } ] }, { "title": "Direct effects of IL-10 on subsets of human CD4+ T cell clones and resting T cells. Specific inhibition of IL-2 production and proliferation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Yssel H, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7684412", "url": "https://glygen.org/publication/PubMed/7684412" } ] }, { "title": "IL-10 inhibits macrophage costimulatory activity by selectively inhibiting the up-regulation of B7 expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Ding L, Linsley PS, Huang LY, Germain RN, Shevach EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7687627", "url": "https://glygen.org/publication/PubMed/7687627" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "de Waal Malefyt R, Figdor CG, Huijbens R, Mohan-Peterson S, Bennett B, Culpepper J, Dang W, Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "7902377", "url": "https://glygen.org/publication/PubMed/7902377" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "Crystal structure of the cysteine protease interleukin-1 beta-converting enzyme: a (p20/p10)2 homodimer.", "journal": "Cell", "date": "1994", "authors": "Walker NP, Talanian RV, Brady KD, Dang LC, Bump NJ, Ferenz CR, Franklin S, Ghayur T, Hackett MC, Hammill LD, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706" } ], "reference": [ { "type": "PubMed", "id": "8044845", "url": "https://glygen.org/publication/PubMed/8044845" } ] }, { "title": "Interleukin 10 suppression of monocyte prostaglandin H synthase-2. Mechanism of inhibition of prostaglandin-dependent matrix metalloproteinase production.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Mertz PM, DeWitt DL, Stetler-Stevenson WG, Wahl LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8063757", "url": "https://glygen.org/publication/PubMed/8063757" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Interleukin 10 (IL-10) inhibits human lymphocyte interferon gamma-production by suppressing natural killer cell stimulatory factor/IL-12 synthesis in accessory cells.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "D'Andrea A, Aste-Amezaga M, Valiante NM, Ma X, Kubin M, Trinchieri G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8102388", "url": "https://glygen.org/publication/PubMed/8102388" } ] }, { "title": "Expression cloning and characterization of a human IL-10 receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Liu Y, Wei SH, Ho AS, de Waal Malefyt R, Moore KW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8120391", "url": "https://glygen.org/publication/PubMed/8120391" } ] }, { "title": "Interleukin 10 (IL-10) upregulates IL-1 receptor antagonist production from lipopolysaccharide-stimulated human polymorphonuclear leukocytes by delaying mRNA degradation.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Cassatella MA, Meda L, Gasperini S, Calzetti F, Bonora S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8163946", "url": "https://glygen.org/publication/PubMed/8163946" } ] }, { "title": "The effects of interleukin-10 on interleukin-1 receptor antagonist and interleukin-1 beta production in human monocytes and neutrophils.", "journal": "Lymphokine and cytokine research", "date": "1994", "authors": "Jenkins JK, Malyak M, Arend WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8186324", "url": "https://glygen.org/publication/PubMed/8186324" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "Macrophage-colony-stimulating factor expression by anti-CD45 stimulated human monocytes is transcriptionally up-regulated by IL-1 beta and inhibited by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Gruber MF, Williams CC, Gerrard TL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8301137", "url": "https://glygen.org/publication/PubMed/8301137" } ] }, { "title": "Interleukin 1 signaling occurs exclusively via the type I receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Sims JE, Gayle MA, Slack JL, Alderson MR, Bird TA, Giri JG, Colotta F, Re F, Mantovani A, Shanebeck K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8327496", "url": "https://glygen.org/publication/PubMed/8327496" } ] }, { "title": "Interleukin-1 type II receptor: a decoy target for IL-1 that is regulated by IL-4.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Colotta F, Re F, Muzio M, Bertini R, Polentarutti N, Sironi M, Giri JG, Dower SK, Sims JE, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8332913", "url": "https://glygen.org/publication/PubMed/8332913" } ] }, { "title": "The 31-kDa precursor of interleukin 1 alpha is myristoylated on specific lysines within the 16-kDa N-terminal propiece.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Stevenson F T, Bursten S L, Fanton C, Locksley R M, Lovett D H", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "reference": [ { "type": "PubMed", "id": "8346241", "url": "https://glygen.org/publication/PubMed/8346241" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Elevated plasma levels of tumor necrosis factor (TNF)-alpha, soluble TNF receptors, interleukin (IL)-6, and IL-10 in patients with hemorrhagic fever with renal syndrome.", "journal": "The Journal of infectious diseases", "date": "1996", "authors": "Linderholm M, Ahlm C, Settergren B, Waage A, Tarnvik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8537680", "url": "https://glygen.org/publication/PubMed/8537680" } ] }, { "title": "IRAK: a kinase associated with the interleukin-1 receptor.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Cao Z, Henzel WJ, Gao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8599092", "url": "https://glygen.org/publication/PubMed/8599092" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Receptors for interleukin (IL)-10 and IL-6-type cytokines use similar signaling mechanisms for inducing transcription through IL-6 response elements.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lai CF, Ripperger J, Morella KK, Jurlander J, Hawley TS, Carson WE, Kordula T, Caligiuri MA, Hawley RG, Fey GH, Baumann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8662928", "url": "https://glygen.org/publication/PubMed/8662928" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "Interleukin-10 drives human monocytes to CD16 positive macrophages.", "journal": "Journal of inflammation", "date": "1996", "authors": "Calzada-Wack JC, Frankenberger M, Ziegler-Heitbrock HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8734788", "url": "https://glygen.org/publication/PubMed/8734788" } ] }, { "title": "IL-4, IL-10 and IFN-gamma have distinct, but interacting, effects on differentiation-induced changes in TNF-alpha and TNF receptor release by cultured human monocytes.", "journal": "Cytokine", "date": "1996", "authors": "Joyce DA, Steer JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8742066", "url": "https://glygen.org/publication/PubMed/8742066" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "TRAF6 is a signal transducer for interleukin-1.", "journal": "Nature", "date": "1996", "authors": "Cao Z, Xiong J, Takeuchi M, Kurama T, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "8837778", "url": "https://glygen.org/publication/PubMed/8837778" } ] }, { "title": "Regulation of surface and soluble TNF receptor expression on human monocytes and synovial fluid macrophages by IL-4 and IL-10.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Hart PH, Hunt EK, Bonder CS, Watson CJ, Finlay-Jones JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8871669", "url": "https://glygen.org/publication/PubMed/8871669" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.", "journal": "Protein science : a publication of the Protein Society", "date": "1996", "authors": "Zdanov A, Schalk-Hihi C, Wlodawer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8897595", "url": "https://glygen.org/publication/PubMed/8897595" } ] }, { "title": "Stat3 recruitment by two distinct ligand-induced, tyrosine-phosphorylated docking sites in the interleukin-10 receptor intracellular domain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Weber-Nordt RM, Riley JK, Greenlund AC, Moore KW, Darnell JE, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8910398", "url": "https://glygen.org/publication/PubMed/8910398" } ] }, { "title": "Contrasting effects of IL-4, IL-10 and corticosteroids on RANTES production by human monocytes.", "journal": "International immunology", "date": "1996", "authors": "Marfaing-Koka A, Maravic M, Humbert M, Galanaud P, Emilie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8921438", "url": "https://glygen.org/publication/PubMed/8921438" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "IL-10 suppresses cell surface CD23/Fc epsilon RII expression, not by enhancing soluble CD23 release, but by reducing CD23 mRNA expression in human monocytes.", "journal": "Journal of clinical immunology", "date": "1996", "authors": "Morinobu A, Kumagai S, Yanagida H, Ota H, Ishida H, Matsui M, Yodoi J, Nakao K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "8946277", "url": "https://glygen.org/publication/PubMed/8946277" } ] }, { "title": "Activation of interferon-gamma inducing factor mediated by interleukin-1beta converting enzyme.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Gu Y, Kuida K, Tsutsui H, Ku G, Hsiao K, Fleming MA, Hayashi N, Higashino K, Okamura H, Nakanishi K, Kurimoto M, Tanimoto T, Flavell RA, Sato V, Harding MW, Livingston DJ, Su MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706" } ], "reference": [ { "type": "PubMed", "id": "8999548", "url": "https://glygen.org/publication/PubMed/8999548" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Rossi DL, Vicari AP, Franz-Bacon K, McClanahan TK, Zlotnik A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9013939", "url": "https://glygen.org/publication/PubMed/9013939" } ] }, { "title": "Caspase-1 processes IFN-gamma-inducing factor and regulates LPS-induced IFN-gamma production.", "journal": "Nature", "date": "1997", "authors": "Ghayur T, Banerjee S, Hugunin M, Butler D, Herzog L, Carter A, Quintal L, Sekut L, Talanian R, Paskind M, Wong W, Kamen R, Tracey D, Allen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-448706", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706" } ], "reference": [ { "type": "PubMed", "id": "9121587", "url": "https://glygen.org/publication/PubMed/9121587" } ] }, { "title": "Identification and functional characterization of a second chain of the interleukin-10 receptor complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Kotenko SV, Krause CD, Izotova LS, Pollack BP, Wu W, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9312047", "url": "https://glygen.org/publication/PubMed/9312047" } ] }, { "title": "IKK-1 and IKK-2: cytokine-activated IkappaB kinases essential for NF-kappaB activation.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Mercurio F, Zhu H, Murray BW, Shevchenko A, Bennett BL, Li J, Young DB, Barbosa M, Mann M, Manning A, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9346484", "url": "https://glygen.org/publication/PubMed/9346484" } ] }, { "title": "Interleukin-10 upregulates tumor necrosis factor receptor type-II (p75) gene expression in endotoxin-stimulated human monocytes.", "journal": "Blood", "date": "1997", "authors": "Dickensheets HL, Freeman SL, Smith MF, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9354687", "url": "https://glygen.org/publication/PubMed/9354687" } ] }, { "title": "Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Huang J, Gao X, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9371760", "url": "https://glygen.org/publication/PubMed/9371760" } ] }, { "title": "MyD88: an adapter that recruits IRAK to the IL-1 receptor complex.", "journal": "Immunity", "date": "1997", "authors": "Wesche H, Henzel WJ, Shillinglaw W, Li S, Cao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9430229", "url": "https://glygen.org/publication/PubMed/9430229" } ] }, { "title": "Interleukin 10 increases CCR5 expression and HIV infection in human monocytes.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Sozzani S, Ghezzi S, Iannolo G, Luini W, Borsatti A, Polentarutti N, Sica A, Locati M, Mackay C, Wells TN, Biswas P, Vicenzi E, Poli G, Mantovani A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9449724", "url": "https://glygen.org/publication/PubMed/9449724" } ] }, { "title": "IFN-gamma and IL-10 inhibit induction of IL-1 receptor type I and type II gene expression by IL-4 and IL-13 in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Dickensheets HL, Donnelly RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9550426", "url": "https://glygen.org/publication/PubMed/9550426" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "STCP-1 (MDC) CC chemokine acts specifically on chronically activated Th2 lymphocytes and is produced by monocytes on stimulation with Th2 cytokines IL-4 and IL-13.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Andrew DP, Chang MS, McNinch J, Wathen ST, Rihanek M, Tseng J, Spellberg JP, Elias CG 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9794440", "url": "https://glygen.org/publication/PubMed/9794440" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "Structural and biological stability of the human interleukin 10 homodimer.", "journal": "Biochemistry", "date": "1998", "authors": "Syto R, Murgolo NJ, Braswell EH, Mui P, Huang E, Windsor WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9836587", "url": "https://glygen.org/publication/PubMed/9836587" } ] }, { "title": "Identification of the receptor component of the IkappaBalpha-ubiquitin ligase.", "journal": "Nature", "date": "1998", "authors": "Yaron A, Hatzubai A, Davis M, Lavon I, Amit S, Manning AM, Andersen JS, Mann M, Mercurio F, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9859996", "url": "https://glygen.org/publication/PubMed/9859996" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Interleukin 10 (IL-10) inhibition of primary human prostate cell-induced angiogenesis: IL-10 stimulation of tissue inhibitor of metalloproteinase-1 and inhibition of matrix metalloproteinase (MMP)-2/MMP-9 secretion.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "1999", "authors": "Stearns ME, Rhim J, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6783783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783" } ], "reference": [ { "type": "PubMed", "id": "9918218", "url": "https://glygen.org/publication/PubMed/9918218" } ] }, { "title": "The SCFbeta-TRCP-ubiquitin ligase complex associates specifically with phosphorylated destruction motifs in IkappaBalpha and beta-catenin and stimulates IkappaBalpha ubiquitination in vitro.", "journal": "Genes & development", "date": "1999", "authors": "Winston JT, Strack P, Beer-Romero P, Chu CY, Elledge SJ, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9990852", "url": "https://glygen.org/publication/PubMed/9990852" } ] }, { "title": "Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.", "journal": "Genes & development", "date": "1999", "authors": "Spencer E, Jiang J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702" } ], "reference": [ { "type": "PubMed", "id": "9990853", "url": "https://glygen.org/publication/PubMed/9990853" } ] } ], "pathway": [ { "id": "hsa:3552", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3552", "resource": "KEGG Pathway" }, { "id": "R-HSA-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-448706", "name": "Interleukin-1 processing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-448706", "resource": "Reactome", "description": "Interleukin-1 processing" }, { "id": "R-HSA-5620971", "name": "Pyroptosis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620971", "resource": "Reactome", "description": "Pyroptosis" }, { "id": "R-HSA-6783783", "name": "Interleukin-10 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6783783", "resource": "Reactome", "description": "Interleukin-10 signaling" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-9020702", "name": "Interleukin-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "resource": "Reactome", "description": "Interleukin-1 signaling" }, { "id": "R-HSA-9660826", "name": "Purinergic signaling in leishmaniasis infection", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660826", "resource": "Reactome", "description": "Purinergic signaling in leishmaniasis infection" } ], "orthologs": [ { "uniprot_canonical_ac": "P01582-1", "protein_name": "Interleukin-1 alpha", "gene_name": "Il1a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETSKMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEETIQPRSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS", "length": 270 }, "evidence": [ { "id": "45934127", "url": "http://www.informatics.jax.org/homology/45934127", "database": "MGI" }, { "id": "P01583", "url": "https://omabrowser.org/oma/group/P01583/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P16598-1", "protein_name": "Interleukin-1 alpha", "gene_name": "Il1a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETSKMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEETIQPRSAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS", "length": 270 }, "evidence": [ { "id": "45934127", "url": "http://www.informatics.jax.org/homology/45934127", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P18430-1", "protein_name": "Interleukin-1 alpha", "gene_name": "IL1A", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTSKTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS", "length": 270 }, "evidence": [ { "id": "P01583", "url": "https://omabrowser.org/oma/group/P01583/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 42, "go_terms": [ { "name": "positive regulation of immature T cell proliferation in thymus", "id": "GO:0033092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033092", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "fever generation", "id": "GO:0001660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001660", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to gamma radiation", "id": "GO:0010332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010332", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "keratinization", "id": "GO:0031424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031424", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of vascular endothelial growth factor production", "id": "GO:0010575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010575", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "cellular response to heat", "id": "GO:0034605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034605", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of protein secretion", "id": "GO:0050714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050714", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "intracellular sodium ion homeostasis", "id": "GO:0006883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006883", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of cell division", "id": "GO:0051781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051781", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to copper ion", "id": "GO:0046688", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046688", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:2001240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001240", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of interleukin-2 production", "id": "GO:0032743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032743", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "ectopic germ cell programmed cell death", "id": "GO:0035234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035234", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to organonitrogen compound", "id": "GO:0010243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010243", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to ozone", "id": "GO:0010193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010193", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "response to L-ascorbic acid", "id": "GO:0033591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033591", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of prostaglandin secretion", "id": "GO:0032308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032308", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "connective tissue replacement involved in inflammatory response wound healing", "id": "GO:0002248", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002248", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of neutrophil migration", "id": "GO:1902624", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902624", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "negative regulation of establishment of Sertoli cell barrier", "id": "GO:1904445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904445", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "positive regulation of steroid biosynthetic process", "id": "GO:0010893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010893", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "copper ion binding", "id": "GO:0005507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005507", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" }, { "name": "interleukin-1 receptor binding", "id": "GO:0005149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005149", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated within its nuclear localization sequence, which impacts subcellular localization.", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "PubMed", "id": "26439902", "url": "https://glygen.org/publication/PubMed/26439902" } ] }, { "annotation": "Phosphorylated. Phosphorylation greatly enhances susceptibility to digestion and promotes the conversion of pre-IL1A alpha to the biologically active IL1A.", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "PubMed", "id": "3258335", "url": "https://glygen.org/publication/PubMed/3258335" } ] }, { "annotation": "Proteolytic processed by CAPN1 in a calcium-dependent manner. Cleavage from 31 kDa precursor to 18 kDa biologically active molecules.", "evidence": [ { "database": "UniProtKB", "id": "P01583", "url": "https://www.uniprot.org/uniprot/P01583" }, { "database": "PubMed", "id": "2115174", "url": "https://glygen.org/publication/PubMed/2115174" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 102, 141 ], "o_linked_sites": [], "snv_sites": [ 22, 102, 127, 139, 141, 143, 217 ], "glycation_sites": [], "phosphorylation_sites": [ 87 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 141, "end_pos": 143 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 259 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }